HHsearch results for GI: 255764495 and protein with PDBid: 1uf3_A

>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6
Probab=99.89  E-value=9.4e-21  Score=153.92  Aligned_cols=211  Identities=15%  Similarity=0.088  Sum_probs=135.0

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCH-HHHHHHHH
Q ss_conf             78899411142788541000222100012100000123308999999999962699799993744448998-99999999
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCN-REIFTSTH   88 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~-~~~~~~~~   88 (309)
                      -+|+.+||+|-                            ..+.|+++++.+.+.+||+||++||+++.+.+ .++..+.+
T Consensus         6 ~~i~~~~d~hg----------------------------~~~ale~~l~~~~~~~~D~vv~~GDl~~~~~~~~~~~~~~~   57 (228)
T 1uf3_A            6 RYILATSNPMG----------------------------DLEALEKFVKLAPDTGADAIALIGNLMPKAAKSRDYAAFFR   57 (228)
T ss_dssp             CEEEEEECCTT----------------------------CHHHHHHHHTHHHHHTCSEEEEESCSSCTTCCHHHHHHHHH
T ss_pred             EEEEEEECCCC----------------------------CHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCHHHHHHHH
T ss_conf             29999956889----------------------------99999999998777299999987886999878299999999


Q ss_pred             HHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCC---CCCCC
Q ss_conf             998618997189994588422220356766432454313444445556212799719879998328888887---55476
Q gi|255764495|r   89 WLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPP---FSANG  165 (309)
Q Consensus        89 ~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~---~~~~g  165 (309)
                      .+...  ..|+++|+||||.+.........   .....   ..........+....+.+.+.++++......   .....
T Consensus        58 ~l~~~--~~pv~~v~GNHD~~~~~~~~~~~---~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  129 (228)
T 1uf3_A           58 ILSEA--HLPTAYVPGPQDAPIWEYLREAA---NVELV---HPEMRNVHETFTFWRGPYLVAGVGGEIADEGEPEEHEAL  129 (228)
T ss_dssp             HHGGG--CSCEEEECCTTSCSHHHHHHHHH---HHHHH---CTTEEECBTSEEEETTTEEEEEECSEEESSSCCBSSSSC
T ss_pred             HHHCC--CCCEEEEECCCCCHHHHHHHHHC---CCCCC---CCCCCCCCCEEEEECCCEEEEECCCCCCCCCCCCHHHHH
T ss_conf             74045--77589996899816752035531---42112---342200132268841877787417744677776023233


Q ss_pred             EECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCC
Q ss_conf             00899999999998524336970899983768887643110127978999999874981999987675324787169986
Q gi|255764495|r  166 YFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL  245 (309)
Q Consensus       166 ~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~  245 (309)
                      .....+..++...+....  ....|++.|+||......    ...+..+.+++++.++++++|||+|.+... +    +.
T Consensus       130 ~~~~~~~~~~~~~~~~~~--~~~~i~~~h~~~~~~~~~----~~~~~~~~~~~~~~~~~l~~~GH~H~~~~~-~----~~  198 (228)
T 1uf3_A          130 RYPAWVAEYRLKALWELK--DYPKIFLFHTMPYHKGLN----EQGSHEVAHLIKTHNPLLVLVAGKGQKHEM-L----GA  198 (228)
T ss_dssp             EEEHHHHHHHHGGGGGSC--SCCEEEEESSCBCBTTTB----TTSBHHHHHHHHHHCCSEEEECCSSCEEEE-E----TT
T ss_pred             HHHHHHHHHHHHHHHHCC--CCCEEEEEECCCCCCCCC----CCCCHHHHHHHHHCCCCEEEECCCCCCCEE-E----CC
T ss_conf             445889999999866403--551489871388765323----346255655555028867995784666138-8----98


Q ss_pred             EEEEEECCCCCCCCCCCCCCCEEEEEEECC
Q ss_conf             899995762357788887785489999538
Q gi|255764495|r  246 IPVVGIASASQKVHSNKPQASYNLFYIEKK  275 (309)
Q Consensus       246 ~~~~~~~s~~~~~~~~~~~~~y~li~i~~~  275 (309)
                      ..++..||.+.        +.|.+++++.+
T Consensus       199 ~~~in~Gs~~~--------g~y~i~d~~~~  220 (228)
T 1uf3_A          199 SWVVVPGDLSE--------GEYSLLDLRAR  220 (228)
T ss_dssp             EEEEECCBGGG--------TEEEEEETTTT
T ss_pred             EEEEECCCCCC--------CCEEEEEECCC
T ss_conf             89998887645--------82799995199