HHsearch alignment for GI: 255764495 and conserved domain: PRK11148

>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional.
Probab=100.00  E-value=3.8e-36  Score=256.66  Aligned_cols=239  Identities=14%  Similarity=0.128  Sum_probs=182.0

Q ss_pred             CCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCC--CCEEEECCCCCCCCCHHHH
Q ss_conf             55327889941114278854100022210001210000012330899999999996269--9799993744448998999
Q gi|255764495|r    6 TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHVSITGDIVNFTCNREI   83 (309)
Q Consensus         6 ~~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~--pD~vvitGDl~~~~~~~~~   83 (309)
T Consensus        12 ~~~m-kiiQISD~HL~~~~~~~----------------~~g~dt~~~l~~vl~~i~~~~~~~D~viiTGDLs~dgs~esY   74 (275)
T PRK11148         12 EARV-RILQITDTHLFADEHET----------------LLGVNTWESYQAVLEAIRAEQHEFDLIVATGDLAQDHSAEAY   74 (275)
T ss_pred             CCCE-EEEEEECCCCCCCCCCC----------------CCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHH
T ss_conf             9877-99998367758788763----------------527698999999999998459998899976402589999999


Q ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCC
Q ss_conf             99999998618997189994588422220356766432454313444445556212799719879998328888887554
Q gi|255764495|r   84 FTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA  163 (309)
Q Consensus        84 ~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~  163 (309)
T Consensus        75 ~~l~~~L~~l--~~P~~~lPGNHD~~~--~m-------~~~l~~~~-----~~~~~~v~~~~~w~iI~LDS~~~g---~~  135 (275)
T PRK11148         75 QHFAEGIAPL--RKPCVWLPGNHDFQP--AM-------YSALQDAG-----ISPAKHVLIGEHWQILLLDSQVFG---VP  135 (275)
T ss_pred             HHHHHHHHHC--CCCEEEECCCCCCHH--HH-------HHHHCCCC-----CCCCCEEEECCCEEEEEEECCCCC---CC
T ss_conf             9999999726--999899588762389--99-------98603266-----786532796498799999799999---77


Q ss_pred             CCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCC--CCCCHHHHHHHHHHC-CCEEEEECCCCCCEEEEEE
Q ss_conf             7600899999999998524336970899983768887643110--127978999999874-9819999876753247871
Q gi|255764495|r  164 NGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIK  240 (309)
Q Consensus       164 ~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~--~~~~~~~l~~~l~~~-~v~lvl~GH~H~~~~~~~~  240 (309)
T Consensus       136 ~G~L~~~qL~wL~~~L~~~~~--~~~lV~lHHpPv~ig~~wmD~~~L~N~~~l~~il~~~~~Vk~v~~GHvHq~~~~~~~  213 (275)
T PRK11148        136 HGELSEFQLEWLERKLADAPE--RHTLVLLHHHPLPAGSAWLDQHSLRNAHELAQVLAKFPNVKAILCGHIHQELDLDWN  213 (275)
T ss_pred             CCEECHHHHHHHHHHHHHCCC--CCEEEEEECCCCCCCCCCHHHHHCCCHHHHHHHHHHCCCEEEEEECCCCCHHHHEEC
T ss_conf             708399999999999974789--987999927984579832001118799999999974899049996265756770699


Q ss_pred             CCCCCEEEEEECCCCCCCCCC-------CCCCCEEEEEEECCCCEEEEEEEEEE
Q ss_conf             699868999957623577888-------87785489999538983899999951
Q gi|255764495|r  241 NEKKLIPVVGIASASQKVHSN-------KPQASYNLFYIEKKNEYWTLEGKRYT  287 (309)
Q Consensus       241 ~~~~~~~~~~~~s~~~~~~~~-------~~~~~y~li~i~~~~~~~~v~~~r~~  287 (309)
T Consensus       214 g----i~~~~tPSTc~QF~p~s~~f~~d~~~PGyR~l~L~~dG-~~~t~V~Rv~  262 (275)
T PRK11148        214 G----RRLLATPSTCVQFKPHCDNFTLDTIAPGWRELELHADG-SLETEVHRLA  262 (275)
T ss_pred             C----EEEEECCCCCEEECCCCCCCCCCCCCCCEEEEEECCCC-CEEEEEEECC
T ss_conf             9----99997487211146799875404889970799974899-5898999826