HHsearch results for GI: 255764495 and protein with PDBid: 2qjc_A

>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei}
Probab=98.48  E-value=4.6e-07  Score=63.87  Aligned_cols=66  Identities=24%  Similarity=0.276  Sum_probs=49.8

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHH-CCCCEEEECCCCCCCCCHHHHHHHHH
Q ss_conf             78899411142788541000222100012100000123308999999999962-69979999374444899899999999
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHVSITGDIVNFTCNREIFTSTH   88 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~-~~pD~vvitGDl~~~~~~~~~~~~~~   88 (309)
                      =||+.++|+|=                            ..+.|+++++.+.. .+.|.+|+.||+++.|....  ...+
T Consensus        19 gRi~viGDIHG----------------------------~~~~L~~lL~~i~~~~~~d~lv~lGDliDrGp~s~--~vl~   68 (262)
T 2qjc_A           19 GRVIIVGDIHG----------------------------CRAQLEDLLRAVSFKQGSDTLVAVGDLVNKGPDSF--GVVR   68 (262)
T ss_dssp             SCEEEECCCTT----------------------------CHHHHHHHHHHHTCCTTTSEEEECSCCSSSSSCHH--HHHH
T ss_pred             CCEEEEEECCC----------------------------CHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCH--HHHH
T ss_conf             98899995026----------------------------98999999996489989998998378317998839--9999


Q ss_pred             HHHHHCCCCCEEEEECCCCCC
Q ss_conf             998618997189994588422
Q gi|255764495|r   89 WLRSIGNPHDISIVPGNHDAY  109 (309)
Q Consensus        89 ~~~~l~~~~~v~~v~GNHD~~  109 (309)
                      ++.++    .+.+|.||||..
T Consensus        69 ~l~~~----~~~~v~GNHE~~   85 (262)
T 2qjc_A           69 LLKRL----GAYSVLGNHDAK   85 (262)
T ss_dssp             HHHHH----TCEECCCHHHHH
T ss_pred             HHHCC----CCEEECCCHHHH
T ss_conf             87646----645840647999