HHsearch results for GI: 255764495 and protein with PDBid: 1z2w_A

>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 1w24_A 2r17_A
Probab=99.69  E-value=1.2e-15  Score=120.40  Aligned_cols=176  Identities=19%  Similarity=0.291  Sum_probs=110.5

Q ss_pred             CCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHH
Q ss_conf             53278899411142788541000222100012100000123308999999999962699799993744448998999999
Q gi|255764495|r    7 TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTS   86 (309)
Q Consensus         7 ~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~   86 (309)
                      .-| ||+.|||+|.....                         ..+.+.+++.+++.++|.|+++||++..       ..
T Consensus         9 ~~M-kI~vISDtH~~~~~-------------------------~~l~~~~~~~~~~~~vD~iih~GDi~~~-------~~   55 (192)
T 1z2w_A            9 DRM-LVLVLGDLHIPHRC-------------------------NSLPAKFKKLLVPGKIQHILCTGNLCTK-------ES   55 (192)
T ss_dssp             --C-EEEEECCCCBTTTC-------------------------SSCCHHHHTTCCTTSCSEEEECSCCBSH-------HH
T ss_pred             CCE-EEEEEECCCCCCCC-------------------------CHHHHHHHHHHCCCCCCEEEECCCCCCH-------HH
T ss_conf             982-99999027889862-------------------------0167999998531699999999899877-------88


Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCE
Q ss_conf             99998618997189994588422220356766432454313444445556212799719879998328888887554760
Q gi|255764495|r   87 THWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGY  166 (309)
Q Consensus        87 ~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~  166 (309)
                      .++++.+.  .++++|.||||.....                                .....+                
T Consensus        56 ~~~l~~~~--~~v~~V~GN~D~~~~l--------------------------------~~~~~~----------------   85 (192)
T 1z2w_A           56 YDYLKTLA--GDVHIVRGDFDENLNY--------------------------------PEQKVV----------------   85 (192)
T ss_dssp             HHHHHHHC--SEEEECCCTTCCCTTS--------------------------------CSEEEE----------------
T ss_pred             HHHHHHCC--CCEEEEECCCCCCCCC--------------------------------CCEEEE----------------
T ss_conf             99887418--7379991687522267--------------------------------728999----------------


Q ss_pred             ECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCCE
Q ss_conf             08999999999985243369708999837688876431101279789999998749819999876753247871699868
Q gi|255764495|r  167 FGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI  246 (309)
Q Consensus       167 ~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~~  246 (309)
                                       .-...+|.++|.......       .+.+.+.+.+...++++++|||+|.+......+    .
T Consensus        86 -----------------~~~g~~i~~~Hg~~~~~~-------~~~~~l~~~~~~~~~divi~GHTH~p~~~~~~~----~  137 (192)
T 1z2w_A           86 -----------------TVGQFKIGLIHGHQVIPW-------GDMASLALLQRQFDVDILISGHTHKFEAFEHEN----K  137 (192)
T ss_dssp             -----------------EETTEEEEEECSCCCCBT-------TCHHHHHHHHHHHSSSEEECCSSCCCEEEEETT----E
T ss_pred             -----------------EECCCEEEEEECCCCCCC-------CCHHHHHHHHHHCCCCEEEECCCCCCEEEEECC----E
T ss_conf             -----------------978979999908976766-------588999999873589989978878503899999----9


Q ss_pred             EEEEECCCCCCCCC--CCCCCCEEEEEEECCCCEEEEEEEEEECCCCCEEEEE
Q ss_conf             99995762357788--8877854899995389838999999513776115753
Q gi|255764495|r  247 PVVGIASASQKVHS--NKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK  297 (309)
Q Consensus       247 ~~~~~~s~~~~~~~--~~~~~~y~li~i~~~~~~~~v~~~r~~~~~d~~~~~~  297 (309)
                      .+++.||++..+..  ....++|.+++++.+    .+++.-+.+..+...+|+
T Consensus       138 ~iiNPGS~~~pr~~~~~~~~~syaIld~~~~----~v~~~~~~l~~~~v~~e~  186 (192)
T 1z2w_A          138 FYINPGSATGAYNALETNIIPSFVLMDIQAS----TVVTYVYQLIGDDVKVER  186 (192)
T ss_dssp             EEEECCCTTCCCCSSCSCCCCEEEEEEEETT----EEEEEEEEEETTEEEEEE
T ss_pred             EEEECCCCCCCCCCCCCCCCCEEEEEEEECC----EEEEEEEEECCCCEEEEE
T ss_conf             9997998888888988888778999998399----999999993599399999