>pfam04042 DNA_pol_E_B DNA polymerase alpha/epsilon subunit B. This family contains a number of DNA polymerase subunits. The B subunit of the DNA polymerase alpha plays an essential role at the initial stage of DNA replication in S. cerevisiae and is phosphorylated in a cell cycle-dependent manner. DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast. In addition, DNA polymerase epsilon may be involved in DNA repair and cell-cycle checkpoint control. The enzyme consists of at least four subunits in mammalian cells as well as in yeast. The largest subunit of DNA polymerase epsilon is responsible for polymerase epsilon is responsible for polymerase activity. In mouse, the DNA polymerase epsilon subunit B is the second largest subunit of the DNA polymerase. A part of the N-terminal was found to be responsible for the interaction with SAP18. Experimental evidence suggests that this subunit may recruit histone deacetylase to the replication

Probab=97.58 E-value=0.0016 Score=42.02 Aligned_cols=76 Identities=17% Similarity=0.165 Sum_probs=53.9 Q ss_pred EEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCH----------- Q ss_conf 899411142788541000222100012100000123308999999999962699799993744448998----------- Q gi|255764495|r 12 LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCN----------- 80 (309) Q Consensus 12 i~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~----------- 80 (309) T Consensus 1 iv~~Sg~~~~~d-----------------------~~~~~~L~~ll~~~~~~~p~~lIL~GpF~~~~~~~~~~~~~~~~~ 57 (205) T pfam04042 1 IVFVSGLYLDGD-----------------------NKSLELLRDLLSGYNAAPPDRLVLAGPFLSAPHNLIASSAVNSTY 57 (205) T ss_pred CEEEECCCCCCC-----------------------CCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCC T ss_conf 989926886888-----------------------664799999998761579958999788878876544356434572 Q ss_pred --HHHHHHHHHHHHHCCCCCEEEEECCCCCCC Q ss_conf --999999999986189971899945884222 Q gi|255764495|r 81 --REIFTSTHWLRSIGNPHDISIVPGNHDAYI 110 (309) Q Consensus 81 --~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~ 110 (309) T Consensus 58 ~~~~~~~l~~~~~~i~~~~~vilvPg~~D~~~ 89 (205) T pfam04042 58 DFVFLKLLDGILEQLLSSTPVILVPGPNDPTN 89 (205) T ss_pred CHHHHHHHHHHHHHHCCCCEEEEECCCCCCCC T ss_conf 17799999999876402685999489876656

HHsearch alignment for GI: 255764495 and conserved domain: pfam04042