HHsearch results for GI: 255764495 and protein with PDBid: 1fjm_A

>1fjm_A Protein serine/threonine phosphatase-1 (alpha isoform, type 1); hydrolase, complex (hydrolase/toxin) complex; HET: ADD; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3
Probab=93.96  E-value=0.28  Score=25.81  Aligned_cols=65  Identities=17%  Similarity=0.179  Sum_probs=37.3

Q ss_pred             CCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCC
Q ss_conf             2797899999987498199998767532478716998689999576235778888778548999953898
Q gi|255764495|r  208 MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE  277 (309)
Q Consensus       208 ~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~y~li~i~~~~~  277 (309)
                      +.+.+.+.+.+++.+.++++-||.=...-..+. .++.  ++.+-|++..-...+  +.=.++.|+++..
T Consensus       226 ~fg~~~~~~Fl~~n~l~lIIR~He~v~~G~~~~-~~~~--viTvFSa~nY~~~~~--N~~ail~i~~~~~  290 (330)
T 1fjm_A          226 TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFF-AKRQ--LVTLFSAPNYCGEFD--NAGAMMSVDETLM  290 (330)
T ss_dssp             EECHHHHHHHHHHHTCSEEEECCSCCTTSEEEE-TTTT--EEEEBCCTTCCSSSC--CCEEEEEECTTCC
T ss_pred             ECCHHHHHHHHHHCCCCEEEECCCCCCCCEEEE-CCCC--EEEEECCCCCCCCCC--CCEEEEEECCCCC
T ss_conf             348899999999879907986385412770794-5994--899944874367888--7579999999884