HHsearch results for GI: 255764495 and protein with PDBid: 3e0j_A

>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens}
Probab=98.45  E-value=4.3e-07  Score=64.04  Aligned_cols=217  Identities=12%  Similarity=0.126  Sum_probs=104.3

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC-----------
Q ss_conf             889941114278854100022210001210000012330899999999996269979999374444899-----------
Q gi|255764495|r   11 VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTC-----------   79 (309)
Q Consensus        11 ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~-----------   79 (309)
                      .++.+||+|+|.......+....+..   |..+....        .-+...+.++..||++||.+....           
T Consensus       202 ~i~fvSgL~ig~~~~~~~l~~~ll~d---~L~G~l~~--------~~~~~~as~I~rlIIaGn~v~~~~~~~d~~~~~~~  270 (476)
T 3e0j_A          202 FVLLVSGLGLGGGGGESLLGTQLLVD---VVTGQLGD--------EGEQCSAAHVSRVILAGNLLSHSTQSRDSINKAKY  270 (476)
T ss_dssp             EEEEECCCCBTSSCHHHHHHHHHHHH---HHHTCSSC--------HHHHHHHTTEEEEEEESCSBCC-------------
T ss_pred             CEEECCCCCEEECCCCCCHHHHHHHH---HHCCCCCC--------CCCCCCHHCEEEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             22431575212113543025789999---86075477--------43322010624999979937755567433454666


Q ss_pred             ---------HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHH-HHHHHHHCCCCCCCCCCCCCEEEEECCCEEE
Q ss_conf             ---------899999999998618997189994588422220356766-4324543134444455562127997198799
Q gi|255764495|r   80 ---------NREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSL-HAWKDYITSDTTCSTGKKLFPYLRIRNNIAL  149 (309)
Q Consensus        80 ---------~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  149 (309)
                               .+.+..+..++.++...++|.++|||||..........+ ....+...  ..........|+....+++.+
T Consensus       271 ~~k~~~~~~~~~~~~ld~~L~~i~~si~V~lmPG~~Dp~~~alPQqplh~~~fp~~~--~~~n~~~vtNP~~~~I~Gv~~  348 (476)
T 3e0j_A          271 LTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLAT--AYSTLQLVTNPYQATIDGVRF  348 (476)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHTTSCEEEECCTTSSSCSSSSCCCCCTTSCHHHH--TSTTEEECCSSEEEEETTEEE
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHC--CCCCEEEECCCEEEEECCEEE
T ss_conf             542111001899999999999724576499927886644445787876865622001--478408807986999999999


Q ss_pred             EEECCCCCCCCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEC
Q ss_conf             98328888887554760089999999999852433697089998376888764311012797899999987498199998
Q gi|255764495|r  150 IGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHG  229 (309)
Q Consensus       150 i~l~s~~~~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~G  229 (309)
                      ++...-....-.... .. +..++.++..|+.-           |-.|..+.+-+-....+.+-|  ++.+ -.+++++|
T Consensus       349 LgtsGq~i~Di~ky~-~~-~~~l~~me~~L~~r-----------hlaPtapdtl~~~P~~~~Dpf--vi~~-~Phv~f~G  412 (476)
T 3e0j_A          349 LGTSGQNVSDIFRYS-SM-EDHLEILEWTLRVR-----------HISPTAPDTLGCYPFYKTDPF--IFPE-CPHVYFCG  412 (476)
T ss_dssp             EECSSHHHHHHHHHS-CC-CCHHHHHHHHHHBT-----------CSCTTSCCC------CCSCTT--SCSS-CCSEEEEE
T ss_pred             EEECCCCHHHHHHHC-CC-CCHHHHHHHHHHHH-----------CCCCCCCCCEEECCCCCCCCE--EECC-CCCEEEEC
T ss_conf             997999889998746-87-99999999999973-----------747789982122205788961--3169-99789969


Q ss_pred             CCCCCEEEEEECCCCC-EEEEEECCCCC
Q ss_conf             7675324787169986-89999576235
Q gi|255764495|r  230 HTHLNSLHWIKNEKKL-IPVVGIASASQ  256 (309)
Q Consensus       230 H~H~~~~~~~~~~~~~-~~~~~~~s~~~  256 (309)
                      |.|.-....+.+..+. +..+.+|+.+.
T Consensus       413 nq~~f~t~~~~g~~~~~v~li~vP~F~~  440 (476)
T 3e0j_A          413 NTPSFGSKIIRGPEDQTVLLVTVPDFSA  440 (476)
T ss_dssp             EESSCEEEEEECSSCCEEEEEEEECHHH
T ss_pred             CCCCEEEEEEECCCCCEEEEEEECCCCC
T ss_conf             9774113688668886689998389777