Query         gi|255764495|ref|YP_003065022.2| putative phosphoesterase protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 309
No_of_seqs    192 out of 2664
Neff          9.8 
Searched_HMMs 23785
Date          Tue May 31 20:06:39 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 255764495.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3ib7_A ICC protein; metallopho 100.0 1.3E-33 5.3E-38  238.6  24.7  232   10-278    26-272 (330)
  2 3d03_A Phosphohydrolase; glyce 100.0   7E-31   3E-35  220.5  29.4  231   10-275     1-245 (274)
  3 2nxf_A Putative dimetal phosph 100.0 1.5E-26 6.5E-31  192.0  26.3  264    8-292     4-317 (322)
  4 2q8u_A Exonuclease, putative;   99.9 6.7E-25 2.8E-29  181.2  15.9  247    8-277    18-271 (336)
  5 1ii7_A MRE11 nuclease; RAD50,   99.9 1.7E-23   7E-28  172.0  10.6  239   10-272     1-245 (333)
  6 2yvt_A Hypothetical protein AQ  99.9 3.1E-21 1.3E-25  157.1  20.7  224   10-286     6-259 (260)
  7 1uf3_A Hypothetical protein TT  99.9 9.4E-21   4E-25  153.9  22.1  211   10-275     6-220 (228)
  8 1xzw_A Purple acid phosphatase  99.9 4.6E-20   2E-24  149.4  22.8  169   61-236   151-328 (426)
  9 2qfp_A Purple acid phosphatase  99.9 1.3E-19 5.5E-24  146.4  21.3  171   60-237   143-322 (424)
 10 1ute_A Protein (II purple acid  99.8 1.4E-19 5.7E-24  146.3  15.5  239    8-276     5-282 (313)
 11 1nnw_A Hypothetical protein; s  99.8 1.4E-20   6E-25  152.7   9.7  220    9-291     1-227 (252)
 12 1s3l_A Hypothetical protein MJ  99.7 6.5E-16 2.8E-20  122.1  16.7  163    4-275    21-183 (190)
 13 2a22_A Vacuolar protein sortin  99.7 1.4E-15 5.9E-20  119.9  17.0  183   12-299    28-212 (215)
 14 1z2w_A Vacuolar protein sortin  99.7 1.2E-15   5E-20  120.4  14.8  176    7-297     9-186 (192)
 15 1su1_A Hypothetical protein YF  99.6 6.3E-14 2.6E-18  109.0  14.3  161    4-272    21-187 (208)
 16 3ck2_A Conserved uncharacteriz  99.6 2.8E-13 1.2E-17  104.7  16.0  157   11-288     8-164 (176)
 17 2kkn_A Uncharacterized protein  99.5   1E-12 4.3E-17  101.1  16.1  159    4-284    18-176 (178)
 18 3gve_A YFKN protein; alpha-bet  99.3   8E-10 3.4E-14   82.0  19.9  255    6-288     8-310 (341)
 19 3jyf_A 2',3'-cyclic nucleotide  99.3 5.9E-10 2.5E-14   82.9  16.7  253    5-287     4-302 (339)
 20 2z1a_A 5'-nucleotidase; metal-  99.2 8.8E-09 3.7E-13   75.2  19.9  199    6-235    26-243 (552)
 21 3ive_A Nucleotidase; structura  99.2 8.7E-09 3.6E-13   75.2  19.2  227   10-252     7-253 (509)
 22 1xm7_A Hypothetical protein AQ  99.2   5E-10 2.1E-14   83.4  12.3  148   12-236     4-153 (195)
 23 1hp1_A 5'-nucleotidase; metall  99.2 8.9E-09 3.7E-13   75.2  18.3  213    6-239     5-236 (516)
 24 3c9f_A 5'-nucleotidase; 2',3'-  99.1   2E-08 8.2E-13   72.9  16.9  206    8-241    14-249 (557)
 25 2wdc_A SOXB, sulfur oxidation   98.9 1.3E-07 5.5E-12   67.5  16.2  197   49-277   103-322 (562)
 26 1g5b_A Serine/threonine protei  98.7 1.6E-07 6.8E-12   66.9  10.7   70    3-110    10-80  (221)
 27 2z72_A Protein-tyrosine-phosph  98.5 1.6E-06 6.6E-11   60.3  10.8   70   10-109    71-153 (342)
 28 2qjc_A Diadenosine tetraphosph  98.5 4.6E-07 1.9E-11   63.9   8.0   66   10-109    19-85  (262)
 29 3e0j_A DNA polymerase subunit   98.4 4.3E-07 1.8E-11   64.0   7.1  217   11-256   202-440 (476)
 30 2dfj_A Diadenosinetetraphospha  97.9 1.4E-05 5.9E-10   54.1   5.1   57   50-110    13-70  (280)
 31 3flo_A DNA polymerase alpha su  97.7  0.0024   1E-07   39.4  15.1  102   49-154   164-291 (460)
 32 2ie4_C PP2A-alpha;, serine/thr  97.0  0.0066 2.8E-07   36.5  10.0   59   54-112    66-124 (309)
 33 3h63_A Serine/threonine-protei  96.1   0.064 2.7E-06   30.0   9.7   45   67-111    90-134 (315)
 34 1wao_1 Serine/threonine protei  95.8    0.09 3.8E-06   29.1  11.1   77  208-291   383-459 (477)
 35 3icf_A PPT, serine/threonine-p  95.3    0.08 3.4E-06   29.4   7.9   60   53-112    79-139 (335)
 36 1aui_A Calcineurin, serine/thr  94.9   0.073 3.1E-06   29.7   6.7   78  208-291   259-339 (521)
 37 3e7a_A PP-1A, serine/threonine  94.7    0.19 8.2E-06   26.9  15.8   65  208-277   225-289 (299)
 38 1fjm_A Protein serine/threonin  94.0    0.28 1.2E-05   25.8  16.6   65  208-277   226-290 (330)
 39 1t71_A Phosphatase, conserved;  86.0     1.5 6.1E-05   21.1  15.8  190    8-247     4-200 (281)
 40 1xwy_A DNAse TATD, deoxyribonu  78.7     2.7 0.00011   19.3  12.1  136   53-231    21-159 (264)
 41 2z06_A Putative uncharacterize  78.1     2.8 0.00012   19.2  19.8  176   50-252    15-192 (252)
 42 1t70_A Phosphatase; crystal, X  74.7     3.5 0.00015   18.6  18.8  163   50-237    15-180 (255)
 43 2gzx_A Putative TATD related D  60.8     6.6 0.00028   16.8  12.4  127   53-222    18-144 (265)
 44 3hkx_A Amidase; alpha-beta-BET  60.3     4.9  0.0002   17.7   2.6   58   49-106    38-104 (283)
 45 2fyw_A Conserved hypothetical   59.2       7  0.0003   16.6   5.0   55   53-110    48-108 (267)
 46 3ot5_A UDP-N-acetylglucosamine  58.4     7.3  0.0003   16.5   5.1   46   51-104   101-146 (403)
 47 2gx8_A NIF3-related protein; s  54.4     8.4 0.00035   16.1   4.6   59   50-109    71-133 (397)
 48 2nyd_A UPF0135 protein SA1388;  51.6     9.3 0.00039   15.8   5.3   60   49-110    46-109 (370)
 49 1vgv_A UDP-N-acetylglucosamine  49.7      10 0.00042   15.6   5.7   46   51-104    73-118 (384)
 50 3dzc_A UDP-N-acetylglucosamine  47.1      11 0.00046   15.4   5.7   46   51-104    98-143 (396)
 51 1xrs_B D-lysine 5,6-aminomutas  46.5      11 0.00047   15.3   5.1   16  211-226   169-184 (262)
 52 1v4v_A UDP-N-acetylglucosamine  43.6      12 0.00052   15.0   5.4   47   50-104    77-123 (376)
 53 3beo_A UDP-N-acetylglucosamine  43.0      13 0.00053   14.9   5.2   46   51-104    82-127 (375)
 54 2yyb_A Hypothetical protein TT  42.7      13 0.00053   14.9   4.6   60   50-109    43-103 (242)
 55 1jlj_A Gephyrin; globular alph  41.8      13 0.00055   14.8   4.5   29   48-76     61-90  (189)
 56 1jmv_A USPA, universal stress   41.5      13 0.00056   14.8   7.2   50  169-232    63-112 (141)
 57 2yxb_A Coenzyme B12-dependent   35.2      17  0.0007   14.2   6.1   50   53-105    58-108 (161)
 58 2vgn_A DOM34; translation term  32.9      18 0.00076   13.9   5.5   19  214-232   338-356 (386)
 59 2qxy_A Response regulator; reg  32.6      18 0.00077   13.9   6.9   51   53-108    37-87  (142)
 60 3agj_B Protein pelota homolog;  32.3      18 0.00078   13.9   4.1   20  213-232   312-331 (358)
 61 3cfy_A Putative LUXO repressor  32.1      19 0.00078   13.8   6.6   51   54-108    38-88  (137)
 62 2g4r_A MOGA, molybdopterin bio  32.0      19 0.00078   13.8   4.4   28   48-76     47-74  (160)
 63 1j6o_A TATD-related deoxyribon  31.0      19 0.00081   13.7  12.0  137   52-231    28-167 (268)
 64 3bul_A Methionine synthase; tr  30.9      19 0.00082   13.7   5.3   51   53-106   138-188 (579)
 65 3hno_A Pyrophosphate-dependent  30.8      20 0.00082   13.7   5.4   56   49-108    89-145 (419)
 66 1nmo_A Hypothetical protein YB  29.5      20 0.00086   13.6   3.7   54   52-108    44-102 (247)
 67 1ccw_A Protein (glutamate muta  28.4      21  0.0009   13.4   5.1   51   52-105    42-93  (137)
 68 2f48_A Diphosphate--fructose-6  26.1      23 0.00099   13.2   5.9   60   44-107   146-206 (555)
 69 3mca_B Protein DOM34, elongati  25.7      24   0.001   13.1   4.4   21  213-233   331-351 (390)
 70 1x52_A Pelota homolog, CGI-17;  24.8      25   0.001   13.0   4.1   56   54-109    44-100 (124)
 71 1nln_A Adenain; thiol hydrolas  22.8      26  0.0011   12.9   1.3   25   15-41     12-36  (204)
 72 1gc5_A ADP-dependent glucokina  22.7      27  0.0011   12.8   1.4   57   50-106   217-283 (467)
 73 3m6m_D Sensory/regulatory prot  22.4      28  0.0012   12.7   7.2   54   54-107    48-101 (143)

No 1  
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, hydrolase; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A
Probab=100.00  E-value=1.3e-33  Score=238.61  Aligned_cols=232  Identities=16%  Similarity=0.196  Sum_probs=171.4

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHC--CCCEEEECCCCCCCCCHHHHHHHH
Q ss_conf             788994111427885410002221000121000001233089999999999626--997999937444489989999999
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVSITGDIVNFTCNREIFTST   87 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~--~pD~vvitGDl~~~~~~~~~~~~~   87 (309)
                      ++|+||||+||+......                .......+.|+++++.|++.  +||+||++|||++.|.+++|+.+.
T Consensus        26 ~~i~hiSD~Hl~~~~~~~----------------~~~~~~~~~l~~~l~~i~~~~~~pD~vvitGDl~~~g~~~~y~~~~   89 (330)
T 3ib7_A           26 YVLLHISDTHLIGGDRRL----------------YGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLR   89 (330)
T ss_dssp             EEEEEECCCCBCSSSCCB----------------TTTBCHHHHHHHHHHHHHHHTCCCSEEEECSCCBTTCCHHHHHHHH
T ss_pred             EEEEEECCCCCCCCCCCC----------------CCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHH
T ss_conf             899997888708987631----------------2574999999999999982298999999898778999999999999


Q ss_pred             HHHHHHC--CCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCC
Q ss_conf             9998618--99718999458842222035676643245431344444555621279971987999832888888755476
Q gi|255764495|r   88 HWLRSIG--NPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANG  165 (309)
Q Consensus        88 ~~~~~l~--~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g  165 (309)
                      ++++.+.  .+.|+++|+||||....         +..++....   .......+....+++.+++|||....   ...|
T Consensus        90 ~~l~~~~~~~~~pv~~v~GNHD~~~~---------~~~~~~~~~---~~~~~~~~~~~~~~~~~~~ldt~~~~---~~~G  154 (330)
T 3ib7_A           90 GLVEPFAAQLGAELVWVMGNHDDRAE---------LRKFLLDEA---PSMAPLDRVCMIDGLRIIVLDTSVPG---HHHG  154 (330)
T ss_dssp             HHHHHHHHHHTCEEEECCCTTSCHHH---------HHHHHHCCC---CCCSCCCEEEEETTEEEEECCCCCTT---CCSB
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCHHH---------HHHHHCCCC---CCCCCCEEEEEECCCEEEECCCCCCC---CCCC
T ss_conf             99999875249977995787764455---------544310136---66676304787078326643666678---7688


Q ss_pred             EECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCC--CCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCC
Q ss_conf             0089999999999852433697089998376888764311--01279789999998749819999876753247871699
Q gi|255764495|r  166 YFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLY--NRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK  243 (309)
Q Consensus       166 ~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~--~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~  243 (309)
                      .++++|++||++.|++.+.  ..+|+++||||......+.  ..+.+++.+.+++++++++++||||+|.+....+.|  
T Consensus       155 ~~~~~ql~wL~~~L~~~~~--~~~iv~~HHpp~~~~~~~~~~~~~~~~~~l~~ll~~~~v~~vl~GH~H~~~~~~~~G--  230 (330)
T 3ib7_A          155 EIRASQLGWLAEELATPAP--DGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVG--  230 (330)
T ss_dssp             CCCHHHHHHHHHHTTSCCT--TCEEEECSSCSSCCSSGGGGGGSBSCHHHHHHHHTTSSEEEEEECSSSSCEEEEETT--
T ss_pred             CCCHHHHHHHHHHHHHCCC--CCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCEEEECC--
T ss_conf             5599999999998864778--876999816985677753344334447999999974698199977788049379999--


Q ss_pred             CCEEEEEECCCCCCCC---------CCCCCCCEEEEEEECCCCE
Q ss_conf             8689999576235778---------8887785489999538983
Q gi|255764495|r  244 KLIPVVGIASASQKVH---------SNKPQASYNLFYIEKKNEY  278 (309)
Q Consensus       244 ~~~~~~~~~s~~~~~~---------~~~~~~~y~li~i~~~~~~  278 (309)
                        ++++.+||++....         .....+||++|++.+++..
T Consensus       231 --i~~~~~pst~~~~~~~~~~~~~~~~~~~~g~~~i~~~~d~~v  272 (330)
T 3ib7_A          231 --IPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVV  272 (330)
T ss_dssp             --EEEEECCCSSCEECTTSCTTCCCEESCSCEEEEEEECSSCEE
T ss_pred             --EEEEEECCCHHCCCCCCCCCCCCCCCCCCCEEEEEEECCCEE
T ss_conf             --999996962532667778887555568997599999599779


No 2  
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A
Probab=100.00  E-value=7e-31  Score=220.55  Aligned_cols=231  Identities=18%  Similarity=0.171  Sum_probs=165.2

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHC--CCCEEEECCCCCCCCCHHHHHHHH
Q ss_conf             788994111427885410002221000121000001233089999999999626--997999937444489989999999
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVSITGDIVNFTCNREIFTST   87 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~--~pD~vvitGDl~~~~~~~~~~~~~   87 (309)
                      -||+||||+||+......                .......+.++++++.+++.  +||+||++|||++.+.+++|+.+.
T Consensus         1 M~I~~iSD~Hl~~~~~~~----------------~~~~~~~~~l~~~~~~i~~~~~~~D~vv~tGDl~~~~~~~~y~~~~   64 (274)
T 3d03_A            1 MLLAHISDTHFRSRGEKL----------------YGFIDVNAANADVVSQLNALRERPDAVVVSGDIVNCGRPEEYQVAR   64 (274)
T ss_dssp             CEEEEECCCCBCSTTCCB----------------TTTBCHHHHHHHHHHHHHTCSSCCSEEEEESCCBSSCCHHHHHHHH
T ss_pred             CEEEEECCCCCCCCCCCC----------------CCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHH
T ss_conf             989999167679887310----------------1677899999999999983289999999887578899889999999


Q ss_pred             HHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEE
Q ss_conf             99986189971899945884222203567664324543134444455562127997198799983288888875547600
Q gi|255764495|r   88 HWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYF  167 (309)
Q Consensus        88 ~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~  167 (309)
                      ++++.+  +.|+++|+||||....  .......+.....      .......+....+++++++||+....   ...+.+
T Consensus        65 ~~l~~l--~~p~~~v~GNHD~~~~--~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~i~ldt~~~~---~~~~~l  131 (274)
T 3d03_A           65 QILGSL--NYPLYLIPGNHDDKAL--FLEYLQPLCPQLG------SDANNMRCAVDDFATRLLFIDSSRAG---TSKGWL  131 (274)
T ss_dssp             HHHTTC--SSCEEEECCTTSCHHH--HHHHHGGGSGGGC------SCGGGCCEEECSSSSEEEECCCCCTT---CSSBCC
T ss_pred             HHHHHH--CCCEEEECCCCCHHHH--HHHHHHHHCCCCC------CCCCCEEEEEECCCEEEEECCCCCCC---CCCCCC
T ss_conf             999872--8878996788634678--8987654301235------67786269995487589842577678---876401


Q ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCC--CCCCHHHHHHHHHHC-CCEEEEECCCCCCEEEEEECCCC
Q ss_conf             899999999998524336970899983768887643110--127978999999874-98199998767532478716998
Q gi|255764495|r  168 GQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKK  244 (309)
Q Consensus       168 ~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~--~~~~~~~l~~~l~~~-~v~lvl~GH~H~~~~~~~~~~~~  244 (309)
                      +++|++||++.|++.+.  ...+|++||||......+..  .+.+++++.++|+++ +|+++||||+|++....+.|   
T Consensus       132 ~~~~l~wL~~~L~~~~~--~~~iv~~Hhpp~~~~~~~~~~~~~~~~~~l~~~l~~~~~V~~vl~GH~H~~~~~~~~g---  206 (274)
T 3d03_A          132 TDETISWLEAQLFEGGD--KPATIFMHHPPLPLGNAQMDPIACENGHRLLALVERFPSLTRIFCGHNHSLTMTQYRQ---  206 (274)
T ss_dssp             CHHHHHHHHHHHHHHTT--SCEEEEESSCSSCCSCTTTGGGSBTTTHHHHHHHHHCTTEEEEEECSSSSCEEEEETT---
T ss_pred             CHHHHHHHHHHHHHCCC--CCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCHHHHEEECC---
T ss_conf             59999999999875106--6349999438746788654542466899999999837993299988548035069999---


Q ss_pred             CEEEEEECCCCCCCCCC---------CCCCCEEEEEEECC
Q ss_conf             68999957623577888---------87785489999538
Q gi|255764495|r  245 LIPVVGIASASQKVHSN---------KPQASYNLFYIEKK  275 (309)
Q Consensus       245 ~~~~~~~~s~~~~~~~~---------~~~~~y~li~i~~~  275 (309)
                       ++++.+||++......         ..+++|.+..+.+.
T Consensus       207 -i~~~~~pst~~q~~~~~~~~~~~~~~~p~~~~l~~~~~~  245 (274)
T 3d03_A          207 -ALISTLPGTVHQVPYCHADTDPYYDLSPASCLMHRQVGE  245 (274)
T ss_dssp             -EEEEECCCSSCBCCCCSSCCSCEEBCCCCEEEEEEEETT
T ss_pred             -EEEEECCCCHHCCCCCCCCCCCCCCCCCCEEEEEEEECC
T ss_conf             -999984841513647788887664448983899999599


No 3  
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12
Probab=99.96  E-value=1.5e-26  Score=191.99  Aligned_cols=264  Identities=14%  Similarity=0.035  Sum_probs=173.2

Q ss_pred             CEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCH------H
Q ss_conf             3278899411142788541000222100012100000123308999999999962699799993744448998------9
Q gi|255764495|r    8 IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCN------R   81 (309)
Q Consensus         8 ~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~------~   81 (309)
                      -.|+|+.|||+|++...........         ..+........++++++.+++++||+||++||+++.+..      +
T Consensus         4 p~f~f~~isD~h~~~~~~~~~~~~~---------~~~~~~~s~~~l~~ai~~~~~~~~dfVv~~GDl~d~~~~~~~~~~~   74 (322)
T 2nxf_A            4 PVFTFGLIADVQYADIEDGENYLRT---------RRRYYRGSADLLRDAVLQWRRERVQCVVQLGDIIDGHNRRRDASDR   74 (322)
T ss_dssp             CSEEEEEECCCCBCSSCCEECTTSS---------SEECTTHHHHHHHHHHHHHHHTTCSEEEECSCCBCTHHHHTTCHHH
T ss_pred             CCEEEEEEECCCCCCCCCCCCCCCC---------CHHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHH
T ss_conf             7179999831787777765233443---------0345666699999999997337999999999878898852368999


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHH---HHHC-CCCCCCCCCCCCEEEEECCCEEEEEECCCCC
Q ss_conf             99999999986189971899945884222203567664324---5431-3444445556212799719879998328888
Q gi|255764495|r   82 EIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWK---DYIT-SDTTCSTGKKLFPYLRIRNNIALIGCSTAIA  157 (309)
Q Consensus        82 ~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~---~~~~-~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~  157 (309)
                      .++.+.+.++.+  ..|+++++||||...............   .... ..................+++.++.+++...
T Consensus        75 ~~~~~~~~~~~~--~~p~~~~~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~ld~~~~  152 (322)
T 2nxf_A           75 ALDTVMAELDAC--SVDVHHVWGNHEFYNFSRPSLLSSRLNSAQRTGTDTGSDLIGDDIYAYEFSPAPNFRFVLLDAYDL  152 (322)
T ss_dssp             HHHHHHHHHHTT--CSEEEECCCHHHHHHCCHHHHHTSTTCCCC------CEECGGGTCCCEEEEEETTEEEEECCTTSB
T ss_pred             HHHHHHHHHHHC--CCCEEEECCCCCCCCCCCHHHCCCCCCCHHHHCCCCCCCCCCCCCCEEEEECCCCEEEEEECCCCC
T ss_conf             999999999865--997898268775222330000001234122211223322257787404764179769999657543


Q ss_pred             CC---------------------------------------CCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCC
Q ss_conf             88---------------------------------------755476008999999999985243369708999837688
Q gi|255764495|r  158 TP---------------------------------------PFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPV  198 (309)
Q Consensus       158 ~~---------------------------------------~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~  198 (309)
                      ..                                       .....+.+.++|++||++.|++++..+..+|++.|||+.
T Consensus       153 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q~~wl~~~L~~~~~~~~~~iv~~H~p~~  232 (322)
T 2nxf_A          153 SVIGREEESEKHTHSWRILTQHNHNLQDLNLPPVSVGLEQRFVKFNGGFSEQQLQWLDAVLTLSDHKQERVLIFSHLPVH  232 (322)
T ss_dssp             CSSSSCTTSHHHHHHHHHHHHHCCCTTCTTSCSCSSSGGGGCSTTCCBCCHHHHHHHHHHHHHHHHHTCEEEEEESSCCC
T ss_pred             CCCCCCCCCCCHHCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             44456656521001100001246662100355322355555444455688999999999998626428748999921897


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHC-CCEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCC
Q ss_conf             87643110127978999999874-98199998767532478716998689999576235778888778548999953898
Q gi|255764495|r  199 LDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE  277 (309)
Q Consensus       199 ~~~~~~~~~~~~~~~l~~~l~~~-~v~lvl~GH~H~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~y~li~i~~~~~  277 (309)
                      .........+.+.+++.++|.++ +|.++||||+|.......   ...+..+.++|....+   ....+|.++++.++  
T Consensus       233 ~~~~~~~~~~~~~~~~~~~l~~~~~V~~v~~GH~H~~~~~~~---~~gi~~v~~~~~~~~~---~~~~~~~~~~~~~d--  304 (322)
T 2nxf_A          233 PCAADPICLAWNHEAVLSVLRSHQSVLCFIAGHDHDGGRCTD---SSGAQHITLEGVIETP---PHSHAFATAYLYED--  304 (322)
T ss_dssp             TTSSCGGGSCTTHHHHHHHHHTCTTEEEEEECSCTTCEEEEC---TTSCEEEECCCGGGCC---TTSCEEEEEEECSS--
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCEEEC---CCCCEEEECCEECCCC---CCCCCEEEEEEECC--
T ss_conf             777887631134999999997489846999477478863344---4897699778020268---99998899999899--


Q ss_pred             EEEEEEEEEECCCCC
Q ss_conf             389999995137761
Q gi|255764495|r  278 YWTLEGKRYTLSPDS  292 (309)
Q Consensus       278 ~~~v~~~r~~~~~d~  292 (309)
                        +|++..+....|+
T Consensus       305 --~~~i~~~~~~~~~  317 (322)
T 2nxf_A          305 --RMVMKGRGRVEDL  317 (322)
T ss_dssp             --EEEEEEEETSCCE
T ss_pred             --EEEEEEEEEEEEE
T ss_conf             --9999989876137


No 4  
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8}
Probab=99.93  E-value=6.7e-25  Score=181.21  Aligned_cols=247  Identities=14%  Similarity=0.081  Sum_probs=136.4

Q ss_pred             CEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC---HHHHH
Q ss_conf             327889941114278854100022210001210000012330899999999996269979999374444899---89999
Q gi|255764495|r    8 IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTC---NREIF   84 (309)
Q Consensus         8 ~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~---~~~~~   84 (309)
                      .| ||+|+||+|||.........            ..+.......++++++.+.+++||+|+++|||++.+.   .+...
T Consensus        18 ~M-kilH~SDlHLG~~~~~~~~~------------~~~~~~~~~~l~~i~~~a~~~~~D~vliaGDlf~~~~~~~~~~~~   84 (336)
T 2q8u_A           18 EL-KILHTSDWHLGVTSWTSSRP------------VDRREELKKALDKVVEEAEKREVDLILLTGDLLHSRNNPSVVALH   84 (336)
T ss_dssp             EE-EEEEEECCCBTCEECTTTCC------------EECHHHHHHHHHHHHHHHHHHTCSEEEEESCSBSCSSCCCHHHHH
T ss_pred             CC-EEEEEECCCCCCCCCCCCCC------------HHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHH
T ss_conf             75-89898046799877775541------------568999999999999999974999999898777799988899999


Q ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCC--EEEEEECCCCCCCCC-
Q ss_conf             99999986189971899945884222203567664324543134444455562127997198--799983288888875-
Q gi|255764495|r   85 TSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNN--IALIGCSTAIATPPF-  161 (309)
Q Consensus        85 ~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~i~l~s~~~~~~~-  161 (309)
                      .+..+++.+....|+++++||||.+...............    ......... .......+  +.++++......... 
T Consensus        85 ~~~~~~~~l~~~~~v~~i~GNHD~~~~~~~~~~~~~~~~~----~~~~~~~~~-~~~~~~~~~~v~~~~~~~~~~~~~~~  159 (336)
T 2q8u_A           85 DLLDYLKRMMRTAPVVVLPGNHDWKGLKLFGNFVTSISSD----ITFVMSFEP-VDVEAKRGQKVRILPFPYPDESEALR  159 (336)
T ss_dssp             HHHHHHHHHHHHSCEEECCC------CHHHHHHHHHHCSS----EEECCSSSC-EEEECTTSCEEEEEEECCC-------
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCHHHHCCHHHHHHCCCC----CEECCCCCC-EEEECCCCCEEEEECCCCCCCCCCCC
T ss_conf             9999999874289789945764641000110022210455----001145565-68870279669994366643000123


Q ss_pred             CCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEEC
Q ss_conf             54760089999999999852433697089998376888764311012797899999987498199998767532478716
Q gi|255764495|r  162 SANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN  241 (309)
Q Consensus       162 ~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~  241 (309)
                      ...+.......++++..++.+..+..+.|+++|++.............+...+.+.+...+++++++||+|.++...-  
T Consensus       160 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~I~~~H~~v~~~~~~~~~~~~~~~~~~~~~~~~~~d~v~~GH~H~~~~~~~--  237 (336)
T 2q8u_A          160 KNEGDFRFFLESRLNKLYEEALKKEDFAIFMGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIHSFREIQK--  237 (336)
T ss_dssp             CCSSHHHHHHHHHHHHHHHHHHTCSSEEEEEEESEETTCC--------CCCEECGGGSCTTSSEEEEESCSSCEEEEE--
T ss_pred             CCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEEEECCCCCCEEECC--
T ss_conf             330678899999999999873264665399875421576666752237654551666313862899277757558779--


Q ss_pred             CCCCEEEEEECCCCC-CCCCCCCCCCEEEEEEECCCC
Q ss_conf             998689999576235-778888778548999953898
Q gi|255764495|r  242 EKKLIPVVGIASASQ-KVHSNKPQASYNLFYIEKKNE  277 (309)
Q Consensus       242 ~~~~~~~~~~~s~~~-~~~~~~~~~~y~li~i~~~~~  277 (309)
                       .+.  +..+||... ++...+...||.+++++.++.
T Consensus       238 -~~~--i~y~Gs~~~~~~~E~~~~kg~~lvdi~~~~~  271 (336)
T 2q8u_A          238 -QPL--TIYPGSLIRIDFGEEADEKGAVFVELKRGEP  271 (336)
T ss_dssp             -TTE--EEECCCSSCCSGGGTTCCCEEEEEEEETTSC
T ss_pred             -CCC--EEECCCCCCCCCCCCCCCCEEEEEEECCCCC
T ss_conf             -998--8973896267725147998799999828981


No 5  
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A
Probab=99.90  E-value=1.7e-23  Score=172.04  Aligned_cols=239  Identities=18%  Similarity=0.162  Sum_probs=118.4

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCC--CHHHHHHHH
Q ss_conf             788994111427885410002221000121000001233089999999999626997999937444489--989999999
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFT--CNREIFTST   87 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~--~~~~~~~~~   87 (309)
                      -||+|+||+|||.....               ...+.......++++++.+.+++||+|+++||+++.+  +.+....+.
T Consensus         1 Mkilh~SD~HlG~~~~~---------------~~~~~~~~~~~~~~~v~~a~~~~vD~vli~GDlfd~~~~~~~~~~~~~   65 (333)
T 1ii7_A            1 MKFAHLADIHLGYEQFH---------------KPQREEEFAEAFKNALEIAVQENVDFILIAGDLFHSSRPSPGTLKKAI   65 (333)
T ss_dssp             CEEEEECCCCBTCCGGG---------------CHHHHHHHHHHHHHHHHHHHHTTCSEEEEESCSBSSSSCCHHHHHHHH
T ss_pred             CEEEEEECCCCCCCCCC---------------CHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHH
T ss_conf             97799913888888778---------------445799999999999999987399999989887889989999999999


Q ss_pred             HHHHHHCC-CCCEEEEECCCCCCCCCHHH-HHHHHHH-HHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCC
Q ss_conf             99986189-97189994588422220356-7664324-543134444455562127997198799983288888875547
Q gi|255764495|r   88 HWLRSIGN-PHDISIVPGNHDAYISGAKE-KSLHAWK-DYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSAN  164 (309)
Q Consensus        88 ~~~~~l~~-~~~v~~v~GNHD~~~~~~~~-~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~  164 (309)
                      +++..|.. .+|+++|+||||.+...... ....... ..........................++.-  ..........
T Consensus        66 ~~~~~l~~~~ipv~~i~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~  143 (333)
T 1ii7_A           66 ALLQIPKEHSIPVFAIEGNHDRTQRGPSVLNLLEDFGLVYVIGMRKEKVENEYLTSERLGNGEYLVKG--VYKDLEIHGM  143 (333)
T ss_dssp             HHHHHHHTTTCCEEEECCTTTCCSSSCCHHHHHHHTTSCEECEEESSCCCSSSEEEEECTTSCEEEEE--EETTEEEEEE
T ss_pred             HHHHHHHHCCCCEEEECCCCCCHHCCHHHHHHHHHCCCEEEECCCCCCCCCEEEECCCCCCCEEEEEC--CCCCCEEECC
T ss_conf             99999986899599964666621000357888986696487045554444405520223652157404--6676134223


Q ss_pred             CEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCC
Q ss_conf             60089999999999852433697089998376888764311012797899999987498199998767532478716998
Q gi|255764495|r  165 GYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK  244 (309)
Q Consensus       165 g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~  244 (309)
                      ............+.+..........|+++|+................   .......+++++++||+|.++.....+   
T Consensus       144 ~~~~~~~~~~~~~~~~~~~~~~~~~i~~~h~~~~~~~~~~~~~~~~~---~~~~~~~~~d~v~~GH~H~~~~~~~~~---  217 (333)
T 1ii7_A          144 KYMSSAWFEANKEILKRLFRPTDNAILMLHQGVREVSEARGEDYFEI---GLGDLPEGYLYYALGHIHKRYETSYSG---  217 (333)
T ss_dssp             CCCCHHHHHSSTTHHHHHCCCCSSEEEEEECCBHHHHHTTTCCCCSB---CGGGSCTTCSEEEEESCSSCEEEEETT---
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCCCCC---CCCCCCCCCCEEECCCCCCCEEECCCC---
T ss_conf             20046788999875431248877736888631245556677643212---210144468779727675873524399---


Q ss_pred             CEEEEEECCCCCC-CCCCCCCCCEEEEEE
Q ss_conf             6899995762357-788887785489999
Q gi|255764495|r  245 LIPVVGIASASQK-VHSNKPQASYNLFYI  272 (309)
Q Consensus       245 ~~~~~~~~s~~~~-~~~~~~~~~y~li~i  272 (309)
                       .+++.+||.... +...+...++.++.+
T Consensus       218 -~~i~y~GS~~~~~f~e~~~~~~~~~~~~  245 (333)
T 1ii7_A          218 -SPVVYPGSLERWDFGDYEVRYEWDGIKF  245 (333)
T ss_dssp             -EEEEECCCSSCCSGGGCSEEEEECSSSE
T ss_pred             -CEEEECCCCCCCCCCCCCCCCCEEEEEE
T ss_conf             -3699859831227652366663599996


No 6  
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national project on protein structural and functional analyses; 1.60A {Aquifex aeolicus VF5} SCOP: d.159.1.6
Probab=99.89  E-value=3.1e-21  Score=157.07  Aligned_cols=224  Identities=13%  Similarity=0.116  Sum_probs=141.0

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHH----
Q ss_conf             7889941114278854100022210001210000012330899999999996269979999374444899899999----
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFT----   85 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~----   85 (309)
                      .||+.|||+|-.                            .+.|+++++.+++++||+||++|||++.+...+...    
T Consensus         6 ~~i~~isD~h~~----------------------------~~~l~~l~~~~~~~~~D~vl~~GDl~~~~~~~~~~~~~~~   57 (260)
T 2yvt_A            6 RKVLAIKNFKER----------------------------FDLLPKLKGVIAEKQPDILVVVGNILKNEALEKEYERAHL   57 (260)
T ss_dssp             CEEEEEECCTTC----------------------------GGGHHHHHHHHHHHCCSEEEEESCCCCCHHHHHHHHHHHH
T ss_pred             EEEEEEECCCCC----------------------------HHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHH
T ss_conf             589999537999----------------------------8999999998877499999991687899987589999998


Q ss_pred             --------------------HHHHHHHH-CCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEC
Q ss_conf             --------------------99999861-899718999458842222035676643245431344444555621279971
Q gi|255764495|r   86 --------------------STHWLRSI-GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIR  144 (309)
Q Consensus        86 --------------------~~~~~~~l-~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  144 (309)
                                          +..+++.+ ....|+++++||||.............      ..................
T Consensus        58 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~GNHD~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~  131 (260)
T 2yvt_A           58 ARREPNRKVIHENEHYIIETLDKFFREIGELGVKTFVVPGKNDAPLKIFLRAAYEA------ETAYPNIRVLHEGFAGWR  131 (260)
T ss_dssp             TTCCCCTHHHHHHHHHHHHHHHHHHHHHHTTCSEEEEECCTTSCCHHHHHHHHHHT------TTTCTTEEECSSEEEEET
T ss_pred             HHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHCCC------CCCCCCCCCCCCEEEEEC
T ss_conf             76454550775026631889999999998559963886288617665456664164------212344212342489953


Q ss_pred             CCEEEEEECCCCCCCC--CCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCC---CCCCCCCHHHHHHHHH
Q ss_conf             9879998328888887--5547600899999999998524336970899983768887643---1101279789999998
Q gi|255764495|r  145 NNIALIGCSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSS---LYNRMFGIQRFQKMIW  219 (309)
Q Consensus       145 ~~~~~i~l~s~~~~~~--~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~---~~~~~~~~~~l~~~l~  219 (309)
                      +...+.+........+  ..........+..|++..++..  .....++++||||......   ......+.+.+.+++.
T Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~l~  209 (260)
T 2yvt_A          132 GEFEVIGFGGLLTEHEFEEDFVLKYPRWYVEYILKFVNEL--KPRRLVTIFYTPPIGEFVDRTPEDPKHHGSAVVNTIIK  209 (260)
T ss_dssp             TTEEEEEECSEEESSCCBSSSSCEEEHHHHHHHGGGGGGS--CCCEEEEEESSCCSCSSTTCBTTBSCCCSCHHHHHHHH
T ss_pred             CCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH--CCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             9779998457768744530444434567899998765320--23550578853873224554532220136799999987


Q ss_pred             HCCCEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEEE
Q ss_conf             7498199998767532478716998689999576235778888778548999953898389999995
Q gi|255764495|r  220 HEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRY  286 (309)
Q Consensus       220 ~~~v~lvl~GH~H~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~y~li~i~~~~~~~~v~~~r~  286 (309)
                      +.++++++|||+|+++. .+    +..+++.+||...        .+|.+++++.+    ++++.++
T Consensus       210 ~~~~~~vi~GH~H~~~~-~~----g~~~iv~pGs~~~--------~~y~~i~~~~~----~~~~~~~  259 (260)
T 2yvt_A          210 SLNPEVAIVGHVGKGHE-LV----GNTIVVNPGEFEE--------GRYAFLDLTQH----KIKLEQF  259 (260)
T ss_dssp             HHCCSEEEECSSCCEEE-EE----TTEEEEECCBGGG--------TEEEEEETTTT----EEEEEEC
T ss_pred             HCCCCEEEEECCCCCEE-EE----CCEEEEECCCCCC--------CCEEEEEECCC----EEEEEEC
T ss_conf             61997999954468848-75----9879998995544--------91799998399----6999977


No 7  
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6
Probab=99.89  E-value=9.4e-21  Score=153.92  Aligned_cols=211  Identities=15%  Similarity=0.088  Sum_probs=135.0

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCH-HHHHHHHH
Q ss_conf             78899411142788541000222100012100000123308999999999962699799993744448998-99999999
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCN-REIFTSTH   88 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~-~~~~~~~~   88 (309)
                      -+|+.+||+|-                            ..+.|+++++.+.+.+||+||++||+++.+.+ .++..+.+
T Consensus         6 ~~i~~~~d~hg----------------------------~~~ale~~l~~~~~~~~D~vv~~GDl~~~~~~~~~~~~~~~   57 (228)
T 1uf3_A            6 RYILATSNPMG----------------------------DLEALEKFVKLAPDTGADAIALIGNLMPKAAKSRDYAAFFR   57 (228)
T ss_dssp             CEEEEEECCTT----------------------------CHHHHHHHHTHHHHHTCSEEEEESCSSCTTCCHHHHHHHHH
T ss_pred             EEEEEEECCCC----------------------------CHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCHHHHHHHH
T ss_conf             29999956889----------------------------99999999998777299999987886999878299999999


Q ss_pred             HHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCC---CCCCC
Q ss_conf             998618997189994588422220356766432454313444445556212799719879998328888887---55476
Q gi|255764495|r   89 WLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPP---FSANG  165 (309)
Q Consensus        89 ~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~---~~~~g  165 (309)
                      .+...  ..|+++|+||||.+.........   .....   ..........+....+.+.+.++++......   .....
T Consensus        58 ~l~~~--~~pv~~v~GNHD~~~~~~~~~~~---~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  129 (228)
T 1uf3_A           58 ILSEA--HLPTAYVPGPQDAPIWEYLREAA---NVELV---HPEMRNVHETFTFWRGPYLVAGVGGEIADEGEPEEHEAL  129 (228)
T ss_dssp             HHGGG--CSCEEEECCTTSCSHHHHHHHHH---HHHHH---CTTEEECBTSEEEETTTEEEEEECSEEESSSCCBSSSSC
T ss_pred             HHHCC--CCCEEEEECCCCCHHHHHHHHHC---CCCCC---CCCCCCCCCEEEEECCCEEEEECCCCCCCCCCCCHHHHH
T ss_conf             74045--77589996899816752035531---42112---342200132268841877787417744677776023233


Q ss_pred             EECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCC
Q ss_conf             00899999999998524336970899983768887643110127978999999874981999987675324787169986
Q gi|255764495|r  166 YFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL  245 (309)
Q Consensus       166 ~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~  245 (309)
                      .....+..++...+....  ....|++.|+||......    ...+..+.+++++.++++++|||+|.+... +    +.
T Consensus       130 ~~~~~~~~~~~~~~~~~~--~~~~i~~~h~~~~~~~~~----~~~~~~~~~~~~~~~~~l~~~GH~H~~~~~-~----~~  198 (228)
T 1uf3_A          130 RYPAWVAEYRLKALWELK--DYPKIFLFHTMPYHKGLN----EQGSHEVAHLIKTHNPLLVLVAGKGQKHEM-L----GA  198 (228)
T ss_dssp             EEEHHHHHHHHGGGGGSC--SCCEEEEESSCBCBTTTB----TTSBHHHHHHHHHHCCSEEEECCSSCEEEE-E----TT
T ss_pred             HHHHHHHHHHHHHHHHCC--CCCEEEEEECCCCCCCCC----CCCCHHHHHHHHHCCCCEEEECCCCCCCEE-E----CC
T ss_conf             445889999999866403--551489871388765323----346255655555028867995784666138-8----98


Q ss_pred             EEEEEECCCCCCCCCCCCCCCEEEEEEECC
Q ss_conf             899995762357788887785489999538
Q gi|255764495|r  246 IPVVGIASASQKVHSNKPQASYNLFYIEKK  275 (309)
Q Consensus       246 ~~~~~~~s~~~~~~~~~~~~~y~li~i~~~  275 (309)
                      ..++..||.+.        +.|.+++++.+
T Consensus       199 ~~~in~Gs~~~--------g~y~i~d~~~~  220 (228)
T 1uf3_A          199 SWVVVPGDLSE--------GEYSLLDLRAR  220 (228)
T ss_dssp             EEEEECCBGGG--------TEEEEEETTTT
T ss_pred             EEEEECCCCCC--------CCEEEEEECCC
T ss_conf             89998887645--------82799995199


No 8  
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1
Probab=99.88  E-value=4.6e-20  Score=149.37  Aligned_cols=169  Identities=15%  Similarity=0.079  Sum_probs=111.6

Q ss_pred             HHCCCCEEEECCCCCCCC-----CHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHH--HHHHHHHHHCCCCCCCC
Q ss_conf             626997999937444489-----98999999999986189971899945884222203567--66432454313444445
Q gi|255764495|r   61 LLHNVDHVSITGDIVNFT-----CNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEK--SLHAWKDYITSDTTCST  133 (309)
Q Consensus        61 ~~~~pD~vvitGDl~~~~-----~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~--~~~~~~~~~~~~~~~~~  133 (309)
                      +..+||+|+++||++...     ....+....+.++.+....|+++++||||.........  ....+...+........
T Consensus       151 ~~~~~dfvl~~GD~~Y~~~~~~~~~~~wd~~~~~~~~~~~~~P~~~~~GNHE~~~~~~~~~~~~~~~~~~~f~~~~~~~~  230 (426)
T 1xzw_A          151 NSAKGQAVLFMGDLSYSNRWPNHDNNRWDTWGRFSERSVAYQPWIWTAGNHEIDYAPDIGEYQPFVPFTNRYPTPHEASG  230 (426)
T ss_dssp             CTTCCSEEEECSCCCCGGGSGGGCTHHHHHHHHHHHHHHTTSCEECCCCGGGCCCBGGGTBCSTTHHHHHHSCCCCGGGT
T ss_pred             CCCCCCEEEECCCEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCC
T ss_conf             07787589965774304645442157888998776778604966983475455666665554436527761888644567


Q ss_pred             CCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEECHHHHHHHHHHHHHCCCC-CCEEEEEEECCCCCCCCCCC-CCCCCH
Q ss_conf             5562127997198799983288888875547600899999999998524336-97089998376888764311-012797
Q gi|255764495|r  134 GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK-GFFRIIMMHHPPVLDTSSLY-NRMFGI  211 (309)
Q Consensus       134 ~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~~~~q~~~l~~~L~~~~~~-~~~~iv~~Hhpp~~~~~~~~-~~~~~~  211 (309)
                      ......|....++++++.|||......       ..+|++||++.|+++... ..++|+++|||+........ ....-+
T Consensus       231 ~~~~~~Ysf~~g~v~fi~lds~~~~~~-------~~~Q~~WL~~~L~~~~~~~~~w~iv~~H~P~y~s~~~~~~~~~~~r  303 (426)
T 1xzw_A          231 SGDPLWYAIKRASAHIIVLSSYSGFVK-------YSPQYKWFTSELEKVNRSETPWLIVLVHAPLYNSYEAHYMEGEAMR  303 (426)
T ss_dssp             CSSTTSEEEEETTEEEEECCTTSCCST-------TSHHHHHHHHHHHHCCTTTCCEEEEECSSCSSCCBSTTTTTTHHHH
T ss_pred             CCCCCEEEEECCEEEEEEECCCCCCCC-------CHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCHHHH
T ss_conf             888855999817289999546668765-------0499999999999754337975999818886435766666778899


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCEE
Q ss_conf             8999999874981999987675324
Q gi|255764495|r  212 QRFQKMIWHEGADLILHGHTHLNSL  236 (309)
Q Consensus       212 ~~l~~~l~~~~v~lvl~GH~H~~~~  236 (309)
                      +.|.++|.+++|+++|+||.|...+
T Consensus       304 ~~l~~lf~~y~Vdlvl~GH~H~YeR  328 (426)
T 1xzw_A          304 AIFEPYFVYYKVDIVFSGHVHSYER  328 (426)
T ss_dssp             HHHHHHHHHTTCSEEEECSSSSEEE
T ss_pred             HHHHHHHHHHCCEEEEECCCCCEEE
T ss_conf             9999999981971999798556355


No 9  
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A*
Probab=99.86  E-value=1.3e-19  Score=146.40  Aligned_cols=171  Identities=18%  Similarity=0.125  Sum_probs=113.6

Q ss_pred             HHHCCCCEEEECCCCCCC-C----CHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHH--HHHHHHHHHHCCCCCCC
Q ss_conf             962699799993744448-9----9899999999998618997189994588422220356--76643245431344444
Q gi|255764495|r   60 ILLHNVDHVSITGDIVNF-T----CNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE--KSLHAWKDYITSDTTCS  132 (309)
Q Consensus        60 i~~~~pD~vvitGDl~~~-~----~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~--~~~~~~~~~~~~~~~~~  132 (309)
                      +...+||+|+++||++.. +    ....++.....++.+....|+++++||||........  .....+...+.......
T Consensus       143 ~~~~~pdfvl~~GD~~y~d~~~~~~~~~wd~~~~~~~~~~~~iP~~~~~GNHE~~~~~~~~~~~~~~~~~~~f~~p~~~~  222 (424)
T 2qfp_A          143 LSPKKGQTVLFVGDLSYADRYPNHDNVRWDTWGRFTERSVAYQPWIWTAGNHEIEFAPEINETEPFKPFSYRYHVPYEAS  222 (424)
T ss_dssp             TCSSCCCEEEECSCCSCGGGSGGGCTHHHHHHHHHHHHHHTTSCEEECCCHHHHCCBGGGTBCSTTHHHHHHCCCCGGGG
T ss_pred             HCCCCCCEEEEECCEEECCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCC
T ss_conf             65568765998043765055566303688899988878872296587067653225765566746404421135776666


Q ss_pred             CCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEECHHHHHHHHHHHHHCCCCC-CEEEEEEECCCCCCCCCCCC-CCCC
Q ss_conf             555621279971987999832888888755476008999999999985243369-70899983768887643110-1279
Q gi|255764495|r  133 TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG-FFRIIMMHHPPVLDTSSLYN-RMFG  210 (309)
Q Consensus       133 ~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~~~~q~~~l~~~L~~~~~~~-~~~iv~~Hhpp~~~~~~~~~-~~~~  210 (309)
                      .......|....++++++.||+.....       .+.+|++||++.|++++... .++|+++|||+......... ...-
T Consensus       223 ~~~~~~yYsfd~G~v~fi~lds~~~~~-------~~~~Q~~WL~~dL~~~~r~~~~w~iv~~H~P~ys~~~~~~~~~~~~  295 (424)
T 2qfp_A          223 QSTSPFWYSIKRASAHIIVLSSYSAYG-------RGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEGEAM  295 (424)
T ss_dssp             TCSSTTSEEEEETTEEEEECCTTSCCS-------TTSHHHHHHHHHHHHCCTTTCCEEEEECSSCSSCCBSTTTTTTHHH
T ss_pred             CCCCCCEEEEEECCEEEEECCCCCCCC-------CCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCHHH
T ss_conf             788875699987888899614744677-------5459999999998753125798699996888654587887666789


Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCCEEE
Q ss_conf             789999998749819999876753247
Q gi|255764495|r  211 IQRFQKMIWHEGADLILHGHTHLNSLH  237 (309)
Q Consensus       211 ~~~l~~~l~~~~v~lvl~GH~H~~~~~  237 (309)
                      ++.+..+|.+++|+++|+||.|..++.
T Consensus       296 r~~~~~lf~ky~Vdlvl~GH~H~Y~Rt  322 (424)
T 2qfp_A          296 RTKFEAWFVKYKVDVVFAGHVHAYERS  322 (424)
T ss_dssp             HHHHHHHHHHTTCSEEEECSSSSEEEE
T ss_pred             HHHHHHHHHHCCCEEEEECCCCCCCCC
T ss_conf             999999999719759996985671100


No 10 
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase, metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A*
Probab=99.84  E-value=1.4e-19  Score=146.29  Aligned_cols=239  Identities=11%  Similarity=0.024  Sum_probs=132.6

Q ss_pred             CEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCC-CCCHHHH-HH
Q ss_conf             327889941114278854100022210001210000012330899999999996269979999374444-8998999-99
Q gi|255764495|r    8 IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVN-FTCNREI-FT   85 (309)
Q Consensus         8 ~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~-~~~~~~~-~~   85 (309)
                      -.+||+.++|.|-+......                  ........+.+.+.+++.+||+||++||++. .|...+. ..
T Consensus         5 ~~~rf~v~gD~g~~~~~~~~------------------~~~~~~~~~~~~~~~~~~~pdfvl~~GD~~y~~g~~~~~~~~   66 (313)
T 1ute_A            5 PILRFVAVGDWGGVPNAPFH------------------TAREMANAKAIATTVKTLGADFILSLGDNFYFTGVHDAKDKR   66 (313)
T ss_dssp             CCEEEEEECSCCCCSSTTSS------------------CHHHHHHHHHHHHHHHHHCCSEEEECSCCSTTTCCSSTTCTH
T ss_pred             CCEEEEEEECCCCCCCCCCC------------------CHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCHHHH
T ss_conf             98799999469999975445------------------178999999999998636998999899887778887521799


Q ss_pred             HHHHHHH-----HCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEE----ECCCEEEEEECCCC
Q ss_conf             9999986-----18997189994588422220356766432454313444445556212799----71987999832888
Q gi|255764495|r   86 STHWLRS-----IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLR----IRNNIALIGCSTAI  156 (309)
Q Consensus        86 ~~~~~~~-----l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~i~l~s~~  156 (309)
                      ..+.+..     .....|+++++||||..................      ......+....    ....+.++.+++..
T Consensus        67 ~~~~~~~~~~~~~~~~~P~~~~~GNHd~~~~~~~~~~~~~~~~~~------~~~~~~y~~~~~~~~~~~~~~~~~~d~~~  140 (313)
T 1ute_A           67 FQETFEDVFSDPSLRNVPWHVLAGNHDHLGNVSAQIAYSKISKRW------NFPSPYYRLRFKIPRSNVSVAIFMLDTVT  140 (313)
T ss_dssp             HHHHTTTTSCSGGGTTCCEEECCCHHHHHSCHHHHHHGGGTSTTE------ECCSSSEEEEEECTTSSCEEEEEECCHHH
T ss_pred             HHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHCCCCC------CCCCCCCCEECCCCCCCCCEEEEECCCEE
T ss_conf             999999875335651898798447656667632220112115455------68887644010467889706999815556


Q ss_pred             --------CCC--CCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEE
Q ss_conf             --------888--7554760089999999999852433697089998376888764311012797899999987498199
Q gi|255764495|r  157 --------ATP--PFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLI  226 (309)
Q Consensus       157 --------~~~--~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lv  226 (309)
                              ...  .......+..+|++||++.|++.+  ..+.|+++|||+......... ....+.+.+++.+++|+++
T Consensus       141 ~~~~~~~~~~~~~~~~~~~~~~~~Q~~WL~~~L~~~~--~~~~iv~~hhp~~~~~~~~~~-~~~~~~~~~ll~~~~V~~~  217 (313)
T 1ute_A          141 LCGNSDDFVSQQPERPRNLALARTQLAWIKKQLAAAK--EDYVLVAGHYPVWSIAEHGPT-HCLVKQLLPLLTTHKVTAY  217 (313)
T ss_dssp             HHCCGGGSTTCSCCSCSCHHHHHHHHHHHHHHHHHCC--CSEEEEECSSCSSCCSSSCCC-HHHHHHTHHHHHHTTCSEE
T ss_pred             EEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC--CCCEEEEEECCCCCCCCCCCC-HHHHHHHHHHHHHCCCEEE
T ss_conf             8730344444566664342239999999999997263--567389982376444667874-7788999999997694499


Q ss_pred             EECCCCCCEEEEEECCCCCEEEEEECCCCCCCCC------------------CCCCCCEEEEEEECCC
Q ss_conf             9987675324787169986899995762357788------------------8877854899995389
Q gi|255764495|r  227 LHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHS------------------NKPQASYNLFYIEKKN  276 (309)
Q Consensus       227 l~GH~H~~~~~~~~~~~~~~~~~~~~s~~~~~~~------------------~~~~~~y~li~i~~~~  276 (309)
                      ||||.|..+...   +.+.+.++.+++++.....                  .....||.+|+|+++.
T Consensus       218 ~~GH~H~~~~~~---~~~~~~~~~~g~gg~~~~~~~~~~~~~~~~~~~~~~~~~~~~gf~~i~v~~~~  282 (313)
T 1ute_A          218 LCGHDHNLQYLQ---DENGLGFVLSGAGNFMDPSKKHLRKVPNGYLRFHFGAENSLGGFAYVEITPKE  282 (313)
T ss_dssp             EECSSSSEEEEE---CTTCCEEEEECBSSCCCCCCTTGGGSCTTCEEEEECCTTSCCEEEEEEECSSC
T ss_pred             EECCCCCEEEEE---CCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEEEEEEECCE
T ss_conf             958864216774---48997899969885667887656668753343235046786639999998999


No 11 
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A
Probab=99.83  E-value=1.4e-20  Score=152.72  Aligned_cols=220  Identities=11%  Similarity=0.057  Sum_probs=129.2

Q ss_pred             EEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHC-----CCCEEEECCCCCCCCCHHHH
Q ss_conf             2788994111427885410002221000121000001233089999999999626-----99799993744448998999
Q gi|255764495|r    9 MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-----NVDHVSITGDIVNFTCNREI   83 (309)
Q Consensus         9 m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~-----~pD~vvitGDl~~~~~~~~~   83 (309)
                      |.||+.|||+| |                           ....|+++++.+.+.     .+|.|+++||+++.|...  
T Consensus         1 m~~I~visDiH-g---------------------------~~~~l~~~l~~i~~~~~~~~~~d~ii~lGDlvd~Gp~~--   50 (252)
T 1nnw_A            1 MVYVAVLANIA-G---------------------------NLPALTAALSRIEEMREEGYEIEKYYILGNIVGLFPYP--   50 (252)
T ss_dssp             -CEEEEEECCT-T---------------------------CHHHHHHHHHHHHHHHHTTCCEEEEEEESCSSSSSSCH--
T ss_pred             CCEEEEEECCC-C---------------------------CHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCH--
T ss_conf             97899997303-5---------------------------98999999999997432589877899937828998886--


Q ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCC
Q ss_conf             99999998618997189994588422220356766432454313444445556212799719879998328888887554
Q gi|255764495|r   84 FTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA  163 (309)
Q Consensus        84 ~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~  163 (309)
                      ....+++..+....++++|+||||.+.......        ... ............               ........
T Consensus        51 ~e~~~~l~~l~~~~~~~~i~GNHD~~~~~~~~~--------~~~-~~~~~~~~~~~~---------------~~~~~~~~  106 (252)
T 1nnw_A           51 KEVIEVIKDLTKKENVKIIRGKYDQIIAMSDPH--------ATD-PGYIDKLELPGH---------------VKKALKFT  106 (252)
T ss_dssp             HHHHHHHHHHHHHSCEEEECCHHHHHHHHSCTT--------CSS-SGGGGGSSCCHH---------------HHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCEEEECCCCHHHHHHHCCC--------CCC-CCHHHHHCCCHH---------------HHHHHHHH
T ss_conf             999999997655178289638856999740524--------555-310222026566---------------77878889


Q ss_pred             CCEECHHHHHHHHHHHHHCC-CCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHC-CCEEEEECCCCCCEEEEEEC
Q ss_conf             76008999999999985243-36970899983768887643110127978999999874-98199998767532478716
Q gi|255764495|r  164 NGYFGQEQAHATSKLLRKAN-KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKN  241 (309)
Q Consensus       164 ~g~~~~~q~~~l~~~L~~~~-~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~-~v~lvl~GH~H~~~~~~~~~  241 (309)
                      ...+..+++.|++....... ......++++|++|................+..++... +.++++|||+|.+....+.+
T Consensus       107 ~~~~~~~~~~~l~~l~~~~~~~~~~~~i~~~H~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vv~GHtH~~~~~~~~~  186 (252)
T 1nnw_A          107 WEKLGHEGREYLRDLPIYLVDKIGGNEVFGVYGSPINPFDGEVLAEQPTSYYEAIMRPVKDYEMLIVASPMYPVDAMTRY  186 (252)
T ss_dssp             HHHHHHHHHHHHHTSCSCEEEEETTEEEEEESSCSSCTTTCCCCSSCCHHHHHHHHGGGTTSSEEEESTTCSEEEEEETT
T ss_pred             HHHCCHHHHHHHHHCCCCEEEEECCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCEEEECCCCEEEEEEECC
T ss_conf             87636888999873763259984389589993786776533246754688877763001466248972474467886078


Q ss_pred             CCCCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEEEECCCC
Q ss_conf             99868999957623577888877854899995389838999999513776
Q gi|255764495|r  242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD  291 (309)
Q Consensus       242 ~~~~~~~~~~~s~~~~~~~~~~~~~y~li~i~~~~~~~~v~~~r~~~~~d  291 (309)
                          ..+++++|++... .+.+.++|.+++++..    .+++.+..|..+
T Consensus       187 ----~~~iN~Gsvg~~~-~~~~~~~y~i~d~~~~----~v~~~~~~YD~~  227 (252)
T 1nnw_A          187 ----GRVVCPGSVGFPP-GKEHKATFALVDVDTL----KPKFIEVEYDKK  227 (252)
T ss_dssp             ----EEEEEECCSSSCS-SSSCCEEEEEEETTTC----CEEEEEECCCSH
T ss_pred             ----CEEECCCEEEECC-CCCCCCEEEEEECCCC----EEEEEEECCCHH
T ss_conf             ----3687186160078-9998777999993798----799999789989


No 12 
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC structure funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A
Probab=99.72  E-value=6.5e-16  Score=122.08  Aligned_cols=163  Identities=18%  Similarity=0.178  Sum_probs=102.8

Q ss_pred             CCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHH
Q ss_conf             32553278899411142788541000222100012100000123308999999999962699799993744448998999
Q gi|255764495|r    4 RYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREI   83 (309)
Q Consensus         4 ~~~~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~   83 (309)
                      +|.++| ||+-|||+|-                            ....|+++++.++++++|.|+++||++..   .  
T Consensus        21 ~~~~~M-KI~iiSDiHg----------------------------n~~ale~vl~~~~~~~~D~vi~lGDiv~~---~--   66 (190)
T 1s3l_A           21 YFQGHM-KIGIMSDTHD----------------------------HLPNIRKAIEIFNDENVETVIHCGDFVSL---F--   66 (190)
T ss_dssp             -----C-EEEEECCCTT----------------------------CHHHHHHHHHHHHHSCCSEEEECSCCCST---H--
T ss_pred             CCCCCC-EEEEEECCCC----------------------------CHHHHHHHHHHHHHCCCCEEEECCCCCCH---H--
T ss_conf             236875-8999980899----------------------------96999999999975599999987883898---9--


Q ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCC
Q ss_conf             99999998618997189994588422220356766432454313444445556212799719879998328888887554
Q gi|255764495|r   84 FTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA  163 (309)
Q Consensus        84 ~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~  163 (309)
                        ..+.+..+  ..|+++|.||||..........     .......          .   ......+             
T Consensus        67 --~~~~l~~~--~~~~~~V~GNhD~~~~~~~~~~-----~~~~~~~----------~---~~~~~~~-------------  111 (190)
T 1s3l_A           67 --VIKEFENL--NANIIATYGNNDGERCKLKEWL-----KDINEEN----------I---IDDFISV-------------  111 (190)
T ss_dssp             --HHHHGGGC--SSEEEEECCTTCCCHHHHHHHH-----HHHCTTC----------E---EESEEEE-------------
T ss_pred             --HHHHHHHC--CCCEEEEECCCCCCHHHHHHHH-----HHCCCCC----------C---CCCEEEE-------------
T ss_conf             --99998734--7608997276543035577776-----5312222----------3---5621346-------------


Q ss_pred             CCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCC
Q ss_conf             76008999999999985243369708999837688876431101279789999998749819999876753247871699
Q gi|255764495|r  164 NGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK  243 (309)
Q Consensus       164 ~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~  243 (309)
                                         .. ...+|+++|.++             .+.+..++...++++++|||+|.+......+  
T Consensus       112 -------------------~~-~~~~i~l~Hg~~-------------~~~l~~~~~~~~~div~~GHTH~~~~~~~~~--  156 (190)
T 1s3l_A          112 -------------------EI-DDLKFFITHGHH-------------QSVLEMAIKSGLYDVVIYGHTHERVFEEVDD--  156 (190)
T ss_dssp             -------------------EE-TTEEEEEEESCC-------------HHHHHHHHHHSCCSEEEEECSSCCEEEEETT--
T ss_pred             -------------------EE-CCCEEEEEECCC-------------HHHHHHHHHCCCCCEEEECCCCCCCEEEECC--
T ss_conf             -------------------75-484899998981-------------2657888642797699999957632799999--


Q ss_pred             CCEEEEEECCCCCCCCCCCCCCCEEEEEEECC
Q ss_conf             86899995762357788887785489999538
Q gi|255764495|r  244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKK  275 (309)
Q Consensus       244 ~~~~~~~~~s~~~~~~~~~~~~~y~li~i~~~  275 (309)
                        ..+++.||++..+.  + .++|.+++++.+
T Consensus       157 --~~~iNPGSvg~pr~--~-~~s~aild~~~~  183 (190)
T 1s3l_A          157 --VLVINPGECCGYLT--G-IPTIGILDTEKK  183 (190)
T ss_dssp             --EEEEECCCSSCTTT--S-CCEEEEEETTTT
T ss_pred             --EEEEECCCCCCCCC--C-CCEEEEEECCCC
T ss_conf             --99997999888899--9-977999994799


No 13 
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7
Probab=99.70  E-value=1.4e-15  Score=119.91  Aligned_cols=183  Identities=19%  Similarity=0.272  Sum_probs=113.8

Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHH
Q ss_conf             89941114278854100022210001210000012330899999999996269979999374444899899999999998
Q gi|255764495|r   12 LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR   91 (309)
Q Consensus        12 i~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~   91 (309)
                      |+.|||+|+....  .                       .+.+++.+.++..++|.|+++||++.   +    ...++++
T Consensus        28 ilvIsDtHip~r~--~-----------------------~lp~~~~~~l~~~kvD~Iih~GDi~~---~----e~l~~L~   75 (215)
T 2a22_A           28 VLLIGDLKIPYGA--K-----------------------ELPSNFRELLATDKINYVLCTGNVCS---Q----EYVEMLK   75 (215)
T ss_dssp             EEEECCCCTTTTC--S-----------------------SCCGGGHHHHHCTTCCEEEECSCCCC---H----HHHHHHH
T ss_pred             EEEECCCCCCCCC--H-----------------------HHHHHHHHHHCCCCCCEEEECCCCCC---H----HHHHHHH
T ss_conf             9999167887640--1-----------------------45499999847468898998999999---8----9999999


Q ss_pred             HHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEECHHH
Q ss_conf             61899718999458842222035676643245431344444555621279971987999832888888755476008999
Q gi|255764495|r   92 SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQ  171 (309)
Q Consensus        92 ~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~~~~q  171 (309)
                      .+..  ++++|.||||..........       .        .  ..      .....+.                    
T Consensus        76 ~l~~--~v~~V~GN~D~~~~~~~~~~-------~--------~--~l------P~~~~~~--------------------  110 (215)
T 2a22_A           76 NITK--NVYIVSGDLDSAIFNPDPES-------N--------G--VF------PEYVVVQ--------------------  110 (215)
T ss_dssp             HHCS--CEEECCCTTCCSCCBCCGGG-------T--------B--CC------CSEEEEE--------------------
T ss_pred             HHCC--CEEEEECCCCCCHHHHHHHH-------H--------H--HC------CCCEEEE--------------------
T ss_conf             6499--76998378671010022788-------9--------7--69------9817999--------------------


Q ss_pred             HHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCCEEEEEE
Q ss_conf             99999998524336970899983768887643110127978999999874981999987675324787169986899995
Q gi|255764495|r  172 AHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGI  251 (309)
Q Consensus       172 ~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~~~~~~~  251 (309)
                                   -+..+|.++|......       ..+.+.+.+++.+.++++++|||+|.+......+    ..+++.
T Consensus       111 -------------~~g~~i~l~Hg~~~~p-------~~~~~~l~~~~~~~~~dvvv~GHTH~p~~~~~~g----~l~iNP  166 (215)
T 2a22_A          111 -------------IGEFKIGLMHGNQVLP-------WDDPGSLEQWQRRLDCDILVTGHTHKLRVFEKNG----KLFLNP  166 (215)
T ss_dssp             -------------ETTEEEEEECSTTSSS-------TTCHHHHHHHHHHHTCSEEEECSSCCCEEEEETT----EEEEEC
T ss_pred             -------------ECCEEEEEECCCCCCC-------CCCHHHHHHHHHCCCCCEEEECCCCCCCEEEECC----EEEEEC
T ss_conf             -------------9999999977986566-------5357899998750289989979989764799999----999948


Q ss_pred             CCCCCCCCC--CCCCCCEEEEEEECCCCEEEEEEEEEECCCCCEEEEECC
Q ss_conf             762357788--887785489999538983899999951377611575314
Q gi|255764495|r  252 ASASQKVHS--NKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY  299 (309)
Q Consensus       252 ~s~~~~~~~--~~~~~~y~li~i~~~~~~~~v~~~r~~~~~d~~~~~~~~  299 (309)
                      ||++..+..  ....++|.+++++.+    .|+++.+.+..+...++...
T Consensus       167 GS~~~~r~~~~~~~~pS~aiLdi~~~----~v~v~~y~l~~~~~kv~~~~  212 (215)
T 2a22_A          167 GTATGAFSALTPDAPPSFMLMALQGN----KVVLYVYDLRDGKTNVAMSE  212 (215)
T ss_dssp             CCSSCCCCTTSTTCCCEEEEEEEETT----EEEEEEEEEETTEEEEEEEE
T ss_pred             CCCCCCCCCCCCCCCCEEEEEEEECC----EEEEEEEEECCCEEEEEEEE
T ss_conf             98777777878888888999999899----99999999349929999999


No 14 
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 1w24_A 2r17_A
Probab=99.69  E-value=1.2e-15  Score=120.40  Aligned_cols=176  Identities=19%  Similarity=0.291  Sum_probs=110.5

Q ss_pred             CCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHH
Q ss_conf             53278899411142788541000222100012100000123308999999999962699799993744448998999999
Q gi|255764495|r    7 TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTS   86 (309)
Q Consensus         7 ~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~   86 (309)
                      .-| ||+.|||+|.....                         ..+.+.+++.+++.++|.|+++||++..       ..
T Consensus         9 ~~M-kI~vISDtH~~~~~-------------------------~~l~~~~~~~~~~~~vD~iih~GDi~~~-------~~   55 (192)
T 1z2w_A            9 DRM-LVLVLGDLHIPHRC-------------------------NSLPAKFKKLLVPGKIQHILCTGNLCTK-------ES   55 (192)
T ss_dssp             --C-EEEEECCCCBTTTC-------------------------SSCCHHHHTTCCTTSCSEEEECSCCBSH-------HH
T ss_pred             CCE-EEEEEECCCCCCCC-------------------------CHHHHHHHHHHCCCCCCEEEECCCCCCH-------HH
T ss_conf             982-99999027889862-------------------------0167999998531699999999899877-------88


Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCE
Q ss_conf             99998618997189994588422220356766432454313444445556212799719879998328888887554760
Q gi|255764495|r   87 THWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGY  166 (309)
Q Consensus        87 ~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~  166 (309)
                      .++++.+.  .++++|.||||.....                                .....+                
T Consensus        56 ~~~l~~~~--~~v~~V~GN~D~~~~l--------------------------------~~~~~~----------------   85 (192)
T 1z2w_A           56 YDYLKTLA--GDVHIVRGDFDENLNY--------------------------------PEQKVV----------------   85 (192)
T ss_dssp             HHHHHHHC--SEEEECCCTTCCCTTS--------------------------------CSEEEE----------------
T ss_pred             HHHHHHCC--CCEEEEECCCCCCCCC--------------------------------CCEEEE----------------
T ss_conf             99887418--7379991687522267--------------------------------728999----------------


Q ss_pred             ECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCCE
Q ss_conf             08999999999985243369708999837688876431101279789999998749819999876753247871699868
Q gi|255764495|r  167 FGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI  246 (309)
Q Consensus       167 ~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~~  246 (309)
                                       .-...+|.++|.......       .+.+.+.+.+...++++++|||+|.+......+    .
T Consensus        86 -----------------~~~g~~i~~~Hg~~~~~~-------~~~~~l~~~~~~~~~divi~GHTH~p~~~~~~~----~  137 (192)
T 1z2w_A           86 -----------------TVGQFKIGLIHGHQVIPW-------GDMASLALLQRQFDVDILISGHTHKFEAFEHEN----K  137 (192)
T ss_dssp             -----------------EETTEEEEEECSCCCCBT-------TCHHHHHHHHHHHSSSEEECCSSCCCEEEEETT----E
T ss_pred             -----------------EECCCEEEEEECCCCCCC-------CCHHHHHHHHHHCCCCEEEECCCCCCEEEEECC----E
T ss_conf             -----------------978979999908976766-------588999999873589989978878503899999----9


Q ss_pred             EEEEECCCCCCCCC--CCCCCCEEEEEEECCCCEEEEEEEEEECCCCCEEEEE
Q ss_conf             99995762357788--8877854899995389838999999513776115753
Q gi|255764495|r  247 PVVGIASASQKVHS--NKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK  297 (309)
Q Consensus       247 ~~~~~~s~~~~~~~--~~~~~~y~li~i~~~~~~~~v~~~r~~~~~d~~~~~~  297 (309)
                      .+++.||++..+..  ....++|.+++++.+    .+++.-+.+..+...+|+
T Consensus       138 ~iiNPGS~~~pr~~~~~~~~~syaIld~~~~----~v~~~~~~l~~~~v~~e~  186 (192)
T 1z2w_A          138 FYINPGSATGAYNALETNIIPSFVLMDIQAS----TVVTYVYQLIGDDVKVER  186 (192)
T ss_dssp             EEEECCCTTCCCCSSCSCCCCEEEEEEEETT----EEEEEEEEEETTEEEEEE
T ss_pred             EEEECCCCCCCCCCCCCCCCCEEEEEEEECC----EEEEEEEEECCCCEEEEE
T ss_conf             9997998888888988888778999998399----999999993599399999


No 15 
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7
Probab=99.58  E-value=6.3e-14  Score=109.04  Aligned_cols=161  Identities=19%  Similarity=0.147  Sum_probs=95.6

Q ss_pred             CCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHH-
Q ss_conf             3255327889941114278854100022210001210000012330899999999996269979999374444899899-
Q gi|255764495|r    4 RYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNRE-   82 (309)
Q Consensus         4 ~~~~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~-   82 (309)
                      +....| ||+.|||+| |                           ....|+++++.++++++|.|+++||+++.+...+ 
T Consensus        21 ~~~~mM-ki~viSDiH-g---------------------------n~~ale~vl~~~~~~~~D~ii~lGDlv~~gp~~~~   71 (208)
T 1su1_A           21 QSNAMM-KLMFASDIH-G---------------------------SLPATERVLELFAQSGAQWLVILGDVLNHGPRNAL   71 (208)
T ss_dssp             ----CC-EEEEECCCT-T---------------------------BHHHHHHHHHHHHHHTCSEEEECSCCSCCCTTSCC
T ss_pred             CCCCCC-EEEEEEECC-C---------------------------CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCHH
T ss_conf             778331-899993168-9---------------------------98999999999875699889991660133765201


Q ss_pred             -----HHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCC
Q ss_conf             -----999999998618997189994588422220356766432454313444445556212799719879998328888
Q gi|255764495|r   83 -----IFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIA  157 (309)
Q Consensus        83 -----~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~  157 (309)
                           .....+.+..+  ..++++|.||||.......           .. ..   .... ......             
T Consensus        72 ~~~~~~~~~l~~l~~~--~~~~~~V~GNhD~~~~~~~-----------~~-~~---~~~~-~~~~~~-------------  120 (208)
T 1su1_A           72 PEGYAPAKVVERLNEV--AHKVIAVRGNCDSEVDQML-----------LH-FP---ITAP-WQQVLL-------------  120 (208)
T ss_dssp             CTTBCHHHHHHHHHTT--GGGEEECCCTTCCHHHHHH-----------SS-SC---CCCS-EEEEEC-------------
T ss_pred             HHHCCCHHHHHHHHHC--CCCEEEECCCCCHHHHHHH-----------HH-CC---CCCC-CCEEEE-------------
T ss_conf             1112809999999854--9967996477837875443-----------32-01---1343-221341-------------


Q ss_pred             CCCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEE
Q ss_conf             88755476008999999999985243369708999837688876431101279789999998749819999876753247
Q gi|255764495|r  158 TPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH  237 (309)
Q Consensus       158 ~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~  237 (309)
                                                  ....+.+.|..+......              .....++++++||+|.+...
T Consensus       121 ----------------------------~~~~~~~~~~~~~~~~~~--------------~~~~~~divv~GHtH~p~~~  158 (208)
T 1su1_A          121 ----------------------------EKQRLFLTHGHLFGPENL--------------PALNQNDVLVYGHTHLPVAE  158 (208)
T ss_dssp             ----------------------------SSCEEEEECSSSSBTTBC--------------CCCCTTCEEECCSSCCCEEE
T ss_pred             ----------------------------CCEEEEEECCCCCCHHHH--------------HHCCCCCEEEECCCCCCEEE
T ss_conf             ----------------------------431699844885588899--------------75159989997774573489


Q ss_pred             EEECCCCCEEEEEECCCCCCCCCCCCCCCEEEEEE
Q ss_conf             87169986899995762357788887785489999
Q gi|255764495|r  238 WIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYI  272 (309)
Q Consensus       238 ~~~~~~~~~~~~~~~s~~~~~~~~~~~~~y~li~i  272 (309)
                      .+++    +.+++.||++..+  .+.+++|.+++.
T Consensus       159 ~~~~----~~~iNPGSvg~pr--~g~~~syaild~  187 (208)
T 1su1_A          159 QRGE----IFHFNPGSVSIPK--GGNPASYGMLDN  187 (208)
T ss_dssp             EETT----EEEEECCCSSCCC--TTCCCEEEEEET
T ss_pred             EECC----EEEEECCCCCCCC--CCCCCEEEEEEC
T ss_conf             9999----9999789988778--999888999999


No 16 
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae TIGR4} SCOP: d.159.1.7
Probab=99.56  E-value=2.8e-13  Score=104.72  Aligned_cols=157  Identities=22%  Similarity=0.193  Sum_probs=102.1

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHH
Q ss_conf             88994111427885410002221000121000001233089999999999626997999937444489989999999999
Q gi|255764495|r   11 VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWL   90 (309)
Q Consensus        11 ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~   90 (309)
                      ||+-|||+|=                            ....|+++++... .++|.|+++||+.......         
T Consensus         8 kI~viSD~Hg----------------------------n~~al~~vl~~~~-~~~D~iih~GD~~~~~~~~---------   49 (176)
T 3ck2_A            8 TIIVMSDSHG----------------------------DSLIVEEVRDRYV-GKVDAVFHNGDSELRPDSP---------   49 (176)
T ss_dssp             EEEEECCCTT----------------------------CHHHHHHHHHHHT-TTSSEEEECSCCCSCTTCG---------
T ss_pred             EEEEEECCCC----------------------------CHHHHHHHHHHHH-CCCCEEEECCCCCCCCHHH---------
T ss_conf             9999900689----------------------------9899999999977-7999999899877512336---------


Q ss_pred             HHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEECHH
Q ss_conf             86189971899945884222203567664324543134444455562127997198799983288888875547600899
Q gi|255764495|r   91 RSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQE  170 (309)
Q Consensus        91 ~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~~~~  170 (309)
                        +  ..++.+|.||||......                                ...++-                   
T Consensus        50 --~--~~~~~~V~GN~D~~~~~~--------------------------------~~~~~~-------------------   74 (176)
T 3ck2_A           50 --L--WEGIRVVKGNMDFYAGYP--------------------------------ERLVTE-------------------   74 (176)
T ss_dssp             --G--GTTEEECCCTTCCSTTCC--------------------------------SEEEEE-------------------
T ss_pred             --H--HCCCEEEECCCCCCCCCC--------------------------------CEEEEE-------------------
T ss_conf             --6--479989738979521483--------------------------------236899-------------------


Q ss_pred             HHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCCEEEEE
Q ss_conf             99999999852433697089998376888764311012797899999987498199998767532478716998689999
Q gi|255764495|r  171 QAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG  250 (309)
Q Consensus       171 q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~~~~~~  250 (309)
                                    -+..++.++|..+....       .+.+.+.+.....+++++++||+|.+......+    +.+++
T Consensus        75 --------------~~~~~i~~~Hg~~~~~~-------~~~~~l~~~~~~~~~divi~GHTH~p~~~~~~~----~~iiN  129 (176)
T 3ck2_A           75 --------------LGSTKIIQTHGHLFDIN-------FNFQKLDYWAQEEEAAICLYGHLHVPSAWLEGK----ILFLN  129 (176)
T ss_dssp             --------------ETTEEEEEECSGGGTTT-------TCSHHHHHHHHHTTCSEEECCSSCCEEEEEETT----EEEEE
T ss_pred             --------------ECCEEEEEEECCCCCCC-------CCHHHHHHHHHHCCCCEEEECCCCCCEEEEECC----EEEEE
T ss_conf             --------------89989999928777888-------898999999985599899968977425999899----99993


Q ss_pred             ECCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEEEEC
Q ss_conf             57623577888877854899995389838999999513
Q gi|255764495|r  251 IASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL  288 (309)
Q Consensus       251 ~~s~~~~~~~~~~~~~y~li~i~~~~~~~~v~~~r~~~  288 (309)
                      .||++..+ ...+.++|.+++++.  +.|+|+...+.+
T Consensus       130 PGSvg~pr-~~~~~~syail~~~~--~~~~v~~~~~d~  164 (176)
T 3ck2_A          130 PGSISQPR-GTIRECLYARVEIDD--SYFKVDFLTRDH  164 (176)
T ss_dssp             ECCSSSCC-TTCCSCCEEEEEECS--SEEEEEEECTTS
T ss_pred             CCCCCCCC-CCCCCCEEEEEEEEC--CEEEEEEEEECC
T ss_conf             58866778-999856899999819--999999998589


No 17 
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima}
Probab=99.52  E-value=1e-12  Score=101.09  Aligned_cols=159  Identities=19%  Similarity=0.199  Sum_probs=89.3

Q ss_pred             CCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHH
Q ss_conf             32553278899411142788541000222100012100000123308999999999962699799993744448998999
Q gi|255764495|r    4 RYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREI   83 (309)
Q Consensus         4 ~~~~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~   83 (309)
                      +|+++| ||+.|||+|......                     ...    +.+++.+  .++|.|+++||+++   ++  
T Consensus        18 ~~~~~~-rIliiSDtH~~~~~~---------------------~l~----~~i~~~~--~~~D~iih~GD~~~---~~--   64 (178)
T 2kkn_A           18 YFQGVK-RFLLISDSHVPVRMA---------------------SLP----DEILNSL--KEYDGVIGLGDYVD---LD--   64 (178)
T ss_dssp             ----CE-EEEEECCCCBTTTTC---------------------CCC----HHHHHGG--GGCSEEEESSCBSC---HH--
T ss_pred             HHHCCE-EEEEECCCCCCCCCH---------------------HHH----HHHHHHH--CCCCEEEECCCCCC---HH--
T ss_conf             442712-999996789886410---------------------256----9999874--47899999999866---75--


Q ss_pred             HHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCC
Q ss_conf             99999998618997189994588422220356766432454313444445556212799719879998328888887554
Q gi|255764495|r   84 FTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA  163 (309)
Q Consensus        84 ~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~  163 (309)
                        ..++++.+.  .++++|.||||.....          ..    .       ........+                  
T Consensus        65 --~l~~l~~~~--~~v~~V~GN~D~~~~~----------~~----l-------p~~~~~~i~------------------  101 (178)
T 2kkn_A           65 --TVILLEKFS--KEFYGVHGNMDYPDVK----------EH----L-------PFSKVLLVE------------------  101 (178)
T ss_dssp             --HHHHHHHHT--SSEEECCCSSSCGGGG----------GT----S-------CSCEEEEET------------------
T ss_pred             --HHHHHHHCC--CCEEEEECCCCCHHHH----------HH----C-------CCEEEEEEC------------------
T ss_conf             --789987307--9879998997867888----------51----9-------824799988------------------


Q ss_pred             CCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCC
Q ss_conf             76008999999999985243369708999837688876431101279789999998749819999876753247871699
Q gi|255764495|r  164 NGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK  243 (309)
Q Consensus       164 ~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~  243 (309)
                                             ..+|.++|....+         .+...........+++++++||+|.+......+  
T Consensus       102 -----------------------g~~i~l~HG~~~~---------~~~~~~~~~~~~~~~divi~GHTH~~~~~~~~~--  147 (178)
T 2kkn_A          102 -----------------------GVTIGMCHGWGAP---------WDLKDRLLKVFNEKPQVILFGHTHEPEDTVKAG--  147 (178)
T ss_dssp             -----------------------TEEEEECCSCCCH---------HHHHHHHHHHSSSCCSEEECCSCSSCCEEEETT--
T ss_pred             -----------------------CEEEEEECCCCCC---------CCHHHHHHHHHHCCCCEEEECCCCCCEEEEECC--
T ss_conf             -----------------------8699998388887---------513678887521389889968856521899899--


Q ss_pred             CCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEE
Q ss_conf             86899995762357788887785489999538983899999
Q gi|255764495|r  244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGK  284 (309)
Q Consensus       244 ~~~~~~~~~s~~~~~~~~~~~~~y~li~i~~~~~~~~v~~~  284 (309)
                        +.+++.||++        .++|.+++++.  ..+.+++.
T Consensus       148 --~~iiNPGS~~--------~~syail~ie~--~~v~~ei~  176 (178)
T 2kkn_A          148 --VRFLNPGSLA--------EGSYAVLELDG--GEVRFELK  176 (178)
T ss_dssp             --EEEECCCCTT--------TTEEEEEEEET--TEEEEEEE
T ss_pred             --EEEEECCCCC--------CCEEEEEEEEC--CEEEEEEE
T ss_conf             --9999798999--------98699999989--99999999


No 18 
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp}
Probab=99.32  E-value=8e-10  Score=82.04  Aligned_cols=255  Identities=15%  Similarity=0.155  Sum_probs=114.7

Q ss_pred             CCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEE-CCCCCCCCCHH-HH
Q ss_conf             55327889941114278854100022210001210000012330899999999996269979999-37444489989-99
Q gi|255764495|r    6 TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI-TGDIVNFTCNR-EI   83 (309)
Q Consensus         6 ~~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvi-tGDl~~~~~~~-~~   83 (309)
                      +..-++|+|+||+| |.-.......           ......-....+..+++.++++.|+.+++ +||+++ |++. .+
T Consensus         8 ~~v~l~il~tnD~H-g~l~~~~~~~-----------~~~~~~gG~arl~t~i~~~r~~~~~~l~ldaGD~~~-Gs~~~~~   74 (341)
T 3gve_A            8 PQVHLSILATTDIH-ANMMDYDYYS-----------DKETADFGLARTAQLIQKHREQNPNTLLVDNGDLIQ-GNPLGEY   74 (341)
T ss_dssp             CEEEEEEEEECCCT-TCCSSEETTT-----------TEECSSCCHHHHHHHHHHHHHHCSSEEEEECSCCSC-SSHHHHH
T ss_pred             CCEEEEEEEECCCC-CCCCCCCCCC-----------CCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCC-CCHHHHH
T ss_conf             87059999977665-6865756667-----------777676649999999999996599879997786567-8602555


Q ss_pred             H---------------HHHHHHHHHCCCCCEEEEECCCCCCCCCH-HHHHHHH-HHHHHCCCCCCCC-CCCCCEEE----
Q ss_conf             9---------------99999986189971899945884222203-5676643-2454313444445-55621279----
Q gi|255764495|r   84 F---------------TSTHWLRSIGNPHDISIVPGNHDAYISGA-KEKSLHA-WKDYITSDTTCST-GKKLFPYL----  141 (309)
Q Consensus        84 ~---------------~~~~~~~~l~~~~~v~~v~GNHD~~~~~~-~~~~~~~-~~~~~~~~~~~~~-~~~~~~~~----  141 (309)
                      .               ...+.+..+.  +. .+++||||.-.... ....... ..++......... .....++.    
T Consensus        75 ~~~~~~~~~~~~~~g~~~~~~~n~~g--~D-a~~~GNHEfd~G~~~l~~~~~~~~~p~l~aNv~~~~~~~~~~p~~~~~~  151 (341)
T 3gve_A           75 AVKYQKDDIISGTKTHPIISVMNALK--YD-AGTLGNHEFNYGLDFLDGTIKGADFPIVNANVKTTSGENRYTPYVINEK  151 (341)
T ss_dssp             HHHHHHHHHHHTSSCCHHHHHHHHTT--CC-BEECCGGGGTTCHHHHHHHHHTCSSCEECSSEECTTSCBSSCCEEEEEE
T ss_pred             HHHHCCCCCCCCCCCCHHHHHHHHCC--CC-EEECCHHHCCCCHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCE
T ss_conf             43203443322446708999987048--87-6722515302578999999834789768776463788736677533406


Q ss_pred             --EEC------CCEEEEEECCCCCC---CCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCC
Q ss_conf             --971------98799983288888---8755476008999999999985243369708999837688876431101279
Q gi|255764495|r  142 --RIR------NNIALIGCSTAIAT---PPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG  210 (309)
Q Consensus       142 --~~~------~~~~~i~l~s~~~~---~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~  210 (309)
                        ...      -.+.++|+.+....   .+....+.......+.+++.+++.+.++...||++-|-........... . 
T Consensus       152 ~~~~~~g~~~g~kIgviG~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~v~~l~~~g~DiiV~lsH~G~~~d~~~~~~-~-  229 (341)
T 3gve_A          152 TLIDENGNEQKVKVGYIGFVPPQIMTWDKKNLEGQVQVQDIVESANETIPKMKAEGADVIIALAHTGIEKQAQSSGA-E-  229 (341)
T ss_dssp             EEECTTSCEEEEEEEEEEECCTTHHHHTHHHHTTTCEECCHHHHHHHHHHHHHHTTCSEEEEEECCCCCSSCCCTTC-S-
T ss_pred             EEEEECCCEEEEEEEEECCCCCCCCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCC-C-
T ss_conf             99985385103899995556865332346566576112559999999997666449988999851684444334554-4-


Q ss_pred             HHHHHHHHHH-CCCEEEEECCCCCCEEEEEEC----------CCCCEEEEEECCCCCCCCCCCCCCCEEE--EEEECCCC
Q ss_conf             7899999987-498199998767532478716----------9986899995762357788887785489--99953898
Q gi|255764495|r  211 IQRFQKMIWH-EGADLILHGHTHLNSLHWIKN----------EKKLIPVVGIASASQKVHSNKPQASYNL--FYIEKKNE  277 (309)
Q Consensus       211 ~~~l~~~l~~-~~v~lvl~GH~H~~~~~~~~~----------~~~~~~~~~~~s~~~~~~~~~~~~~y~l--i~i~~~~~  277 (309)
                       ....++.++ .++|+|+.||.|.........          ....++++.+++-.         .....  ++++..++
T Consensus       230 -~~~~~la~~~~gvD~IlgGHsH~~~~~~~~~~~~~~~~~~~~~~gv~ivqag~~g---------~~vg~i~l~~~~~~g  299 (341)
T 3gve_A          230 -NAVFDLATKTKGIDAIISGHQHGLFPSAEYAGVAQFNVEKGTINGIPVVMPSSWG---------KYLGVIDLKLEKADG  299 (341)
T ss_dssp             -SCHHHHHHHCSCCCEEEECSSCCEESCGGGTTSTTEETTTTEETTEEEEEECSTT---------SEEEEEEEEEEEETT
T ss_pred             -HHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHH---------CEEEEEEEEEECCCC
T ss_conf             -1788998559996489979888656676536777743537875888999578587---------588899999986898


Q ss_pred             EEEEEEEEEEC
Q ss_conf             38999999513
Q gi|255764495|r  278 YWTLEGKRYTL  288 (309)
Q Consensus       278 ~~~v~~~r~~~  288 (309)
                      .|.|.-.+...
T Consensus       300 ~~~v~~~~~~~  310 (341)
T 3gve_A          300 SWKVADSKGSI  310 (341)
T ss_dssp             EEEEEEEEEEE
T ss_pred             CEEEEEEEEEE
T ss_conf             08999434689


No 19 
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp}
Probab=99.27  E-value=5.9e-10  Score=82.90  Aligned_cols=253  Identities=14%  Similarity=0.125  Sum_probs=114.0

Q ss_pred             CCCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEE-EECCCCCCCCCHH-H
Q ss_conf             2553278899411142788541000222100012100000123308999999999962699799-9937444489989-9
Q gi|255764495|r    5 YTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV-SITGDIVNFTCNR-E   82 (309)
Q Consensus         5 ~~~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~v-vitGDl~~~~~~~-~   82 (309)
                      -.|+-++|+|++|+|=--.+...            .............+..+++.++++.|+.+ +.+||+++ |++. .
T Consensus         4 a~tv~l~il~tnD~Hg~l~~~~~------------~~~~~~~~gG~arlat~i~~~r~~~~~~l~ldaGD~~~-Gs~~~~   70 (339)
T 3jyf_A            4 AATVDLRIMETTDLHSNMMDFDY------------YKDAATEKFGLVRTASLIEQARAEVKNSVLVDNGDVIQ-GSPLGD   70 (339)
T ss_dssp             CCEEEEEEEEECCCTTCCSSEET------------TTTEECSSCCHHHHHHHHHHHHHTCSCEEEEECSCCSS-SSHHHH
T ss_pred             CCCEEEEEEEECCCCCCCCCCCC------------CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCC-CCCHHH
T ss_conf             77267999996656568757565------------67777675629999999999997688969998487788-830087


Q ss_pred             HHH-----------HHHHHHHHCCCCCEEEEECCCCCCCCCHH-HHHHHH-HHHHHCCCC-CCC-CCCCCCEEEEE----
Q ss_conf             999-----------99999861899718999458842222035-676643-245431344-444-55562127997----
Q gi|255764495|r   83 IFT-----------STHWLRSIGNPHDISIVPGNHDAYISGAK-EKSLHA-WKDYITSDT-TCS-TGKKLFPYLRI----  143 (309)
Q Consensus        83 ~~~-----------~~~~~~~l~~~~~v~~v~GNHD~~~~~~~-~~~~~~-~~~~~~~~~-~~~-~~~~~~~~~~~----  143 (309)
                      +..           ..+.+..+  ++. ..++||||+-..... ...... -.++..... ... ......+|...    
T Consensus        71 ~~~~~~~~~~~~~~~~~~~n~~--g~D-a~~~GNHEFD~G~~~l~~~~~~~~~p~l~aNv~~~~~~~~~~~py~i~~~~v  147 (339)
T 3jyf_A           71 YMAAKGLKEGDVHPVYKAMNTL--NYA-VGNLGNHEFNYGLDFLHKALAGAKFPYVNANIIDAKTGKPMFTPYLIQDTRV  147 (339)
T ss_dssp             HHHHHCCCTTCCCHHHHHHTTS--CCS-EEECCGGGGTTCHHHHHHHHHTCSSCEECSSEEETTTSSBSSCCEEEEEEEE
T ss_pred             HHCCCCCCCCCCCHHHHHHHHC--CCC-EEECCHHHHHCCHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCEEEE
T ss_conf             6325311345531699999755--988-1611247665279999999740679877664033667872778860120688


Q ss_pred             ------CC--CEEEEEECCCCCC---CCCCCCCEECHHHHHHHHHHHHHCCCCCCE-EEEEEECCCCCCCCCCCCCCCCH
Q ss_conf             ------19--8799983288888---875547600899999999998524336970-89998376888764311012797
Q gi|255764495|r  144 ------RN--NIALIGCSTAIAT---PPFSANGYFGQEQAHATSKLLRKANKKGFF-RIIMMHHPPVLDTSSLYNRMFGI  211 (309)
Q Consensus       144 ------~~--~~~~i~l~s~~~~---~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~-~iv~~Hhpp~~~~~~~~~~~~~~  211 (309)
                            .+  .+.++|+-+....   .+....+....+-.+.+++.+++.+.++.. +|++.|-........  ....+.
T Consensus       148 ~~~~g~~~g~kIgviG~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~v~~l~~~g~D~iI~l~H~G~~~d~~~--~~~~~~  225 (339)
T 3jyf_A          148 VDSDGQIHTLRIGYIGFVPPQIMTWDKANLNGKVTVNDITETARKYIPEMRAKGADVVVVVAHSGLSADPYQ--AMAENS  225 (339)
T ss_dssp             ECTTSCEEEEEEEEEEECCTTHHHHTHHHHTTTEEECCHHHHHHHHHHHHHHTTCSEEEEEECCCCCCSCCC--TTCSCC
T ss_pred             EECCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC--CCCCCH
T ss_conf             751551333699886057766432545455687207889999999997665528983220334485666332--234326


Q ss_pred             HHHHHHHHH-CCCEEEEECCCCCCEEEEEE----------CCCCCEEEEEECCCCCCCCCCCCCCCEEE--EEEECCCCE
Q ss_conf             899999987-49819999876753247871----------69986899995762357788887785489--999538983
Q gi|255764495|r  212 QRFQKMIWH-EGADLILHGHTHLNSLHWIK----------NEKKLIPVVGIASASQKVHSNKPQASYNL--FYIEKKNEY  278 (309)
Q Consensus       212 ~~l~~~l~~-~~v~lvl~GH~H~~~~~~~~----------~~~~~~~~~~~~s~~~~~~~~~~~~~y~l--i~i~~~~~~  278 (309)
                         .+++++ .++|+|+.||.|........          +....++++.+++-.         ..+..  ++++.+++.
T Consensus       226 ---~~~a~~~~giD~IlgGHsH~~~~~~~~~~~~g~~~~~~~~~~~~vvqag~~g---------~~vg~v~l~~~~~~~~  293 (339)
T 3jyf_A          226 ---VYYLSQVPGVDAIMFGHAHAVFPGKDFANIKGADIAKGTLNGVPAVMPGMWG---------DHLGVVDLVLNNDSGK  293 (339)
T ss_dssp             ---HHHHTTSTTCCEEEECSSCSEESSGGGTTSTTEETTTTEETTEEEEEECSTT---------SEEEEEEEEEECTTSS
T ss_pred             ---HHHHHCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCHHH---------CEEEEEEEEEECCCCE
T ss_conf             ---8898468998789969887646577645557876667774998999779577---------3888999999889981


Q ss_pred             EEEEEEEEE
Q ss_conf             899999951
Q gi|255764495|r  279 WTLEGKRYT  287 (309)
Q Consensus       279 ~~v~~~r~~  287 (309)
                      |+|.-.+..
T Consensus       294 ~~v~~~~~~  302 (339)
T 3jyf_A          294 WQVTQSKAE  302 (339)
T ss_dssp             CEEEEEEEE
T ss_pred             EEEEEEEEE
T ss_conf             899975778


No 20 
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus HB8} SCOP: d.114.1.1 d.159.1.2
Probab=99.20  E-value=8.8e-09  Score=75.19  Aligned_cols=199  Identities=15%  Similarity=0.160  Sum_probs=92.9

Q ss_pred             CCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEE-ECCCCCCCCCH-HHH
Q ss_conf             5532788994111427885410002221000121000001233089999999999626997999-93744448998-999
Q gi|255764495|r    6 TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS-ITGDIVNFTCN-REI   83 (309)
Q Consensus         6 ~~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vv-itGDl~~~~~~-~~~   83 (309)
                      ++.-++|+|++|+|=--.+......           ......-....+..+++.++++.|+.++ -+||+.+ |++ ..+
T Consensus        26 ~~~~ltILhtnD~HG~l~~~~~~~~-----------~~~~~~gG~arlat~i~~~r~~~~~~L~ld~GD~~~-Gs~~s~~   93 (552)
T 2z1a_A           26 GGFTLTLVHTNDTHAHLEPVELTLS-----------GEKTPVGGVARRVALFDRVWARAKNPLFLDAGDVFQ-GTLYFNQ   93 (552)
T ss_dssp             --CEEEEEEECCCTTCCSCEEEECS-----------SSEEEECCHHHHHHHHHHHHHHSSSEEEEECSCCSS-SSHHHHH
T ss_pred             CCCEEEEEEECCCCCCCCCCCCCCC-----------CCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCC-CCHHHHH
T ss_conf             9936999997346458636455546-----------777764759999999999997697929997898777-6399886


Q ss_pred             ---HHHHHHHHHHCCCCCEEEEECCCCCCCCCH-HHHHHHH-HHHHHCCCC----CCC-CCCCCCEEEEECCCE--EEEE
Q ss_conf             ---999999986189971899945884222203-5676643-245431344----444-555621279971987--9998
Q gi|255764495|r   84 ---FTSTHWLRSIGNPHDISIVPGNHDAYISGA-KEKSLHA-WKDYITSDT----TCS-TGKKLFPYLRIRNNI--ALIG  151 (309)
Q Consensus        84 ---~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~-~~~~~~~-~~~~~~~~~----~~~-~~~~~~~~~~~~~~~--~~i~  151 (309)
                         ....+++..+.  +. .+++||||...... ....... -.++.....    ... ......+.....+++  .++|
T Consensus        94 ~~G~~~~~~~n~~g--~D-a~~lGNHEfd~G~~~l~~~~~~~~fp~L~aNv~~~~~~~~~~~~~~y~i~~~~g~kVgviG  170 (552)
T 2z1a_A           94 YRGLADRYFMHRLR--YR-AMALGNHEFDLGPGPLADFLKGARFKVVSANVDASREPRLKGLFAPYAVVVVGGERVGIIG  170 (552)
T ss_dssp             HTTHHHHHHHHHTT--CC-EEECCGGGGTTCHHHHHHHHTTCCSEEECTTEECTTCGGGTTSCBSEEEEEETTEEEEEEE
T ss_pred             HCCHHHHHHHHCCC--CC-EEEECHHHCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCEEEEEECCCEEEEEE
T ss_conf             09817999986569--88-8976404212688999999986699888742004666434666685499970785799997


Q ss_pred             ECCCCC---CCCCCCCCEECHHHHHHHHHHHHHCCCCCC-EEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHH-CCCEEE
Q ss_conf             328888---887554760089999999999852433697-089998376888764311012797899999987-498199
Q gi|255764495|r  152 CSTAIA---TPPFSANGYFGQEQAHATSKLLRKANKKGF-FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH-EGADLI  226 (309)
Q Consensus       152 l~s~~~---~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~-~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~-~~v~lv  226 (309)
                      +.+...   ..+........+  ...+++...+.+.++. .+|++.|-..              +.-.++.++ .+++++
T Consensus       171 l~~~~~~~~~~~~~~~~~~d~--~~~~~~~v~~~~~~~~DviV~lsH~g~--------------~~d~~la~~~~~id~I  234 (552)
T 2z1a_A          171 LTTPDTREISNPGPTVAFLDP--YESAQKAVYELLAKGVNKIVVLSHLGY--------------GEDLKLARRLVGVQVI  234 (552)
T ss_dssp             EECTTHHHHSCCCTTCEECCH--HHHHHHHHHHHHHTTCCCEEEEEESCH--------------HHHHHHHTTCSSCCEE
T ss_pred             EECCCCCCCCCCCCCEEECCH--HHHHHHHHHHHHHCCCCEEEEEECCCC--------------HHHHHHHHHCCCCCEE
T ss_conf             504542110256771575558--999999999998469987999825884--------------7899999828886401


Q ss_pred             EECCCCCCE
Q ss_conf             998767532
Q gi|255764495|r  227 LHGHTHLNS  235 (309)
Q Consensus       227 l~GH~H~~~  235 (309)
                      +.||.|...
T Consensus       235 lgGHsH~~~  243 (552)
T 2z1a_A          235 VGGHSHTLL  243 (552)
T ss_dssp             EECSSCCCB
T ss_pred             ECCCCCEEC
T ss_conf             057400000


No 21 
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A*
Probab=99.19  E-value=8.7e-09  Score=75.23  Aligned_cols=227  Identities=12%  Similarity=0.100  Sum_probs=103.3

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEE-CCCCCCCCCHHH-H---H
Q ss_conf             7889941114278854100022210001210000012330899999999996269979999-374444899899-9---9
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI-TGDIVNFTCNRE-I---F   84 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvi-tGDl~~~~~~~~-~---~   84 (309)
                      ++|+|++|+|=--.+.....          ........-....+..+++.++++.|+.+++ +||+++ |++.. +   +
T Consensus         7 itILhtnD~Hg~l~~~~~~~----------~~~~~~~~GG~arlat~i~~~r~~~~~~l~ldaGD~~~-Gs~~s~~~~g~   75 (509)
T 3ive_A            7 VTIIYTNDLHAHVEPYKVPW----------IADGKRDIGGWANITTLVKQEKAKNKATWFFDAGDYFT-GPYISSLTKGK   75 (509)
T ss_dssp             EEEEEECCCTTCCSCBCCTT----------SGGGTSCBCCHHHHHHHHHHHHHHCSSEEEEECSCCSS-SSHHHHTTTTH
T ss_pred             EEEEEECCCCCCCCCCCCCC----------CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCC-CCHHHHHHCCH
T ss_conf             99999843654642568730----------24787664759999999999986396989997898877-71888775998


Q ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCCCCH-HHHHHHH-HHHHHCCCCC---CCCCC-CCCEEEEECCCE--EEEEECCCC
Q ss_conf             99999986189971899945884222203-5676643-2454313444---44555-621279971987--999832888
Q gi|255764495|r   85 TSTHWLRSIGNPHDISIVPGNHDAYISGA-KEKSLHA-WKDYITSDTT---CSTGK-KLFPYLRIRNNI--ALIGCSTAI  156 (309)
Q Consensus        85 ~~~~~~~~l~~~~~v~~v~GNHD~~~~~~-~~~~~~~-~~~~~~~~~~---~~~~~-~~~~~~~~~~~~--~~i~l~s~~  156 (309)
                      ...+++..+.  +. .+++||||...... ....... -.++......   ..... ...+.....+++  .++|+.+..
T Consensus        76 ~~~~~mn~~g--~D-a~~lGNHEFD~G~~~l~~~~~~~~fp~l~aNv~~~~~~~~~~~~~~~i~~~~G~kIgviGl~~~~  152 (509)
T 3ive_A           76 AIIDIMNTMP--FD-AVTIGNHEFDHGWDNTLLQLSQAKFPIVQGNIFYQNSSKSFWDKPYTIIEKDGVKIGVIGLHGVF  152 (509)
T ss_dssp             HHHHHHTTSC--CS-EECCCGGGGTTCHHHHHHHHTTCSSCBCCCSEEETTSCCBSSSCSEEEEEETTEEEEEEEEECHH
T ss_pred             HHHHHHHCCC--CC-EEEECHHHCCCCHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCEEEEEECCEEEEEEEEECCC
T ss_conf             9999987459--98-99984451365889999999758997784454323454646788869999899899999873455


Q ss_pred             C----CCCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCC--CCCHHHHHHHHHH-CCCEEEEEC
Q ss_conf             8----88755476008999999999985243369708999837688876431101--2797899999987-498199998
Q gi|255764495|r  157 A----TPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWH-EGADLILHG  229 (309)
Q Consensus       157 ~----~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~--~~~~~~l~~~l~~-~~v~lvl~G  229 (309)
                      .    ..+....+.......+.+++.+++.+...-.+|++.|.............  ....+.-..+.++ .++|+++.|
T Consensus       153 ~~~~~~~~~~~~~~~~~d~v~~~~~~v~~lk~~~D~II~L~H~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iD~ilgG  232 (509)
T 3ive_A          153 AFNDTVSAATRVGIEARDEIKWLQRYIDELKGKVDLTVALIHEGVPARQSSMGGTDVRRALDKDIQTASQVKGLDILITG  232 (509)
T ss_dssp             HHHHHSCGGGCTTEEECCHHHHHHHHHHHHTTTCSEEEEEEECSSCCCCCCC---CCCCCCHHHHHHHHHCSSCCEEEEE
T ss_pred             CCCCCCCCCCCCCEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEECC
T ss_conf             57763356666762776899999999886333587899975357454455667642101235678876138998768527


Q ss_pred             CCCCCEEEEEECCCCCEEEEEEC
Q ss_conf             76753247871699868999957
Q gi|255764495|r  230 HTHLNSLHWIKNEKKLIPVVGIA  252 (309)
Q Consensus       230 H~H~~~~~~~~~~~~~~~~~~~~  252 (309)
                      |.|......+..  +..+++.++
T Consensus       233 H~H~~~~~~~~~--~~~~iv~~g  253 (509)
T 3ive_A          233 HAHVGTPEPIKV--GNTLILSTD  253 (509)
T ss_dssp             SSCCCCSSCEEE--TTEEEECCC
T ss_pred             CCCCCCCCCEEC--CCEEEEECC
T ss_conf             887566554351--752566449


No 22 
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initiative, midwest center for structural genomics, PSI, MCSG; 2.40A {Aquifex aeolicus VF5} SCOP: d.159.1.8
Probab=99.17  E-value=5e-10  Score=83.39  Aligned_cols=148  Identities=21%  Similarity=0.252  Sum_probs=81.4

Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHC-CC-CEEEECCCCCCCCCHHHHHHHHHH
Q ss_conf             8994111427885410002221000121000001233089999999999626-99-799993744448998999999999
Q gi|255764495|r   12 LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NV-DHVSITGDIVNFTCNREIFTSTHW   89 (309)
Q Consensus        12 i~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~-~p-D~vvitGDl~~~~~~~~~~~~~~~   89 (309)
                      |-.+||+|||...-.+      ...+         ....+.-+.+++..++. +| |.|++.||++......  +.+.++
T Consensus         4 i~fiSD~Hfgh~~i~~------~r~f---------~~~~~~~~~ii~~wn~~V~~~D~v~~LGD~~~~~~~~--~~~~~~   66 (195)
T 1xm7_A            4 MYFISDTHFYHENIIN------LNPE---------VRFKGFEIVILTNLLKVLKPEDTLYHLGDFTWHFNDK--NEYLRI   66 (195)
T ss_dssp             EEEEBCCCBTCTTHHH------HSTT---------TCCTTHHHHHHHHHHTTCCTTCEEEECSCCBSCSCCT--TSHHHH
T ss_pred             EEEEECCCCCCCCCCC------CCCC---------CCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCH--HHHHHH
T ss_conf             7999586789835134------7998---------9999999999999984179898899927510257867--999999


Q ss_pred             HHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEECH
Q ss_conf             98618997189994588422220356766432454313444445556212799719879998328888887554760089
Q gi|255764495|r   90 LRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQ  169 (309)
Q Consensus        90 ~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~~~  169 (309)
                      +.+|.  ...+.|.||||.....        ...++.             .  ..+...++                   
T Consensus        67 l~~L~--G~k~lI~GNHD~~~~~--------~~~~~~-------------~--i~~~~~~~-------------------  102 (195)
T 1xm7_A           67 WKALP--GRKILVMGNHDKDKES--------LKEYFD-------------E--IYDFYKII-------------------  102 (195)
T ss_dssp             HHHSS--SEEEEECCTTCCCHHH--------HTTTCS-------------E--EESSEEEE-------------------
T ss_pred             HHHCC--CCEEEEECCCCCHHHH--------HHHCHH-------------H--HCCCEEEE-------------------
T ss_conf             98679--9779985778845766--------552304-------------3--31120255-------------------


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEE
Q ss_conf             9999999998524336970899983768887643110127978999999874981999987675324
Q gi|255764495|r  170 EQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL  236 (309)
Q Consensus       170 ~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~  236 (309)
                                    ..+...++++|+|+.........  .....+.++..+.+.++.++||+|.+..
T Consensus       103 --------------~~~g~~i~lsHyP~~~~~~~~~~--~~~~~~~~~~~~~~~~~~ihGH~H~~~~  153 (195)
T 1xm7_A          103 --------------EHKGKRILLSHYPAKDPITERYP--DRQEMVREIYFKENCDLLIHGHVHWNRE  153 (195)
T ss_dssp             --------------EETTEEEEEESSCSSCSSCCSCH--HHHHHHHHHHHHTTCSEEEECCCCCCSC
T ss_pred             --------------EECCEEEEEEECCCCCCCCCCCC--CCCHHHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             --------------32996999995686567543345--4303788888734985999922788977


No 23 
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A
Probab=99.16  E-value=8.9e-09  Score=75.15  Aligned_cols=213  Identities=12%  Similarity=0.008  Sum_probs=93.3

Q ss_pred             CCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCC-EEEECCCCCCCCCHHH-H
Q ss_conf             5532788994111427885410002221000121000001233089999999999626997-9999374444899899-9
Q gi|255764495|r    6 TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD-HVSITGDIVNFTCNRE-I   83 (309)
Q Consensus         6 ~~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD-~vvitGDl~~~~~~~~-~   83 (309)
                      .|.-++|+|+||+| |.-.....             ...........++.+.+.+++.+|+ +++.+||+++ |++.. +
T Consensus         5 ~t~~l~IlhtnD~H-g~~~~~~~-------------~~~g~~~~~~~i~~~r~~~~~~~~~~l~ld~GD~~~-gs~~s~~   69 (516)
T 1hp1_A            5 KTYKITVLHTNDHH-GHFWRNEY-------------GEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINT-GVPESDL   69 (516)
T ss_dssp             CCEEEEEEEECCCT-TCCSCCTT-------------SCCCHHHHHHHHHHHHHHHHHHTCEEEEEECSCCSS-SCHHHHT
T ss_pred             CEEEEEEEEECCCC-CCCCCCCC-------------CCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCC-CCHHHHH
T ss_conf             72699999976222-48747777-------------776689999999999999860398989997998888-6578777


Q ss_pred             ---HHHHHHHHHHCCCCCEEEEECCCCCCCCCH-HHHHHHH-HHHHHCCCC---CCCCCCCCCEEEEECCCEE--EEEEC
Q ss_conf             ---999999986189971899945884222203-5676643-245431344---4445556212799719879--99832
Q gi|255764495|r   84 ---FTSTHWLRSIGNPHDISIVPGNHDAYISGA-KEKSLHA-WKDYITSDT---TCSTGKKLFPYLRIRNNIA--LIGCS  153 (309)
Q Consensus        84 ---~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~-~~~~~~~-~~~~~~~~~---~~~~~~~~~~~~~~~~~~~--~i~l~  153 (309)
                         ....+++..+...   .+++||||...... ....... -.++.....   ........-+.....++++  ++|+.
T Consensus        70 ~~g~~~~~~mn~~g~D---a~~~GNHEFD~G~~~l~~~~~~~~fp~l~aNi~~~~~~~~~~~py~I~~~~g~kIgiIG~~  146 (516)
T 1hp1_A           70 QDAEPDFRGMNLVGYD---AMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLT  146 (516)
T ss_dssp             TTTHHHHHHHHHHTCC---EEECCGGGGSSCHHHHHHHHHHCSSCEECSSEEETTTTEESSBSEEEEEETTEEEEEEEEE
T ss_pred             HCCHHHHHHHHCCCCC---EEEECCHHCCCCHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCEEEEEECCEEEEEECCC
T ss_conf             4988999998657986---9998804224688999999964799888635530003644557569997668275431333


Q ss_pred             CCCC---CCCCCCCCE--ECH-HHHHHHHHHHHHCCCCCC-EEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEE
Q ss_conf             8888---887554760--089-999999999852433697-089998376888764311012797899999987498199
Q gi|255764495|r  154 TAIA---TPPFSANGY--FGQ-EQAHATSKLLRKANKKGF-FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLI  226 (309)
Q Consensus       154 s~~~---~~~~~~~g~--~~~-~q~~~l~~~L~~~~~~~~-~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lv  226 (309)
                      +...   ..+....+.  ..+ +.++.....|+..  ++. .+|++.|-..... ........+...+...+...+++++
T Consensus       147 ~~~~~~~~~~~~~~~~~f~d~~~~~~~~~~~l~~~--~~~DiII~l~H~G~~~d-~~~~~~~~~~~~~a~~~~~~~iD~I  223 (516)
T 1hp1_A          147 TDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQT--EKPDIIIAATHMGHYDN-GEHGSNAPGDVEMARALPAGSLAMI  223 (516)
T ss_dssp             CTTTTTSSSCCSCTTEEECCHHHHHHHHHHHHHHH--TCCSEEEEEEESCCCGG-GCCTTSCCCHHHHHHHSCTTSSSEE
T ss_pred             CCCCCCCCCCCCCCCCEECCHHHHHHHHHHHHHHH--CCCCEEEEEEECCCCCC-CCCCCCCCCCHHHHHHCCCCCCEEE
T ss_conf             34541124755556734558999999999998761--58988999640254455-4333347721888973567885399


Q ss_pred             EECCCCCCEEEEE
Q ss_conf             9987675324787
Q gi|255764495|r  227 LHGHTHLNSLHWI  239 (309)
Q Consensus       227 l~GH~H~~~~~~~  239 (309)
                      +.||.|.......
T Consensus       224 lgGHsH~~~~~~~  236 (516)
T 1hp1_A          224 VGGHSQDPVCMAA  236 (516)
T ss_dssp             ECCSSCCBCCEEE
T ss_pred             ECCCCCCCCCCCC
T ss_conf             8577764333235


No 24 
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein structure initiative, PSI-2; 1.90A {Candida albicans SC5314} SCOP: d.114.1.1 d.159.1.2
Probab=99.08  E-value=2e-08  Score=72.89  Aligned_cols=206  Identities=15%  Similarity=0.115  Sum_probs=90.4

Q ss_pred             CEEEEEEEECCCC--CCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEE-ECCCCCCCCCHHH--
Q ss_conf             3278899411142--7885410002221000121000001233089999999999626997999-9374444899899--
Q gi|255764495|r    8 IMFVLAHISDIHL--SYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS-ITGDIVNFTCNRE--   82 (309)
Q Consensus         8 ~m~ri~hlSDlHl--g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vv-itGDl~~~~~~~~--   82 (309)
                      .-++|+|++|+|=  ..........       .+|-      ......+.+.+.+++.++|+++ -+||+.+ |++-.  
T Consensus        14 g~l~iLHTnD~HG~l~~h~~~~~~~-------ad~G------~~~s~~~~~r~~a~~~~~d~LllDaGD~~q-Gt~lsd~   79 (557)
T 3c9f_A           14 NDINFVHTTDTHGWYSGHINQPLYH-------ANWG------DFISFTTHMRRIAHSRNQDLLLIDSGDRHD-GNGLSDI   79 (557)
T ss_dssp             CSEEEEEECCCTTCTTCCSSCGGGC-------CCHH------HHHHHHHHHHHHHHHTTCEEEEEECSCCCS-SCHHHHS
T ss_pred             CCEEEEEECCCCCCCCCCCCCCCCC-------CCHH------HHHHHHHHHHHHHHHCCCCEEEEECCCCCC-CCCCHHH
T ss_conf             7389998245677986656644556-------7616------799999999999986399989997887778-8505121


Q ss_pred             ----HHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHH-----HHHHCCCCC------CCC-CCCCCEEEE-ECC
Q ss_conf             ----999999998618997189994588422220356766432-----454313444------445-556212799-719
Q gi|255764495|r   83 ----IFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAW-----KDYITSDTT------CST-GKKLFPYLR-IRN  145 (309)
Q Consensus        83 ----~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~-----~~~~~~~~~------~~~-~~~~~~~~~-~~~  145 (309)
                          -....+++..+.  +. .+++||||.+........+..+     .++......      ... ....+.+.. ...
T Consensus        80 t~~kG~~~~~i~n~~g--yD-a~tlGNHEFd~g~~~~~~~~~~~~~~~fp~LsaNv~~~~~~~~~~p~~~~y~~~~t~~~  156 (557)
T 3c9f_A           80 TSPNGLKSTPIFIKQD--YD-LLTIGNHELYLWENSKQEYETVVNHFQDKYVCSNVDIRLDNGLFVPLGLKYKYFTTPIR  156 (557)
T ss_dssp             SSSTTTTTHHHHTTSC--CS-EECCCGGGSSSHHHHHHHHHHHHHHTTTTBBCSSEEEECTTSCEEESSBSCEEEECTTT
T ss_pred             CCCCCHHHHHHHHCCC--CC-EEEECCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCEEEEECCC
T ss_conf             1548889999987779--89-99736547776611899999998752898687677615776555654567149998328


Q ss_pred             CEEE--EEECCCCCCCCCCCCCEECHH---HHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             8799--983288888875547600899---99999999852433697089998376888764311012797899999987
Q gi|255764495|r  146 NIAL--IGCSTAIATPPFSANGYFGQE---QAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH  220 (309)
Q Consensus       146 ~~~~--i~l~s~~~~~~~~~~g~~~~~---q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~  220 (309)
                      ++++  +|+-... .............   +..|+.+.++    ++...||++-|-+......      ....+...+++
T Consensus       157 G~kIgviG~l~d~-~~~~~~~~v~~~~~~i~~~~~~e~~~----~~vD~IVvLsH~g~~~d~~------e~~~v~~~i~~  225 (557)
T 3c9f_A          157 GIRVMAFGFLFDF-KRFNSGTRVTPMAETIHEPWFQEALK----HEVDLIIIVGHTPISHNWG------EFYQVHQYLRQ  225 (557)
T ss_dssp             CCEEEEEECCCCC-CCCCTTEEECCHHHHTTSHHHHHHTT----SCCSEEEEECSSCCCTTTC------HHHHHHHHHHH
T ss_pred             CEEEEEEECCCCC-CCCCCCCEECCHHHHHHHHHHHHHHH----CCCCEEEEEECCCCCCCCC------HHHHHHHHHHH
T ss_conf             9899998534356-65788867788899999899999875----6899899986237556763------05679999997


Q ss_pred             -C--CCEEEEECCCCCCEEEEEEC
Q ss_conf             -4--98199998767532478716
Q gi|255764495|r  221 -E--GADLILHGHTHLNSLHWIKN  241 (309)
Q Consensus       221 -~--~v~lvl~GH~H~~~~~~~~~  241 (309)
                       .  .++++|.||+|......+++
T Consensus       226 ~~~d~id~I~GGHSH~r~~~~~d~  249 (557)
T 3c9f_A          226 FFPDTIIQYFGGHSHIRDFTVFDS  249 (557)
T ss_dssp             HCTTSEEEEEECSSCCEEEEEEET
T ss_pred             HCCCCCEEEECCCCCCCCCCCCCC
T ss_conf             589987699818878777644358


No 25 
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A
Probab=98.92  E-value=1.3e-07  Score=67.46  Aligned_cols=197  Identities=15%  Similarity=0.118  Sum_probs=89.6

Q ss_pred             CHHHHHHHHHHHH----HCCCC-EEEECCCCCCCCCHH-HH---HHHHHHHHHHCCCCCEEEEECCCCCCCCCHH-HHHH
Q ss_conf             0899999999996----26997-999937444489989-99---9999999861899718999458842222035-6766
Q gi|255764495|r   49 SKEVANLLINDIL----LHNVD-HVSITGDIVNFTCNR-EI---FTSTHWLRSIGNPHDISIVPGNHDAYISGAK-EKSL  118 (309)
Q Consensus        49 ~~~~l~~~~~~i~----~~~pD-~vvitGDl~~~~~~~-~~---~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~-~~~~  118 (309)
                      ..+.+..+++.++    +.+|+ +++.+||+.+ |++. .+   +...+++..+...  . + .||||.-..... ....
T Consensus       103 G~arlatli~~~R~~~~a~~~n~LlldaGD~~q-Gs~~s~~~~G~~~v~~mN~lG~D--a-~-~GNHEFd~G~~~L~~~~  177 (562)
T 2wdc_A          103 GMGALTALIRDQKARVEAEGGKALVLDGGDTWT-NSGLSLLTRGEAVVRWQNLVGVD--H-M-VSHWEWTLGRERVEELL  177 (562)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCCEEEEECSCCSS-SSHHHHHHTTHHHHHHHHHHTCC--E-E-CCSGGGGGCHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC-CCHHHHHHCCHHHHHHHHHCCCC--E-E-ECCCCCCCCHHHHHHHH
T ss_conf             899999999999999860499879996797787-71888874887899999736975--8-8-53621346888899999


Q ss_pred             HH-HHHHHCCCCC-C--CCCCCCCEEEEECCCEE--EEEECCCCC---CCCCCCCCE---ECHHHHHHHHHHHHHCCCCC
Q ss_conf             43-2454313444-4--45556212799719879--998328888---887554760---08999999999985243369
Q gi|255764495|r  119 HA-WKDYITSDTT-C--STGKKLFPYLRIRNNIA--LIGCSTAIA---TPPFSANGY---FGQEQAHATSKLLRKANKKG  186 (309)
Q Consensus       119 ~~-~~~~~~~~~~-~--~~~~~~~~~~~~~~~~~--~i~l~s~~~---~~~~~~~g~---~~~~q~~~l~~~L~~~~~~~  186 (309)
                      .. -.++...... .  .......+.....+++.  ++|+.+...   .++....+.   ...+.++..-..|   +.++
T Consensus       178 ~~~~fp~L~aNv~~~~~~~~~~~py~i~~~~G~kVgvIG~t~~~~~~~~~~~~~~~~~f~d~~~~~~~~v~~l---r~~g  254 (562)
T 2wdc_A          178 GLFRGEFLSYNIVDDLFGDPLFPAYRIHRVGPYALAVVGASYPYVKVSHPESFTEGLSFALDERRLQEAVDKA---RAEG  254 (562)
T ss_dssp             HHCCSEECCSSCEETTTCCBSSCSEEEEEETTEEEEEEEECCTTHHHHSCGGGGTTEECCCCHHHHHHHHHHH---HHTT
T ss_pred             HHCCCCEEECCCCCCCCCCCCCCCEEEEEECCEEEEEECCCCCCCCCCCCCCCCCCCEECCHHHHHHHHHHHH---HHCC
T ss_conf             7569977751110034578267765999989989998423577642024534557735778999999999998---7538


Q ss_pred             CEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHC-CCEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCC
Q ss_conf             70899983768887643110127978999999874-98199998767532478716998689999576235778888778
Q gi|255764495|r  187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQA  265 (309)
Q Consensus       187 ~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~-~v~lvl~GH~H~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~  265 (309)
                      ...||++-|.-             .+.-.++.++. ++|+|+.||+|.........  +.++++.+++-.         .
T Consensus       255 ~DvIV~LsH~G-------------~~~d~~la~~v~gIDvIlgGHtH~~~~~p~~~--~~t~iv~ag~~g---------~  310 (562)
T 2wdc_A          255 ANAVVLLSHNG-------------MQLDAALAERIRGIDLILSGHTHDLTPRPWRV--GKTWIVAGSAAG---------K  310 (562)
T ss_dssp             CSEEEEEECSC-------------HHHHHHHHTTSSSCCEEEECSSCCCCSSCEEE--TTEEEEECCSTT---------C
T ss_pred             CCEEEEEECCC-------------CCCCHHHHHHCCCCCEEEECCCCCCCEEEEEE--CCEEEECCCCCC---------C
T ss_conf             98899960578-------------53106788622574089826677641000243--333663178663---------5


Q ss_pred             CEEEEEEECCCC
Q ss_conf             548999953898
Q gi|255764495|r  266 SYNLFYIEKKNE  277 (309)
Q Consensus       266 ~y~li~i~~~~~  277 (309)
                      ....++++-++.
T Consensus       311 ~lg~ldl~~~~~  322 (562)
T 2wdc_A          311 ALMRVDLKLWKG  322 (562)
T ss_dssp             EEEEEEEEEETT
T ss_pred             EEEEEEEEEECC
T ss_conf             799999999799


No 26 
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3
Probab=98.71  E-value=1.6e-07  Score=66.85  Aligned_cols=70  Identities=20%  Similarity=0.223  Sum_probs=50.3

Q ss_pred             CCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHH-CCCCEEEECCCCCCCCCHH
Q ss_conf             432553278899411142788541000222100012100000123308999999999962-6997999937444489989
Q gi|255764495|r    3 KRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHVSITGDIVNFTCNR   81 (309)
Q Consensus         3 ~~~~~~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~-~~pD~vvitGDl~~~~~~~   81 (309)
                      .+|+    ||..|||||=                            ....|+++++.+.. ...|.+|+.||+++.|...
T Consensus        10 ~~~~----ri~vIgDIHG----------------------------~~~~L~~lL~~~~~~~~~d~lv~lGD~vDrGp~s   57 (221)
T 1g5b_A           10 SKYR----NIWVVGDLHG----------------------------CYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAEN   57 (221)
T ss_dssp             GGCS----CEEEECCCTT----------------------------CHHHHHHHHHHHTCCTTTCEEEECSCCSSSSSCH
T ss_pred             CCCC----EEEEEECCCC----------------------------CHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCC
T ss_conf             8887----7999940006----------------------------9999999999748998777899917761568874


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCCCCC
Q ss_conf             99999999986189971899945884222
Q gi|255764495|r   82 EIFTSTHWLRSIGNPHDISIVPGNHDAYI  110 (309)
Q Consensus        82 ~~~~~~~~~~~l~~~~~v~~v~GNHD~~~  110 (309)
                      .     +.++.+. ...+.+|.||||...
T Consensus        58 ~-----~vl~~l~-~~~~~~i~GNHE~~~   80 (221)
T 1g5b_A           58 V-----ECLELIT-FPWFRAVRGNHEQMM   80 (221)
T ss_dssp             H-----HHHGGGG-STTEEECCCHHHHHH
T ss_pred             H-----HHHHHHH-CCCCCCCCCCHHHHH
T ss_conf             8-----9999764-434454678189999


No 27 
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A
Probab=98.49  E-value=1.6e-06  Score=60.35  Aligned_cols=70  Identities=19%  Similarity=0.286  Sum_probs=46.6

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHH--------CCCCEEEECCCCCCCCCHH
Q ss_conf             78899411142788541000222100012100000123308999999999962--------6997999937444489989
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--------HNVDHVSITGDIVNFTCNR   81 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~--------~~pD~vvitGDl~~~~~~~   81 (309)
                      -||+.|||+|=+                            .+.|.++++.+.-        ...+.+|+.||++|+|...
T Consensus        71 ~ri~aIGDiHG~----------------------------~~~l~~lL~~~~~~d~~~~~~~~~~~lV~lGD~iDRG~~s  122 (342)
T 2z72_A           71 KKVVALSDVHGQ----------------------------YDVLLTLLKKQKIIDSDGNWAFGEGHMVMTGDIFDRGHQV  122 (342)
T ss_dssp             CEEEEECCCTTC----------------------------HHHHHHHHHHTTSBCTTSCBCCTTCEEEECSCCSSSSSCH
T ss_pred             CEEEEEECCCCC----------------------------HHHHHHHHHHCCCCCCCCCCCCCCCEEEECCCCCCCCCCC
T ss_conf             879999887679----------------------------9999999997699752124688776699636524899870


Q ss_pred             HHHHHHHHHHHH-----CCCCCEEEEECCCCCC
Q ss_conf             999999999861-----8997189994588422
Q gi|255764495|r   82 EIFTSTHWLRSI-----GNPHDISIVPGNHDAY  109 (309)
Q Consensus        82 ~~~~~~~~~~~l-----~~~~~v~~v~GNHD~~  109 (309)
                      .  ....++..|     ..+..|+++.||||.+
T Consensus       123 ~--evl~ll~~L~~~a~~~gg~v~~llGNHE~m  153 (342)
T 2z72_A          123 N--EVLWFMYQLDQQARDAGGMVHLLMGNHEQM  153 (342)
T ss_dssp             H--HHHHHHHHHHHHHHHTTCEEEECCCHHHHH
T ss_pred             H--HHHHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             9--999999999886443488199970536887


No 28 
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei}
Probab=98.48  E-value=4.6e-07  Score=63.87  Aligned_cols=66  Identities=24%  Similarity=0.276  Sum_probs=49.8

Q ss_pred             EEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHH-CCCCEEEECCCCCCCCCHHHHHHHHH
Q ss_conf             78899411142788541000222100012100000123308999999999962-69979999374444899899999999
Q gi|255764495|r   10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHVSITGDIVNFTCNREIFTSTH   88 (309)
Q Consensus        10 ~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~-~~pD~vvitGDl~~~~~~~~~~~~~~   88 (309)
                      =||+.++|+|=                            ..+.|+++++.+.. .+.|.+|+.||+++.|....  ...+
T Consensus        19 gRi~viGDIHG----------------------------~~~~L~~lL~~i~~~~~~d~lv~lGDliDrGp~s~--~vl~   68 (262)
T 2qjc_A           19 GRVIIVGDIHG----------------------------CRAQLEDLLRAVSFKQGSDTLVAVGDLVNKGPDSF--GVVR   68 (262)
T ss_dssp             SCEEEECCCTT----------------------------CHHHHHHHHHHHTCCTTTSEEEECSCCSSSSSCHH--HHHH
T ss_pred             CCEEEEEECCC----------------------------CHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCH--HHHH
T ss_conf             98899995026----------------------------98999999996489989998998378317998839--9999


Q ss_pred             HHHHHCCCCCEEEEECCCCCC
Q ss_conf             998618997189994588422
Q gi|255764495|r   89 WLRSIGNPHDISIVPGNHDAY  109 (309)
Q Consensus        89 ~~~~l~~~~~v~~v~GNHD~~  109 (309)
                      ++.++    .+.+|.||||..
T Consensus        69 ~l~~~----~~~~v~GNHE~~   85 (262)
T 2qjc_A           69 LLKRL----GAYSVLGNHDAK   85 (262)
T ss_dssp             HHHHH----TCEECCCHHHHH
T ss_pred             HHHCC----CCEEECCCHHHH
T ss_conf             87646----645840647999


No 29 
>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens}
Probab=98.45  E-value=4.3e-07  Score=64.04  Aligned_cols=217  Identities=12%  Similarity=0.126  Sum_probs=104.3

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCC-----------
Q ss_conf             889941114278854100022210001210000012330899999999996269979999374444899-----------
Q gi|255764495|r   11 VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTC-----------   79 (309)
Q Consensus        11 ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~-----------   79 (309)
                      .++.+||+|+|.......+....+..   |..+....        .-+...+.++..||++||.+....           
T Consensus       202 ~i~fvSgL~ig~~~~~~~l~~~ll~d---~L~G~l~~--------~~~~~~as~I~rlIIaGn~v~~~~~~~d~~~~~~~  270 (476)
T 3e0j_A          202 FVLLVSGLGLGGGGGESLLGTQLLVD---VVTGQLGD--------EGEQCSAAHVSRVILAGNLLSHSTQSRDSINKAKY  270 (476)
T ss_dssp             EEEEECCCCBTSSCHHHHHHHHHHHH---HHHTCSSC--------HHHHHHHTTEEEEEEESCSBCC-------------
T ss_pred             CEEECCCCCEEECCCCCCHHHHHHHH---HHCCCCCC--------CCCCCCHHCEEEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             22431575212113543025789999---86075477--------43322010624999979937755567433454666


Q ss_pred             ---------HHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHH-HHHHHHHCCCCCCCCCCCCCEEEEECCCEEE
Q ss_conf             ---------899999999998618997189994588422220356766-4324543134444455562127997198799
Q gi|255764495|r   80 ---------NREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSL-HAWKDYITSDTTCSTGKKLFPYLRIRNNIAL  149 (309)
Q Consensus        80 ---------~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  149 (309)
                               .+.+..+..++.++...++|.++|||||..........+ ....+...  ..........|+....+++.+
T Consensus       271 ~~k~~~~~~~~~~~~ld~~L~~i~~si~V~lmPG~~Dp~~~alPQqplh~~~fp~~~--~~~n~~~vtNP~~~~I~Gv~~  348 (476)
T 3e0j_A          271 LTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLAT--AYSTLQLVTNPYQATIDGVRF  348 (476)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHTTSCEEEECCTTSSSCSSSSCCCCCTTSCHHHH--TSTTEEECCSSEEEEETTEEE
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHC--CCCCEEEECCCEEEEECCEEE
T ss_conf             542111001899999999999724576499927886644445787876865622001--478408807986999999999


Q ss_pred             EEECCCCCCCCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEC
Q ss_conf             98328888887554760089999999999852433697089998376888764311012797899999987498199998
Q gi|255764495|r  150 IGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHG  229 (309)
Q Consensus       150 i~l~s~~~~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~G  229 (309)
                      ++...-....-.... .. +..++.++..|+.-           |-.|..+.+-+-....+.+-|  ++.+ -.+++++|
T Consensus       349 LgtsGq~i~Di~ky~-~~-~~~l~~me~~L~~r-----------hlaPtapdtl~~~P~~~~Dpf--vi~~-~Phv~f~G  412 (476)
T 3e0j_A          349 LGTSGQNVSDIFRYS-SM-EDHLEILEWTLRVR-----------HISPTAPDTLGCYPFYKTDPF--IFPE-CPHVYFCG  412 (476)
T ss_dssp             EECSSHHHHHHHHHS-CC-CCHHHHHHHHHHBT-----------CSCTTSCCC------CCSCTT--SCSS-CCSEEEEE
T ss_pred             EEECCCCHHHHHHHC-CC-CCHHHHHHHHHHHH-----------CCCCCCCCCEEECCCCCCCCE--EECC-CCCEEEEC
T ss_conf             997999889998746-87-99999999999973-----------747789982122205788961--3169-99789969


Q ss_pred             CCCCCEEEEEECCCCC-EEEEEECCCCC
Q ss_conf             7675324787169986-89999576235
Q gi|255764495|r  230 HTHLNSLHWIKNEKKL-IPVVGIASASQ  256 (309)
Q Consensus       230 H~H~~~~~~~~~~~~~-~~~~~~~s~~~  256 (309)
                      |.|.-....+.+..+. +..+.+|+.+.
T Consensus       413 nq~~f~t~~~~g~~~~~v~li~vP~F~~  440 (476)
T 3e0j_A          413 NTPSFGSKIIRGPEDQTVLLVTVPDFSA  440 (476)
T ss_dssp             EESSCEEEEEECSSCCEEEEEEEECHHH
T ss_pred             CCCCEEEEEEECCCCCEEEEEEECCCCC
T ss_conf             9774113688668886689998389777


No 30 
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A}
Probab=97.88  E-value=1.4e-05  Score=54.13  Aligned_cols=57  Identities=21%  Similarity=0.360  Sum_probs=41.3

Q ss_pred             HHHHHHHHHHHHHC-CCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCC
Q ss_conf             89999999999626-99799993744448998999999999986189971899945884222
Q gi|255764495|r   50 KEVANLLINDILLH-NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI  110 (309)
Q Consensus        50 ~~~l~~~~~~i~~~-~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~  110 (309)
                      .+.|+++++.+.-. .-|.+|+.||++++|+..  ....+++..+  +..+.+|.||||...
T Consensus        13 ~~~l~~lL~~i~~~~~~D~Lv~lGD~iDRGpds--~~vl~~~~~l--~~~~~~v~GNHE~~~   70 (280)
T 2dfj_A           13 YDELIALLHKVEFTPGKDTLWLTGDLVARGPGS--LDVLRYVKSL--GDSVRLVLGNHDLHL   70 (280)
T ss_dssp             HHHHHHHHHHTTCCTTTCEEEECSCCSSSSSCH--HHHHHHHHHT--GGGEEECCCHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCCCEEEEECCEECCCCCH--HHHHHHHHHC--CCCCCCCCCCHHHHH
T ss_conf             999999999639998888899926452699798--9999999970--446420355346788


No 31 
>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc-binding motif, DNA replication; HET: DNA; 2.50A {Saccharomyces cerevisiae}
Probab=97.74  E-value=0.0024  Score=39.37  Aligned_cols=102  Identities=16%  Similarity=0.065  Sum_probs=56.2

Q ss_pred             CHHHHHHHHHHHHH-CCCCEEEECCCCCCCCCH--------------------HH-H-HHHHHHHHHHCCCCCEEEEECC
Q ss_conf             08999999999962-699799993744448998--------------------99-9-9999999861899718999458
Q gi|255764495|r   49 SKEVANLLINDILL-HNVDHVSITGDIVNFTCN--------------------RE-I-FTSTHWLRSIGNPHDISIVPGN  105 (309)
Q Consensus        49 ~~~~l~~~~~~i~~-~~pD~vvitGDl~~~~~~--------------------~~-~-~~~~~~~~~l~~~~~v~~v~GN  105 (309)
                      ....|..+++.+.. .+|+.+|+.|+.++...+                    .+ + ..+..++..+....+|.+|||+
T Consensus       164 ~~e~L~~ll~~~~~~~~p~~LIL~Gpfvd~~~~~i~~g~~~~~~~~~~~~~~~~~~f~~~l~~~l~~i~~~~~vilvPg~  243 (460)
T 3flo_A          164 SLELLQEFIDSINNEVKPHVLIMFGPFIDITHPLIASGKLPNFPQFKTQPKTLDELFLKLFTPILKTISPHIQTVLIPST  243 (460)
T ss_dssp             CCHHHHHHHHHHHHTTCCSEEEEESCSSBTTCHHHHHTCCCCCTTCSSCCSSHHHHHHHHTHHHHTTSCTTSEEEEECCT
T ss_pred             CHHHHHHHHHHHHCCCCCCEEEEECCEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             58999999987525468977999547251466401157756731112014568999999999877424566469995688


Q ss_pred             CCCCCC---CHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECC
Q ss_conf             842222---0356766432454313444445556212799719879998328
Q gi|255764495|r  106 HDAYIS---GAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCST  154 (309)
Q Consensus       106 HD~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s  154 (309)
                      ||....   .....+.    +...............|.....+++.+.+...
T Consensus       244 ~D~~~~~~~~PQpp~~----~~~~~~~~~~i~~~sNP~~~~in~v~i~~~s~  291 (460)
T 3flo_A          244 KDAISNHAAYPQASLI----RKALQLPKRNFKCMANPSSFQINEIYFGCSNV  291 (460)
T ss_dssp             TBTTCSCCSBSBCCCC----TTTTTCCTTTEEECCBSEEEEETTEEEEECCS
T ss_pred             CCCCCCCCCCCCCCCC----HHHHHCCCCCEEECCCCEEEEECCEEEEEECC
T ss_conf             6532345456887661----66651100150862797598999989999577


No 32 
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 2nym_C* 2nyl_C*
Probab=97.04  E-value=0.0066  Score=36.52  Aligned_cols=59  Identities=15%  Similarity=-0.002  Sum_probs=35.5

Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCC
Q ss_conf             99999996269979999374444899899999999998618997189994588422220
Q gi|255764495|r   54 NLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISG  112 (309)
Q Consensus        54 ~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~  112 (309)
                      -.+++......-.-.|+.||.+|+|...---...-+.-.+.-|..|+.+.|||+.....
T Consensus        66 ~~i~~~~~~p~~~~ylFLGDYVDRG~~slE~i~lL~alKi~~P~~v~lLRGNHE~~~~n  124 (309)
T 2ie4_C           66 MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQIT  124 (309)
T ss_dssp             HHHHHHHCCTTTSCEEECSCCSSSSTTHHHHHHHHHHHHHHCTTTEEECCCTTSSTTGG
T ss_pred             HHHHHHCCCCCCCCEECCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCCCC
T ss_conf             99999659997654881585047887642899999999820887166613777433246


No 33 
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A
Probab=96.07  E-value=0.064  Score=30.03  Aligned_cols=45  Identities=18%  Similarity=0.150  Sum_probs=30.3

Q ss_pred             EEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCC
Q ss_conf             999937444489989999999999861899718999458842222
Q gi|255764495|r   67 HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYIS  111 (309)
Q Consensus        67 ~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~  111 (309)
                      -.++.||.+|+|...-.-.+.-+.-.+..|..|+.+.|||+....
T Consensus        90 ~ylFLGDYVDRG~~slEvi~lL~alKi~yP~~v~LLRGNHE~~~~  134 (315)
T 3h63_A           90 PYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNM  134 (315)
T ss_dssp             CEEEESCCSSSSTTHHHHHHHHHHHHHHSTTTEEEECCTTSSHHH
T ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCC
T ss_conf             699837632678774427999999974188738983587767543


No 34 
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3
Probab=95.80  E-value=0.09  Score=29.05  Aligned_cols=77  Identities=13%  Similarity=0.098  Sum_probs=41.8

Q ss_pred             CCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEEEEE
Q ss_conf             27978999999874981999987675324787169986899995762357788887785489999538983899999951
Q gi|255764495|r  208 MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT  287 (309)
Q Consensus       208 ~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~y~li~i~~~~~~~~v~~~r~~  287 (309)
                      ..+.+.+.+.+++.+.++++-||.=.+.-..+.- ++.  ++.+-|++..-...+  +.=.++.|+.+  ....++....
T Consensus       383 ~fg~~~~~~fl~~n~l~~iiR~H~~~~~G~~~~~-~~~--~~TvfSa~~y~~~~~--n~~~~~~~~~~--~~~~~~~~~~  455 (477)
T 1wao_1          383 QFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAH-GGR--CVTVFSAPNYCDQMG--NKASYIHLQGS--DLRPQFHQFT  455 (477)
T ss_dssp             EECHHHHHHHHHHTTCCEEEECCSCCTEEEEEEG-GGT--EEEEBCCTTTTSSSC--CEEEEEEEETT--EEEEEEEEEC
T ss_pred             EECHHHHHHHHHHCCCCEEEECCCCCCCCEEEEC-CCC--EEEEECCCCCCCCCC--CCEEEEEEECC--CCEEEEEEEC
T ss_conf             2589999999998699389987976206346735-994--899956886578988--56589999779--8625689814


Q ss_pred             CCCC
Q ss_conf             3776
Q gi|255764495|r  288 LSPD  291 (309)
Q Consensus       288 ~~~d  291 (309)
                      ..|.
T Consensus       456 ~~~~  459 (477)
T 1wao_1          456 AVPH  459 (477)
T ss_dssp             CCCC
T ss_pred             CCCC
T ss_conf             7998


No 35 
>3icf_A PPT, serine/threonine-protein phosphatase T; iron, metalloprotein, structural genomics, PSI-2, protein structure initiative; 2.30A {Saccharomyces cerevisiae}
Probab=95.33  E-value=0.08  Score=29.40  Aligned_cols=60  Identities=15%  Similarity=0.084  Sum_probs=36.9

Q ss_pred             HHHHHHHHHHCCCC-EEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCC
Q ss_conf             99999999626997-9999374444899899999999998618997189994588422220
Q gi|255764495|r   53 ANLLINDILLHNVD-HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISG  112 (309)
Q Consensus        53 l~~~~~~i~~~~pD-~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~  112 (309)
                      |-.+++......|+ -.++.||.+|+|...---.+.-+.-.+..|..|+.+.|||+.....
T Consensus        79 L~~if~~~g~~~~~~~ylFLGDYVDRG~~slEvl~lL~~lKi~~P~~v~LLRGNHE~~~~n  139 (335)
T 3icf_A           79 VLNLFRKFGKVGPKHTYLFNGDFVDRGSWSCEVALLFYCLKILHPNNFFLNRGNHESDNMN  139 (335)
T ss_dssp             HHHHHHHHCCCBTTEEEEECSCCSSSSTTHHHHHHHHHHHHHHCTTTEEECCCTTSSHHHH
T ss_pred             HHHHHHHCCCCCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCC
T ss_conf             9999998099997770883776655799851999999999971898688735777673113


No 36 
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 PDB: 2p6b_A 1tco_A* 1mf8_A* 1m63_A* 2jog_A
Probab=94.95  E-value=0.073  Score=29.67  Aligned_cols=78  Identities=13%  Similarity=0.201  Sum_probs=42.1

Q ss_pred             CCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEE--CCC-CCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEE
Q ss_conf             279789999998749819999876753247871--699-86899995762357788887785489999538983899999
Q gi|255764495|r  208 MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK--NEK-KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGK  284 (309)
Q Consensus       208 ~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~--~~~-~~~~~~~~~s~~~~~~~~~~~~~y~li~i~~~~~~~~v~~~  284 (309)
                      +.+...+.+.|++.+.++++-||.=...-....  +.. +.-.++.+-|++..-...+  +.=.++.++.+    .+.++
T Consensus       259 ~FG~~a~~~FL~~N~L~lIIRaHE~v~~Gy~~~~~~k~~~~p~viTVFSApnYc~~~n--N~aavl~~~~~----~~~i~  332 (521)
T 1aui_A          259 FYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYN--NKAAVLKYENN----VMNIR  332 (521)
T ss_dssp             EECHHHHHHHHHHTTCSEEEECCSCCTTSEEECCBCTTTSSBSEEEECCCSSGGGTSC--CCEEEEEEETT----EEEEE
T ss_pred             EECHHHHHHHHHHCCCCEEEEECCCHHHHHHHHCCCCCCCCCCEEEECCCCCCCCCCC--CEEEEEEECCC----CEEEE
T ss_conf             8686999999998699789982723150544424886678887899733885456779--87999998589----60489


Q ss_pred             EEECCCC
Q ss_conf             9513776
Q gi|255764495|r  285 RYTLSPD  291 (309)
Q Consensus       285 r~~~~~d  291 (309)
                      .....|-
T Consensus       333 qF~~~ph  339 (521)
T 1aui_A          333 QFNCSPH  339 (521)
T ss_dssp             EECCCCC
T ss_pred             EECCCCC
T ss_conf             8478999


No 37 
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha catalytic subunit; PP1:nodularin CO-carbohydrate metabolism, cell cycle, cell division; HET: X9A; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A*
Probab=94.72  E-value=0.19  Score=26.87  Aligned_cols=65  Identities=17%  Similarity=0.191  Sum_probs=38.1

Q ss_pred             CCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCC
Q ss_conf             2797899999987498199998767532478716998689999576235778888778548999953898
Q gi|255764495|r  208 MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE  277 (309)
Q Consensus       208 ~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~y~li~i~~~~~  277 (309)
                      +.+.+.+.+.+++.+.++++-||.=.+.-..+.- ++.  ++..-|++..-  +..++.=.++.|+++..
T Consensus       225 ~fg~~~~~~Fl~~n~l~~IIR~He~v~~G~~~~~-~~~--viTvFSa~nY~--~~~~N~gail~i~~~~~  289 (299)
T 3e7a_A          225 TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFA-KRQ--LVTLFSAPNYC--GEFDNAGAMMSVDETLM  289 (299)
T ss_dssp             EECHHHHHHHHHHHTCSEEEECCSCCTTSEEEET-TTT--EEEEBCCSSGG--GTCCCCEEEEEECTTCC
T ss_pred             ECCHHHHHHHHHHCCCEEEEECCCCCCCCCEEEC-CCC--EEEEEECCCCC--CCCCCCEEEEEECCCCC
T ss_conf             0588999999998698199975836006716736-995--89996388757--88887379999989970


No 38 
>1fjm_A Protein serine/threonine phosphatase-1 (alpha isoform, type 1); hydrolase, complex (hydrolase/toxin) complex; HET: ADD; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3
Probab=93.96  E-value=0.28  Score=25.81  Aligned_cols=65  Identities=17%  Similarity=0.179  Sum_probs=37.3

Q ss_pred             CCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCC
Q ss_conf             2797899999987498199998767532478716998689999576235778888778548999953898
Q gi|255764495|r  208 MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE  277 (309)
Q Consensus       208 ~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~y~li~i~~~~~  277 (309)
                      +.+.+.+.+.+++.+.++++-||.=...-..+. .++.  ++.+-|++..-...+  +.=.++.|+++..
T Consensus       226 ~fg~~~~~~Fl~~n~l~lIIR~He~v~~G~~~~-~~~~--viTvFSa~nY~~~~~--N~~ail~i~~~~~  290 (330)
T 1fjm_A          226 TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFF-AKRQ--LVTLFSAPNYCGEFD--NAGAMMSVDETLM  290 (330)
T ss_dssp             EECHHHHHHHHHHHTCSEEEECCSCCTTSEEEE-TTTT--EEEEBCCTTCCSSSC--CCEEEEEECTTCC
T ss_pred             ECCHHHHHHHHHHCCCCEEEECCCCCCCCEEEE-CCCC--EEEEECCCCCCCCCC--CCEEEEEECCCCC
T ss_conf             348899999999879907986385412770794-5994--899944874367888--7579999999884


No 39 
>1t71_A Phosphatase, conserved; crystal, X-RAY crystallography, structural genomics, berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9
Probab=85.97  E-value=1.5  Score=21.11  Aligned_cols=190  Identities=13%  Similarity=0.043  Sum_probs=85.7

Q ss_pred             CEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHH-HHCCCCEEEECCCCCCCCCHHHHHHH
Q ss_conf             32788994111427885410002221000121000001233089999999999-62699799993744448998999999
Q gi|255764495|r    8 IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI-LLHNVDHVSITGDIVNFTCNREIFTS   86 (309)
Q Consensus         8 ~m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i-~~~~pD~vvitGDl~~~~~~~~~~~~   86 (309)
                      .| ||+.+.|+= |.                         .....++..+..+ ++.++|+||..|.-+-.|.--.-+.+
T Consensus         4 ~M-kiLfiGDIv-G~-------------------------~Gr~~v~~~Lp~l~~~~~iDfvIaNgENaa~G~Git~~~~   56 (281)
T 1t71_A            4 SI-KFIFLGDVY-GK-------------------------AGRNIIKNNLAQLKSKYQADLVIVNAENTTHGKGLSLKHY   56 (281)
T ss_dssp             CC-EEEEECEEB-HH-------------------------HHHHHHHTTHHHHHHHHTCSEEEEECTBTTTTSSCCHHHH
T ss_pred             CC-EEEEEEECC-CH-------------------------HHHHHHHHHHHHHHHHHCCCEEEECCCCCCCCCCCCHHHH
T ss_conf             43-699998068-88-------------------------8999999980999998289999989853678969899999


Q ss_pred             HHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCC----CCCCCCEEEEECCCEEEEEECCCC--CCCC
Q ss_conf             9999861899718999458842222035676643245431344444----555621279971987999832888--8887
Q gi|255764495|r   87 THWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCS----TGKKLFPYLRIRNNIALIGCSTAI--ATPP  160 (309)
Q Consensus        87 ~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~i~l~s~~--~~~~  160 (309)
                      .++++ .  .+.| +..|||=........ +.....+..+......    ...+........++..+..+|-.-  ...+
T Consensus        57 ~~l~~-~--GvDv-iT~GNH~wd~kei~~-~i~~~~~ilRP~N~p~~~p~~~pG~G~~i~~~~~~~i~Vinl~Gr~fm~~  131 (281)
T 1t71_A           57 EFLKE-A--GVNY-ITMGNHTWFQKLDLA-VVINKKDLVRPLNLDTSFAFHNLGQGSLVFEFNKAKIRITNLLGTSVPLP  131 (281)
T ss_dssp             HHHHH-H--TCCE-EECCTTTTCCGGGHH-HHTTCTTEECBSCBCTTSTTTTSSBSEEEEECSSCEEEEEEEECTTSCCS
T ss_pred             HHHHH-H--CCCE-EECCCCCCCCHHHHH-HHHCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCEEEEEHHCCCCCCC
T ss_conf             99997-1--9989-924721025635799-88526643104545544678888875799951674254210117435687


Q ss_pred             CCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEE
Q ss_conf             55476008999999999985243369708999837688876431101279789999998749819999876753247871
Q gi|255764495|r  161 FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK  240 (309)
Q Consensus       161 ~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~  240 (309)
                      ..   ...+  ..-+...+.+  .+....+|=+|--    +++       -.........-.|.+|+-=|+|.+....--
T Consensus       132 ~~---~~~p--f~~~~~~~~~--~~~~~iiVDfHAE----ATS-------EK~Amg~~lDGrVsaVvGTHTHV~TaD~rI  193 (281)
T 1t71_A          132 FK---TTNP--FKVLKELILK--RDCDLHIVDFHAE----TTS-------EKNAFCMAFDGYVTTIFGTHTHVPSADLRI  193 (281)
T ss_dssp             SC---BCCH--HHHHHHHHTT--CCCSEEEEEEECS----CHH-------HHHHHHHHHTTTSSEEEEESSSSCCTTCEE
T ss_pred             CC---CCCH--HHHHHHHHHC--CCCCEEEEECCCC----HHH-------HHHHHHHHHCCCEEEEEECCCCCCCCCCEE
T ss_conf             54---5635--6777788753--4798799973551----178-------999999873698789985675622676647


Q ss_pred             CCCCCEE
Q ss_conf             6998689
Q gi|255764495|r  241 NEKKLIP  247 (309)
Q Consensus       241 ~~~~~~~  247 (309)
                      -++|...
T Consensus       194 Lp~GTAy  200 (281)
T 1t71_A          194 TPKGSAY  200 (281)
T ss_dssp             CTTSCEE
T ss_pred             CCCCCEE
T ss_conf             5898199


No 40 
>1xwy_A DNAse TATD, deoxyribonuclease TATD; TIM barrael, zinc ION, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.1.9.12
Probab=78.66  E-value=2.7  Score=19.32  Aligned_cols=136  Identities=19%  Similarity=0.106  Sum_probs=76.9

Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             99999999626997999937444489989999999999861899718999458842222035676643245431344444
Q gi|255764495|r   53 ANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCS  132 (309)
Q Consensus        53 l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~  132 (309)
                      ++.+++.+.+.+...+++.|-     .++++..+.++.+...   .++...|=|=.+....................   
T Consensus        21 ~~~vl~~a~~~gV~~ii~~~~-----~~~~~~~~~~la~~~~---~i~~~~GiHP~~~~~~~~~~~~~~~~~~~~~~---   89 (264)
T 1xwy_A           21 RDDVVACAFDAGVNGLLITGT-----NLRESQQAQKLARQYS---SCWSTAGVHPHDSSQWQAATEEAIIELAAQPE---   89 (264)
T ss_dssp             HHHHHHHHHHTTCCEEEECCC-----SHHHHHHHHHHHHHST---TEEEEECCCGGGGGGCCHHHHHHHHHHHTSTT---
T ss_pred             HHHHHHHHHHCCCCEEEEECC-----CHHHHHHHHHHHHHCC---CEEEEEEECCCHHHCCCHHHHHHHHHHHCCCC---
T ss_conf             999999999889988999538-----9999999999997589---85899611815232046557999999970887---


Q ss_pred             CCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHH
Q ss_conf             55562127997198799983288888875547600899999999998524336970899983768887643110127978
Q gi|255764495|r  133 TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ  212 (309)
Q Consensus       133 ~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~  212 (309)
                              +   -.+.-+|||-.....       ....|...+.++|+-+..-+.+  ++.|-.            .-.+
T Consensus        90 --------~---~aIGEiGLD~~~~~~-------~~~~q~~~f~~ql~lA~~~~~P--vviH~r------------~a~~  137 (264)
T 1xwy_A           90 --------V---VAIGECGLDFNRNFS-------TPEEQERAFVAQLRIAADLNMP--VFMHCR------------DAHE  137 (264)
T ss_dssp             --------E---EEEEEEEEETTTCSS-------CHHHHHHHHHHHHHHHHHHTCC--EEEEEE------------SCHH
T ss_pred             --------C---EEEEECCCCCCCCCC-------CHHHHHHHHHHHHHHHHHCCCC--EEEEEC------------CCHH
T ss_conf             --------2---488621555011344-------1779999999999998517997--799864------------5478


Q ss_pred             HHHHHHHHCC---CEEEEECCC
Q ss_conf             9999998749---819999876
Q gi|255764495|r  213 RFQKMIWHEG---ADLILHGHT  231 (309)
Q Consensus       213 ~l~~~l~~~~---v~lvl~GH~  231 (309)
                      ++.++++++.   ...++|...
T Consensus       138 ~~~~il~~~~~~~~~~v~H~f~  159 (264)
T 1xwy_A          138 RFMTLLEPWLDKLPGAVLHCFT  159 (264)
T ss_dssp             HHHHHHGGGGGGSSCEEECSCC
T ss_pred             HHHHHHHHHHCCCCCEEEEEEE
T ss_conf             9999999974368877899722


No 41 
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus HB8} SCOP: d.159.1.10 PDB: 2cv9_A
Probab=78.11  E-value=2.8  Score=19.22  Aligned_cols=176  Identities=15%  Similarity=0.068  Sum_probs=84.2

Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             89999999999626997999937444489989999999999861899718999458842222035676643245431344
Q gi|255764495|r   50 KEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT  129 (309)
Q Consensus        50 ~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~  129 (309)
                      ...++..+..++++ .|+||..|.-+-.|.--.-+.+.++++ .  .+.+ +..|||=...+.... +... .+..+...
T Consensus        15 r~~v~~~Lp~l~~~-~DfvIaNgENaa~G~Git~~~~~~l~~-~--GvDv-iT~GNH~wd~kei~~-~i~~-~~ilRP~N   87 (252)
T 2z06_A           15 LRAVGLHLPDIRDR-YDLVIANGENAARGKGLDRRSYRLLRE-A--GVDL-VSLGNHAWDHKEVYA-LLES-EPVVRPLN   87 (252)
T ss_dssp             HHHHHHHHHHHGGG-CSEEEEECTTTTTTSSCCHHHHHHHHH-H--TCCE-EECCTTTTSCTTHHH-HHHH-SSEECCTT
T ss_pred             HHHHHHHHHHHHHH-CCEEEEECCCCCCCCCCCHHHHHHHHH-H--CCCE-EECCCHHHCCHHHHH-HHHC-CHHCCCCC
T ss_conf             99999876776751-889999513578886899999999998-1--9859-973844324557898-7620-11125011


Q ss_pred             CCCCCCCCCEEEEECCCEEEEEECC--CCCCCCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCC
Q ss_conf             4445556212799719879998328--88888755476008999999999985243369708999837688876431101
Q gi|255764495|r  130 TCSTGKKLFPYLRIRNNIALIGCST--AIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNR  207 (309)
Q Consensus       130 ~~~~~~~~~~~~~~~~~~~~i~l~s--~~~~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~  207 (309)
                      ......+........++..+..+|-  .....+.    . ++  +..+++.+++.  +....+|=+|--    +++    
T Consensus        88 ~~~~~PG~G~~i~~~~g~~i~Vinl~Gr~fM~~~----d-~P--F~~~d~~l~~~--~~~~iiVDfHaE----aTS----  150 (252)
T 2z06_A           88 YPPGTPGKGFWRLEVGGESLLFVQVMGRIFMDPL----D-DP--FRALDRLLEEE--KADYVLVEVHAE----ATS----  150 (252)
T ss_dssp             SCSSCSSCSEEEEEETTEEEEEEEEECCTTSCCC----C-CH--HHHHHHHHHHC--CCSEEEEEEECS----CHH----
T ss_pred             CCCCCCCCEEEEECCCCCEEEEEEEEHHHCCCCC----C-CH--HHHHHHHHHHC--CCCEEEEECCCC----HHH----
T ss_conf             1689998706997359947999980033459988----9-97--99999999746--896799986775----078----


Q ss_pred             CCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCCCCEEEEEEC
Q ss_conf             279789999998749819999876753247871699868999957
Q gi|255764495|r  208 MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIA  252 (309)
Q Consensus       208 ~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~~~~~~~~~~  252 (309)
                         -.........-.|.+++-=|+|.+....---++|......++
T Consensus       151 ---EK~A~g~~lDGrvsaVvGTHTHV~TaD~rILp~GTayiTDvG  192 (252)
T 2z06_A          151 ---EKMALAHYLDGRASAVLGTHTHVPTLDATRLPKGTLYQTDVG  192 (252)
T ss_dssp             ---HHHHHHHHHBTTBSEEEEESSCSCBSCCEECTTSCEEESCCC
T ss_pred             ---HHHHHHHHCCCCEEEEEECCCCCCCCCCEECCCCEEEEECCC
T ss_conf             ---999989760696899985676655664457479809981685


No 42 
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural genomics, berkeley structural genomics center, BSGC, PSI; 2.30A {Deinococcus radiodurans R1} SCOP: d.159.1.9
Probab=74.71  E-value=3.5  Score=18.62  Aligned_cols=163  Identities=10%  Similarity=-0.060  Sum_probs=78.0

Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             89999999999626997999937444489989999999999861899718999458842222035676643245431344
Q gi|255764495|r   50 KEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT  129 (309)
Q Consensus        50 ~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~  129 (309)
                      ...++..+..+++ +.|+||..|.-+-.|.--.-+.+.++++ .  .+.| +..|||=...+.........-.+......
T Consensus        15 r~~v~~~Lp~lk~-~~DfVIaNgENaa~G~Git~~~~~~L~~-~--GvDv-IT~GNH~wd~kei~~~i~~~~~~ilrp~N   89 (255)
T 1t70_A           15 RRVLQNHLPTIRP-QFDFVIVNMENSAGGFGMHRDAARGALE-A--GAGC-LTLGNHAWHHKDIYPMLSEDTYPIVRPLN   89 (255)
T ss_dssp             HHHHHHHHHHHGG-GCSEEEEECTBTTTTSSCCHHHHHHHHH-H--TCSE-EECCTTTTSSTTHHHHHHTTCSCEECCSC
T ss_pred             HHHHHHHHHHHHH-HCCEEEECCCCCCCCCCCCHHHHHHHHH-C--CCCE-EECCCCCCCCCCHHHHHCCCCCCCCHHHC
T ss_conf             9999987187785-0989999985478986899999999997-1--9979-94474103386003444124400024550


Q ss_pred             CCC-CCCCCCEEEEECCCEEEEEEC--CCCCCCCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCC
Q ss_conf             444-555621279971987999832--88888875547600899999999998524336970899983768887643110
Q gi|255764495|r  130 TCS-TGKKLFPYLRIRNNIALIGCS--TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYN  206 (309)
Q Consensus       130 ~~~-~~~~~~~~~~~~~~~~~i~l~--s~~~~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~  206 (309)
                      ... ...+.........+..+..+|  ...+..+.     -++  +..+++.|++.+  ....+|=+|--    +++   
T Consensus        90 ~p~~~~pG~G~~~~~~~g~ki~Vinl~Gr~fM~~~-----d~P--F~~~d~~l~~~~--~~~i~VDfHaE----aTS---  153 (255)
T 1t70_A           90 YADPGTPGVGWRTFDVNGEKLTVVNLLGRVFMEAV-----DNP--FRTMDALLERDD--LGTVFVDFHAE----ATS---  153 (255)
T ss_dssp             CCCTTCSSCSEEEEECSSSEEEEEEEECCTTSCCC-----SCH--HHHHHHHTTCSS--CCEEEEEEECS----CHH---
T ss_pred             CCCCCCCCCEEEEEECCCCEEEEEEECCCCCCCCC-----CCH--HHHHHHHHHHCC--CCEEEEECCCH----HHH---
T ss_conf             77888998639999626643999993252037867-----787--999999886446--88499983450----378---


Q ss_pred             CCCCHHHHHHHHHHCCCEEEEECCCCCCEEE
Q ss_conf             1279789999998749819999876753247
Q gi|255764495|r  207 RMFGIQRFQKMIWHEGADLILHGHTHLNSLH  237 (309)
Q Consensus       207 ~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~  237 (309)
                          -.........-.|.+++-=|+|.+..-
T Consensus       154 ----EK~A~g~~ldGrvsavvGTHTHV~TaD  180 (255)
T 1t70_A          154 ----EKEAMGWHLAGRVAAVIGTHTHVPTAD  180 (255)
T ss_dssp             ----HHHHHHHHHTTSSSEEEEESSCSCBSC
T ss_pred             ----HHHHHHHHHCCCEEEEEECCCCCCCCC
T ss_conf             ----999989871795899985675512555


No 43 
>2gzx_A Putative TATD related DNAse; deoxyribonuclease, NESG, ZR237, structural genomics, PSI, protein structure initiative; 2.20A {Staphylococcus aureus subsp}
Probab=60.76  E-value=6.6  Score=16.78  Aligned_cols=127  Identities=14%  Similarity=0.077  Sum_probs=71.9

Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             99999999626997999937444489989999999999861899718999458842222035676643245431344444
Q gi|255764495|r   53 ANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCS  132 (309)
Q Consensus        53 l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~  132 (309)
                      ++.+++.+.+.+.+.+++.|-     .++++..+.++.+...   .++.+.|=|-.................... .   
T Consensus        18 ~~~vi~~a~~~gv~~ii~~~~-----~~~~~~~~~~l~~~~~---~i~~~~G~HP~~~~~~~~~~~~~~~~~~~~-~---   85 (265)
T 2gzx_A           18 LSEVITRAREAGVDRMFVVGF-----NKSTIERAMKLIDEYD---FLYGIIGWHPVDAIDFTEEHLEWIESLAQH-P---   85 (265)
T ss_dssp             HHHHHHHHHHTTCCEEEEEEC-----SHHHHHHHHHHHHHCT---TEEEEECCCGGGGGGCCHHHHHHHHHHTTS-T---
T ss_pred             HHHHHHHHHHCCCCEEEEECC-----CHHHHHHHHHHHHHCC---CEEEECCCCCCCCCCCCHHHHHHHHHHHHC-C---
T ss_conf             999999999879988999258-----9999999999996588---678843888751445324457899999828-8---


Q ss_pred             CCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHH
Q ss_conf             55562127997198799983288888875547600899999999998524336970899983768887643110127978
Q gi|255764495|r  133 TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ  212 (309)
Q Consensus       133 ~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~  212 (309)
                             .+   -.+.-+|||......       -.+.|...++++|+-+.+-+.+  ++.|..            ...+
T Consensus        86 -------~~---~aiGEiGLD~~~~~~-------~~~~Q~~~f~~ql~lA~e~~lP--v~iH~r------------~a~~  134 (265)
T 2gzx_A           86 -------KV---IGIGEMGLDYHWDKS-------PADVQKEVFRKQIALAKRLKLP--IIIHNR------------EATQ  134 (265)
T ss_dssp             -------TE---EEEEEEEEECSCCSS-------CHHHHHHHHHHHHHHHHHHTCC--EEEEEE------------SCHH
T ss_pred             -------CC---EEEECCCCCCCCCCC-------HHHHHHHHHHHHHHHHHHHCCC--EEEEEC------------CCHH
T ss_conf             -------72---465135644332677-------4989999999999999986992--899975------------4307


Q ss_pred             HHHHHHHHCC
Q ss_conf             9999998749
Q gi|255764495|r  213 RFQKMIWHEG  222 (309)
Q Consensus       213 ~l~~~l~~~~  222 (309)
                      ++.+++.+++
T Consensus       135 ~~~~il~~~~  144 (265)
T 2gzx_A          135 DCIDILLEEH  144 (265)
T ss_dssp             HHHHHHHHTT
T ss_pred             HHHHHHHHHC
T ss_conf             7999999715


No 44 
>3hkx_A Amidase; alpha-beta-BETA-alpha:alpha-beta-BETA-alpha dimeric sandwich, hydrolase; 1.66A {Nesterenkonia SP}
Probab=60.27  E-value=4.9  Score=17.66  Aligned_cols=58  Identities=10%  Similarity=0.061  Sum_probs=32.5

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEECC---------CCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             089999999999626997999937---------4444899899999999998618997189994588
Q gi|255764495|r   49 SKEVANLLINDILLHNVDHVSITG---------DIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNH  106 (309)
Q Consensus        49 ~~~~l~~~~~~i~~~~pD~vvitG---------Dl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNH  106 (309)
                      ..+.++.+++.+.++++|+||+.=         |+...........+.+.+.++.....++++.|--
T Consensus        38 Nl~~i~~~i~~A~~~gadlvv~PE~~~~Gy~~~~~~~~~~~~~~~~~~~~l~~la~~~~i~iv~G~~  104 (283)
T 3hkx_A           38 NLDLIDDAAARASEQGAQLLLTPELFGFGYVPSQICAQVSAEQVDAARSRLRGIARDRGIALVWSLP  104 (283)
T ss_dssp             HHHHHHHHHHHHHHTTCSEEECCTTGGGCSCHHHHHHHCCHHHHHHHHHHHHHHHHHTTSEEEECCB
T ss_pred             HHHHHHHHHHHHHHCCCEEEECCCCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHCCCEEEECCE
T ss_conf             9999999999999888939995888645898578753121221489999999999975987994403


No 45 
>2fyw_A Conserved hypothetical protein; structural genomics, PSI, midwest center for structural genomics, MCSG; 2.40A {Streptococcus pneumoniae TIGR4} SCOP: c.135.1.1
Probab=59.21  E-value=7  Score=16.61  Aligned_cols=55  Identities=7%  Similarity=-0.003  Sum_probs=28.8

Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCH----HHH--HHHHHHHHHHCCCCCEEEEECCCCCCC
Q ss_conf             9999999962699799993744448998----999--999999986189971899945884222
Q gi|255764495|r   53 ANLLINDILLHNVDHVSITGDIVNFTCN----REI--FTSTHWLRSIGNPHDISIVPGNHDAYI  110 (309)
Q Consensus        53 l~~~~~~i~~~~pD~vvitGDl~~~~~~----~~~--~~~~~~~~~l~~~~~v~~v~GNHD~~~  110 (309)
                      -..+++.+.+.+.|+|+.==-++..+..    ..+  +....++   ...+.+|..--|-|...
T Consensus        48 t~~vi~~Ai~~~~dlIItHHP~~f~~~~~~~~~~~~~~~~~~l~---~~~I~vy~~Ht~lD~~~  108 (267)
T 2fyw_A           48 REETVAEAIEKGVDLIIVKHAPIFRPIKDLLASRPQNQIYIDLI---KHDIAVYVSHTNIDIVE  108 (267)
T ss_dssp             CHHHHHHHHHTTCSEEEESSCSCCSCCCCCCTTSHHHHHHHHHH---HTTCEEEECSHHHHHST
T ss_pred             CHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHH---HCCEEEEEEECCHHHCC
T ss_conf             99999999986999999768622368531137861778999998---68825898103532326


No 46 
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes}
Probab=58.44  E-value=7.3  Score=16.52  Aligned_cols=46  Identities=20%  Similarity=0.151  Sum_probs=27.0

Q ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             999999999962699799993744448998999999999986189971899945
Q gi|255764495|r   51 EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPG  104 (309)
Q Consensus        51 ~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~G  104 (309)
                      ..+..+-+.+.+.+||+|++.||-.     +.+..+.   .......|+..+-|
T Consensus       101 ~~i~~~~~~~~~~kPD~vlV~GDr~-----~~la~al---aa~~~~Ipi~Hieg  146 (403)
T 3ot5_A          101 RVMNGINEVIAAENPDIVLVHGDTT-----TSFAAGL---ATFYQQKMLGHVEA  146 (403)
T ss_dssp             HHHHHHHHHHHHHCCSEEEEETTCH-----HHHHHHH---HHHHTTCEEEEESC
T ss_pred             HHHHHHHHHHHHHCCCEEEEECCCC-----HHHHHHH---HHHHHCCCEEEEEC
T ss_conf             9999999999973999999968880-----4899999---99981997899964


No 47 
>2gx8_A NIF3-related protein; structural genomics, unknown function, protein structure initiative, midwest center for structural genomics; HET: EPE; 2.20A {Bacillus cereus atcc 14579} SCOP: c.135.1.1
Probab=54.36  E-value=8.4  Score=16.09  Aligned_cols=59  Identities=10%  Similarity=0.102  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCH----HHHHHHHHHHHHHCCCCCEEEEECCCCCC
Q ss_conf             8999999999962699799993744448998----99999999998618997189994588422
Q gi|255764495|r   50 KEVANLLINDILLHNVDHVSITGDIVNFTCN----REIFTSTHWLRSIGNPHDISIVPGNHDAY  109 (309)
Q Consensus        50 ~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~----~~~~~~~~~~~~l~~~~~v~~v~GNHD~~  109 (309)
                      .+.-+.+++.+.+.+.|+||.===++..+..    ..+. .+.+...+...+.+|..-=|=|..
T Consensus        71 lD~T~evi~eAi~~gadlIIsHHPl~F~p~k~l~~~~~~-~~~~~~lik~~I~vys~HTnlD~~  133 (397)
T 2gx8_A           71 LDVTEEVVDEAIQLGANVIIAHHPLIFNPLKAIHTDKAY-GKIIEKCIKNDIAIYAAHTNVDVA  133 (397)
T ss_dssp             SSCCHHHHHHHHHHTCCEEEESSCSCCSCCSCCCTTSHH-HHHHHHHHHTTCEEEECCHHHHHS
T ss_pred             ECCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHH-HHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             759999999999779989997898654787767779838-899999997897599842542336


No 48 
>2nyd_A UPF0135 protein SA1388; hypothetical protein SA1388, selenomethionine SAD, unknown function; 2.00A {Staphylococcus aureus subsp} PDB: 3lnl_A*
Probab=51.55  E-value=9.3  Score=15.80  Aligned_cols=60  Identities=7%  Similarity=-0.012  Sum_probs=30.4

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCCCCCCCH----HHHHHHHHHHHHHCCCCCEEEEECCCCCCC
Q ss_conf             08999999999962699799993744448998----999999999986189971899945884222
Q gi|255764495|r   49 SKEVANLLINDILLHNVDHVSITGDIVNFTCN----REIFTSTHWLRSIGNPHDISIVPGNHDAYI  110 (309)
Q Consensus        49 ~~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~----~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~  110 (309)
                      ..+.-+.+++.+.+.+.|+||.===++..+..    ..+.  +.+...+...+.+|..-=|=|...
T Consensus        46 alD~t~~vi~eAi~~~adlIitHHPlif~~~k~l~~~~~~--~~l~~li~~~I~vys~HTnlD~~~  109 (370)
T 2nyd_A           46 ALDCTLEVVNEAIEKGYNTIISHHPLIFKGVTSLKANGYG--LIIRKLIQHDINLIAMHTNLDVNP  109 (370)
T ss_dssp             ESSCCHHHHHHHHHHTCCEEEESSCSSCSCCSCCCSSTHH--HHHHHHHHTTCEEEECCHHHHTST
T ss_pred             EECCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCHH--HHHHHHHHCCCEEEEECCCCCCCC
T ss_conf             9679999999999779999997998665897566578589--999999977974998125511367


No 49 
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A*
Probab=49.72  E-value=10  Score=15.62  Aligned_cols=46  Identities=20%  Similarity=0.141  Sum_probs=28.0

Q ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             999999999962699799993744448998999999999986189971899945
Q gi|255764495|r   51 EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPG  104 (309)
Q Consensus        51 ~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~G  104 (309)
                      ..+..+-+.+.+.+||+|++.||-.     +.+..+   +......+|+..+-|
T Consensus        73 ~~i~~~~~~l~~~kpD~v~v~GDr~-----e~la~a---~aa~~~~Ipi~Hieg  118 (384)
T 1vgv_A           73 RILEGLKPILAEFKPDVVLVHGDTT-----TTLATS---LAAFYQRIPVGHVEA  118 (384)
T ss_dssp             HHHHHHHHHHHHHCCSEEEEETTCH-----HHHHHH---HHHHTTTCCEEEESC
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCC-----HHHHHH---HHHHHCCCCEEEEEC
T ss_conf             9999999999855999899968984-----376699---999975997899841


No 50 
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, infectious diseases, isomerase, center for structural genomics of infectious diseases; 2.35A {Vibrio cholerae}
Probab=47.10  E-value=11  Score=15.35  Aligned_cols=46  Identities=13%  Similarity=0.058  Sum_probs=27.6

Q ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             999999999962699799993744448998999999999986189971899945
Q gi|255764495|r   51 EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPG  104 (309)
Q Consensus        51 ~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~G  104 (309)
                      ..+..+-+.+.+.+||+|++-||-.     +.+..   .+.......|+..+-|
T Consensus        98 ~~i~~~~~~~~~~kpD~VlV~GDr~-----e~la~---a~aa~~~~ipi~Hieg  143 (396)
T 3dzc_A           98 KILLGMQQVLSSEQPDVVLVHGDTA-----TTFAA---SLAAYYQQIPVGHVEA  143 (396)
T ss_dssp             HHHHHHHHHHHHHCCSEEEEETTSH-----HHHHH---HHHHHTTTCCEEEETC
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCC-----CHHHH---HHHHHHHCCCEEEEEE
T ss_conf             9999999999971999999958886-----22548---9999982997899971


No 51 
>1xrs_B D-lysine 5,6-aminomutase beta subunit; TIM barrel, rossmann domain, PLP, cobalamin, 5'- deoxyadenosine, radical, adenosylcobalamin; HET: B12 PLP 5AD; 2.80A {Clostridium sticklandii} SCOP: c.23.6.1 d.230.4.1
Probab=46.54  E-value=11  Score=15.30  Aligned_cols=16  Identities=25%  Similarity=0.223  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHCCCEEE
Q ss_conf             7899999987498199
Q gi|255764495|r  211 IQRFQKMIWHEGADLI  226 (309)
Q Consensus       211 ~~~l~~~l~~~~v~lv  226 (309)
                      .+++.+...+.++|+|
T Consensus       169 ~ee~v~~a~e~~aD~V  184 (262)
T 1xrs_B          169 NEDFIKKAVELEADVL  184 (262)
T ss_dssp             HHHHHHHHHHTTCSEE
T ss_pred             HHHHHHHHHHCCCCEE
T ss_conf             9999999986499999


No 52 
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3
Probab=43.57  E-value=12  Score=15.00  Aligned_cols=47  Identities=13%  Similarity=0.169  Sum_probs=27.7

Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             8999999999962699799993744448998999999999986189971899945
Q gi|255764495|r   50 KEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPG  104 (309)
Q Consensus        50 ~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~G  104 (309)
                      ...+..+-+.+...+||+|++.||-.     +.+..  .+ .......|+..+-|
T Consensus        77 ~~~~~~~~~il~~~kpD~Vlv~GDr~-----~~la~--a~-aa~~~~ipi~Hieg  123 (376)
T 1v4v_A           77 ARILPQAARALKEMGADYVLVHGDTL-----TTFAV--AW-AAFLEGIPVGHVEA  123 (376)
T ss_dssp             HHHHHHHHHHHHHTTCSEEEEESSCH-----HHHHH--HH-HHHHTTCCEEEETC
T ss_pred             HHHHHHHHHHHHCCCCCEEEEECCCC-----HHHHH--HH-HHHHCCCCEEEEEC
T ss_conf             99999999997405999899968970-----79999--99-99862974798661


No 53 
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A
Probab=43.00  E-value=13  Score=14.95  Aligned_cols=46  Identities=17%  Similarity=0.037  Sum_probs=26.8

Q ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             999999999962699799993744448998999999999986189971899945
Q gi|255764495|r   51 EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPG  104 (309)
Q Consensus        51 ~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~G  104 (309)
                      ..+..+-+.+...+||+|++.||-.     +.+..+...   .....|+..+-|
T Consensus        82 ~~~~~~~~~~~~~kpD~vlv~GDr~-----e~la~a~aa---~~~~ipi~Hieg  127 (375)
T 3beo_A           82 RGLEGLDKVMKEAKPDIVLVHGDTT-----TTFIASLAA---FYNQIPVGHVEA  127 (375)
T ss_dssp             HHHHHHHHHHHHHCCSEEEEETTSH-----HHHHHHHHH---HHTTCCEEEESC
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCC-----HHHHHHHHH---HHCCCCEEEEEC
T ss_conf             9999999999747998899946872-----477799999---981983899624


No 54 
>2yyb_A Hypothetical protein TTHA1606; structural genomics, unknown function, NPPSFA; 2.60A {Thermus thermophilus HB8}
Probab=42.68  E-value=13  Score=14.92  Aligned_cols=60  Identities=10%  Similarity=-0.000  Sum_probs=28.4

Q ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHH-HCCCCCEEEEECCCCCC
Q ss_conf             8999999999962699799993744448998999999999986-18997189994588422
Q gi|255764495|r   50 KEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS-IGNPHDISIVPGNHDAY  109 (309)
Q Consensus        50 ~~~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~-l~~~~~v~~v~GNHD~~  109 (309)
                      .+.-..+++.+.+.+.|+|+.==-+...+.........+.+.. +...+.+|..-=|=|..
T Consensus        43 lD~t~~vi~~Ai~~g~dlIItHHP~~f~~~~~~~~~~~~~i~~li~~~I~vy~~Ht~lD~~  103 (242)
T 2yyb_A           43 VDAGEAIFRKALEEEVDFLIVHHGLFWGKPFPIVGHHKRRLETLFQGGINLYAAHLPLDAH  103 (242)
T ss_dssp             EECSHHHHHHHHHTTCSEEEEEECSCSSCCCCSCHHHHHHHHHHHHTTCEEEECSHHHHHC
T ss_pred             ECCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEECCCCHHHC
T ss_conf             7599999999998799999979850104765445607999999997896117713564332


No 55 
>1jlj_A Gephyrin; globular alpha/beta fold, structural protein; 1.60A {Homo sapiens} SCOP: c.57.1.1 PDB: 1ihc_A
Probab=41.79  E-value=13  Score=14.83  Aligned_cols=29  Identities=17%  Similarity=-0.028  Sum_probs=18.5

Q ss_pred             CCHHHHH-HHHHHHHHCCCCEEEECCCCCC
Q ss_conf             3089999-9999996269979999374444
Q gi|255764495|r   48 FSKEVAN-LLINDILLHNVDHVSITGDIVN   76 (309)
Q Consensus        48 ~~~~~l~-~~~~~i~~~~pD~vvitGDl~~   76 (309)
                      +..+.+. .+.+.+.+..+|+|+.||=+.-
T Consensus        61 Dd~~~I~~~l~~~~~~~~~DlViTTGGtg~   90 (189)
T 1jlj_A           61 DEIEEIKETLIDWCDEKELNLILTTGGTGF   90 (189)
T ss_dssp             SCHHHHHHHHHHHHHTSCCSEEEEESCCSS
T ss_pred             CCHHHHHHHHHHHHHCCCCCEEEECCCCCC
T ss_conf             978999999999875237768997675566


No 56 
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4
Probab=41.49  E-value=13  Score=14.80  Aligned_cols=50  Identities=18%  Similarity=0.094  Sum_probs=28.6

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             9999999999852433697089998376888764311012797899999987498199998767
Q gi|255764495|r  169 QEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH  232 (309)
Q Consensus       169 ~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H  232 (309)
                      .....++.+..+.........++....+              .+.+.+...+.++++++-|..+
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------~~~i~~~~~~~~~dliVvG~~~  112 (141)
T 1jmv_A           63 TETQKALLDLAESVDYPISEKLSGSGDL--------------GQVLSDAIEQYDVDLLVTGHHQ  112 (141)
T ss_dssp             CHHHHHHHHHHHHSSSCCCCEEEEEECH--------------HHHHHHHHHHTTCCEEEEEECC
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEEECCH--------------HHHHHHHHHHCCCCEEEEECCC
T ss_conf             9999999999987177628999960674--------------7889999872788889993289


No 57 
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix K1}
Probab=35.17  E-value=17  Score=14.16  Aligned_cols=50  Identities=12%  Similarity=0.094  Sum_probs=32.0

Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCC-CCEEEEECC
Q ss_conf             99999999626997999937444489989999999999861899-718999458
Q gi|255764495|r   53 ANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNP-HDISIVPGN  105 (309)
Q Consensus        53 l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~-~~v~~v~GN  105 (309)
                      .+.+++.+.+++||+|.++.=++  ..........+.+++.... .+| ++=|+
T Consensus        58 ~e~~v~~a~~~~~d~v~lS~~~~--~~~~~~~~~i~~L~~~g~~~i~i-~vGG~  108 (161)
T 2yxb_A           58 PEQVAMAAVQEDVDVIGVSILNG--AHLHLMKRLMAKLRELGADDIPV-VLGGT  108 (161)
T ss_dssp             HHHHHHHHHHTTCSEEEEEESSS--CHHHHHHHHHHHHHHTTCTTSCE-EEEEC
T ss_pred             HHHHHHHHHHCCCCEEEEECCCC--CCHHHHHHHHHHHHHCCCCCCEE-EEECC
T ss_conf             99999999866998999855766--44899999999999759999879-99668


No 58 
>2vgn_A DOM34; translation termination factor, protein biosynthesis, translation regulation, cell division, mRNA degradation; 2.5A {Saccharomyces cerevisiae} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 PDB: 2vgm_A
Probab=32.92  E-value=18  Score=13.92  Aligned_cols=19  Identities=11%  Similarity=0.239  Sum_probs=8.1

Q ss_pred             HHHHHHHCCCEEEEECCCC
Q ss_conf             9999987498199998767
Q gi|255764495|r  214 FQKMIWHEGADLILHGHTH  232 (309)
Q Consensus       214 l~~~l~~~~v~lvl~GH~H  232 (309)
                      +.+...+.+..+++.-..|
T Consensus       338 l~e~~~~~g~~V~iis~~~  356 (386)
T 2vgn_A          338 LMDSVESNGGKALVLSTLH  356 (386)
T ss_dssp             HHHHHHHTTCEEEEECTTS
T ss_pred             HHHHHHHCCCEEEEECCCC
T ss_conf             9999996599999988999


No 59 
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima}
Probab=32.61  E-value=18  Score=13.89  Aligned_cols=51  Identities=10%  Similarity=0.059  Sum_probs=32.2

Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             99999999626997999937444489989999999999861899718999458842
Q gi|255764495|r   53 ANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDA  108 (309)
Q Consensus        53 l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~  108 (309)
                      -+..++.+.+..||+|++  |+ . ....-++.+.++ ++.....||.++.|+-|.
T Consensus        37 g~eal~~l~~~~~dlvll--D~-m-p~~dGl~l~~~i-r~~~~~~piI~lT~~~~~   87 (142)
T 2qxy_A           37 EQEAFTFLRREKIDLVFV--DV-F-EGEESLNLIRRI-REEFPDTKVAVLSAYVDK   87 (142)
T ss_dssp             HHHHHHHHTTSCCSEEEE--EC-T-TTHHHHHHHHHH-HHHCTTCEEEEEESCCCH
T ss_pred             HHHHHHHHHHCCCCEEEE--CC-C-CCHHHHHHHHHH-HHHCCCCCEEEEECCCCH
T ss_conf             999999998579999985--47-8-631289999999-986899978999735888


No 60 
>3agj_B Protein pelota homolog; GTP binding, translation-hydrolase complex; HET: GTP; 2.30A {Aeropyrum pernix}
Probab=32.26  E-value=18  Score=13.85  Aligned_cols=20  Identities=10%  Similarity=0.146  Sum_probs=10.0

Q ss_pred             HHHHHHHHCCCEEEEECCCC
Q ss_conf             99999987498199998767
Q gi|255764495|r  213 RFQKMIWHEGADLILHGHTH  232 (309)
Q Consensus       213 ~l~~~l~~~~v~lvl~GH~H  232 (309)
                      .+.+...+.|..+++.-..|
T Consensus       312 ~l~~~a~~~g~~V~ivss~~  331 (358)
T 3agj_B          312 EALRLVESMGGRVIIIPGDS  331 (358)
T ss_dssp             HHHHHHHHTTCEEEEECSSS
T ss_pred             HHHHHHHHCCCEEEEECCCC
T ss_conf             99999986699999998999


No 61 
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633}
Probab=32.13  E-value=19  Score=13.84  Aligned_cols=51  Identities=12%  Similarity=0.077  Sum_probs=31.2

Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             9999999626997999937444489989999999999861899718999458842
Q gi|255764495|r   54 NLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDA  108 (309)
Q Consensus        54 ~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~  108 (309)
                      +..++.+.+..||+|++  |+.--+. .-++. .+.+++.....|+.++.|+.+.
T Consensus        38 ~eal~~l~~~~pdlill--D~~mp~~-~G~~l-~~~ir~~~~~~piI~lt~~~~~   88 (137)
T 3cfy_A           38 RDAIQFIERSKPQLIIL--DLKLPDM-SGEDV-LDWINQNDIPTSVIIATAHGSV   88 (137)
T ss_dssp             HHHHHHHHHHCCSEEEE--CSBCSSS-BHHHH-HHHHHHTTCCCEEEEEESSCCH
T ss_pred             HHHHHHHHHCCCCEEEE--ECCCCCC-CHHHH-HHHHHHHCCCCCEEEEECCCCH
T ss_conf             99999998479999998--3899999-88999-9999974899848999877999


No 62 
>2g4r_A MOGA, molybdopterin biosynthesis MOG protein; anomalous substructure of MOGA, biosynthetic protein; 1.92A {Mycobacterium tuberculosis} PDB: 3oi9_A
Probab=31.97  E-value=19  Score=13.82  Aligned_cols=28  Identities=18%  Similarity=0.139  Sum_probs=17.5

Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEECCCCCC
Q ss_conf             30899999999996269979999374444
Q gi|255764495|r   48 FSKEVANLLINDILLHNVDHVSITGDIVN   76 (309)
Q Consensus        48 ~~~~~l~~~~~~i~~~~pD~vvitGDl~~   76 (309)
                      +..+.++++++.+. ++.|+|+.||=+.-
T Consensus        47 D~~~~~~~~~~~~~-~~~DlVittGG~g~   74 (160)
T 2g4r_A           47 DGNPVGEALHDAVN-AGVDVIITSGGTGI   74 (160)
T ss_dssp             SSHHHHHHHHHHHH-TTCSEEEEESCCSS
T ss_pred             CHHHHHHHHHHHHH-CCCCEEEECCCEEE
T ss_conf             57999999999986-69999997475350


No 63 
>1j6o_A TATD-related deoxyribonuclease; structural genomics, TM0667, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.80A {Thermotoga maritima} SCOP: c.1.9.12
Probab=31.03  E-value=19  Score=13.72  Aligned_cols=137  Identities=14%  Similarity=0.133  Sum_probs=75.2

Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             99999999962699799993744448998999999999986189971899945884222203567664324543134444
Q gi|255764495|r   52 VANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC  131 (309)
Q Consensus        52 ~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~  131 (309)
                      -++.+++.+.+.+...++..|-     .++++..+.++.+.   ...+++..|=|=.+..............+.....  
T Consensus        28 d~~~vl~~a~~~gv~~ii~~~~-----~~~~~~~~~~l~~~---~~~v~~a~GiHP~~~~~~~~~~~~~l~~~~~~~~--   97 (268)
T 1j6o_A           28 DRNAVISSFEENNIEFVVNVGV-----NLEDSKKSLDLSKT---SDRIFCSVGVHPHDAKEVPEDFIEHLEKFAKDEK--   97 (268)
T ss_dssp             THHHHHHTTTTTTEEEEEEECS-----SHHHHHHHHHHHTT---CTTEEEEECCCGGGGGGCCTTHHHHHHHHTTSTT--
T ss_pred             CHHHHHHHHHHCCCCEEEEECC-----CHHHHHHHHHHHHC---CCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHCC--
T ss_conf             9999999999889988999059-----99999999999845---8966887468988636576778999999873087--


Q ss_pred             CCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCH
Q ss_conf             45556212799719879998328888887554760089999999999852433697089998376888764311012797
Q gi|255764495|r  132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI  211 (309)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~~~~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~  211 (309)
                               +   -.+.-+|||......+       .+.|.+.++++|+-+.+-+.+  ++.|..            ...
T Consensus        98 ---------~---vaIGEiGLD~~~~~~~-------~~~Q~~~F~~ql~lA~~~~~P--v~iH~r------------~a~  144 (268)
T 1j6o_A           98 ---------V---VAIGETGLDFFRNISP-------AEVQKRVFVEQIELAGKLNLP--LVVHIR------------DAY  144 (268)
T ss_dssp             ---------E---EEEEEEEEETTTCSSC-------HHHHHHHHHHHHHHHHHHTCC--EEEEEE------------SCH
T ss_pred             ---------E---EEEECCCCCCCCCCCH-------HHHHHHHHHHHHHHHHHCCCC--EEEEEC------------CHH
T ss_conf             ---------8---9983466664545237-------899999999999999861998--799710------------068


Q ss_pred             HHHHHHHHHCC---CEEEEECCC
Q ss_conf             89999998749---819999876
Q gi|255764495|r  212 QRFQKMIWHEG---ADLILHGHT  231 (309)
Q Consensus       212 ~~l~~~l~~~~---v~lvl~GH~  231 (309)
                      +++.+++.+++   ...++|+-.
T Consensus       145 ~~~~~il~~~~~~~~~~i~H~fs  167 (268)
T 1j6o_A          145 SEAYEILRTESLPEKRGVIHAFS  167 (268)
T ss_dssp             HHHHHHHHHSCCCSSCEEETTCC
T ss_pred             HHHHHHHHHHCCCCCCEEEEECC
T ss_conf             99999999825876675898548


No 64 
>3bul_A Methionine synthase; transferase, reactivation conformation, cobalamin, intermodular interactions, amino-acid biosynthesis, cobalt; HET: B12; 2.30A {Escherichia coli} SCOP: a.46.1.1 c.23.6.1 d.173.1.1 PDB: 3iv9_A* 3iva_A* 1k7y_A* 1k98_A* 1bmt_A*
Probab=30.91  E-value=19  Score=13.71  Aligned_cols=51  Identities=16%  Similarity=0.223  Sum_probs=38.0

Q ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             999999996269979999374444899899999999998618997189994588
Q gi|255764495|r   53 ANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNH  106 (309)
Q Consensus        53 l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNH  106 (309)
                      .+.+++.+.+.+||+|-++|=||.  +..+.....+.+++.+..+|| +|=|..
T Consensus       138 ~~~~v~~~~~~~~d~iglS~llt~--s~~~m~~~~~~l~~~g~~~~v-~vGGa~  188 (579)
T 3bul_A          138 AEKILRTAKEVNADLIGLSGLITP--SLDEMVNVAKEMERQGFTIPL-LIGGAT  188 (579)
T ss_dssp             HHHHHHHHHHHTCSEEEEECCSTH--HHHHHHHHHHHHHHTTCCSCE-EEESTT
T ss_pred             HHHHHHHHHHHCCCEEEEECCCHH--HHHHHHHHHHHHHHHCCCCCE-EECCCC
T ss_conf             999999999849978999533477--799999999999972898717-832640


No 65 
>3hno_A Pyrophosphate-dependent phosphofructokinase; structural genomics, PSI-2, protein structure initiative; 2.00A {Nitrosospira multiformis atcc 25196} PDB: 3k2q_A
Probab=30.77  E-value=20  Score=13.69  Aligned_cols=56  Identities=16%  Similarity=0.179  Sum_probs=36.9

Q ss_pred             CHHHHHHHHHHHHHCCCCEE-EECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             08999999999962699799-9937444489989999999999861899718999458842
Q gi|255764495|r   49 SKEVANLLINDILLHNVDHV-SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDA  108 (309)
Q Consensus        49 ~~~~l~~~~~~i~~~~pD~v-vitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD~  108 (309)
                      ..+.++.+++.+++.+.|.+ +|.||=+.    .....+.+.......+++|..||.-=|-
T Consensus        89 ~~~~~~~i~~~l~~~~Id~Li~IGGdgS~----~~a~~L~~~~~~~~~~i~vIgIPKTIDN  145 (419)
T 3hno_A           89 NRREYERLIEVFKAHDIGYFFYNGGGDSA----DTCLKVSQLSGTLGYPIQAIHVPKTVDN  145 (419)
T ss_dssp             CHHHHHHHHHHHHHTTEEEEEEEESHHHH----HHHHHHHHHHHHTTCCCEEEEEECCTTC
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCHHH----HHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             25799999999997099879997580789----9999999999970899418961243257


No 66 
>1nmo_A Hypothetical protein YBGI; toroidal structure, structure 2 function project, S2F, structural genomics, unknown functio; 2.20A {Escherichia coli} SCOP: c.135.1.1 PDB: 1nmp_A
Probab=29.55  E-value=20  Score=13.56  Aligned_cols=54  Identities=11%  Similarity=-0.034  Sum_probs=26.5

Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCC-----HHHHHHHHHHHHHHCCCCCEEEEECCCCC
Q ss_conf             9999999996269979999374444899-----89999999999861899718999458842
Q gi|255764495|r   52 VANLLINDILLHNVDHVSITGDIVNFTC-----NREIFTSTHWLRSIGNPHDISIVPGNHDA  108 (309)
Q Consensus        52 ~l~~~~~~i~~~~pD~vvitGDl~~~~~-----~~~~~~~~~~~~~l~~~~~v~~v~GNHD~  108 (309)
                      .-..+++.+.+.+.|+|+.==-++..+.     .........   .+.....+|..--|-|.
T Consensus        44 ~t~~vi~~Ai~~g~dlIItHHP~~f~~~~~~~~~~~~~~i~~---l~k~~i~vy~~Ht~~D~  102 (247)
T 1nmo_A           44 ASQALLDEAVRLGADAVIVHHGYFWKGESPVIRGMKRNRLKT---LLANDINLYGWHLPLDA  102 (247)
T ss_dssp             CCHHHHHHHHHTTCSEEEEEECSCCTTSCCCCCTHHHHHHHH---HHHTTCEEEECCHHHHH
T ss_pred             CCHHHHHHHHHCCCCEEEECCCHHCCCCCCCCCCCCHHHHHH---HHHCCCCEEEECCCHHH
T ss_conf             999999999977999999898221278765656860899999---99789727983476444


No 67 
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM- barrel, rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A*
Probab=28.44  E-value=21  Score=13.44  Aligned_cols=51  Identities=14%  Similarity=0.059  Sum_probs=31.3

Q ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCC-CCCEEEEECC
Q ss_conf             99999999962699799993744448998999999999986189-9718999458
Q gi|255764495|r   52 VANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGN-PHDISIVPGN  105 (309)
Q Consensus        52 ~l~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~-~~~v~~v~GN  105 (309)
                      -.+.+++.+.+.+||+|.++.=+..  .........+.+++... ..++ ++=|+
T Consensus        42 p~e~iv~~~~~~~~d~V~iS~~~~~--~~~~~~~~i~~L~~~~~~~v~i-ivGG~   93 (137)
T 1ccw_A           42 PQELFIKAAIETKADAILVSSLYGQ--GEIDCKGLRQKCDEAGLEGILL-YVGGN   93 (137)
T ss_dssp             CHHHHHHHHHHHTCSEEEEEECSST--HHHHHTTHHHHHHHTTCTTCEE-EEEES
T ss_pred             CHHHHHHHHHHHCCCEEEEEECCCC--CHHHHHHHHHHHHHCCCCCCEE-EEECC
T ss_conf             9999999999839987887611344--5577999999999749999979-99788


No 68 
>2f48_A Diphosphate--fructose-6-phosphate 1- phosphotransferase; HET: FBP; 2.11A {Borrelia burgdorferi B31} SCOP: c.89.1.1 PDB: 1kzh_A*
Probab=26.08  E-value=23  Score=13.17  Aligned_cols=60  Identities=22%  Similarity=0.209  Sum_probs=38.3

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEEC-CCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             0123308999999999962699799993-744448998999999999986189971899945884
Q gi|255764495|r   44 RKKYFSKEVANLLINDILLHNVDHVSIT-GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD  107 (309)
Q Consensus        44 ~~~~~~~~~l~~~~~~i~~~~pD~vvit-GDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD  107 (309)
                      +......+-++.+++.+++.+.|.+|+- ||=+.    .....+.+.+.....+.+|..||.-=|
T Consensus       146 r~~~~~~e~~~~~~~~l~~~~Id~LviIGGddS~----~~A~~Lae~~~~~~~~i~VIgVPKTID  206 (555)
T 2f48_A          146 RTKIETEEHYNKALFVAKENNLNAIIIIGGDDSN----TNAAILAEYFKKNGENIQVIGVPKTID  206 (555)
T ss_dssp             CCCCCSHHHHHHHHHHHHHTTCSEEEEEESHHHH----HHHHHHHHHHHHTTCCCEEEEEEEETT
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHH----HHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             9997777899999999986389889997876899----999999999986167960898413536


No 69 
>3mca_B Protein DOM34, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe}
Probab=25.69  E-value=24  Score=13.12  Aligned_cols=21  Identities=5%  Similarity=0.025  Sum_probs=10.4

Q ss_pred             HHHHHHHHCCCEEEEECCCCC
Q ss_conf             999999874981999987675
Q gi|255764495|r  213 RFQKMIWHEGADLILHGHTHL  233 (309)
Q Consensus       213 ~l~~~l~~~~v~lvl~GH~H~  233 (309)
                      .+.+...+.+..+++.-..|.
T Consensus       331 ~l~e~~~~~g~~V~iis~~~~  351 (390)
T 3mca_B          331 SLVEGVKEINCPVYIFSSLHE  351 (390)
T ss_dssp             HHHHHHHHTTCCEEEECTTSH
T ss_pred             HHHHHHHHCCCEEEEECCCCH
T ss_conf             999999864989999899982


No 70 
>1x52_A Pelota homolog, CGI-17; ERF1_3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.79.3.2
Probab=24.79  E-value=25  Score=13.01  Aligned_cols=56  Identities=11%  Similarity=0.055  Sum_probs=33.8

Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHC-CCCCEEEEECCCCCC
Q ss_conf             99999996269979999374444899899999999998618-997189994588422
Q gi|255764495|r   54 NLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIG-NPHDISIVPGNHDAY  109 (309)
Q Consensus        54 ~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~-~~~~v~~v~GNHD~~  109 (309)
                      +.+.+++..-.++.++++=++........-....++++... ....|++++.+|+..
T Consensus        44 ~ev~~Ale~GAVe~LLisd~l~r~~d~~~r~~i~~l~e~~~~~g~~V~iiS~~~e~G  100 (124)
T 1x52_A           44 KQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSG  100 (124)
T ss_dssp             HHHHHHHHTTCEEEEEEEHHHHTCSSHHHHHHHHHHHHHHHHTTCEEEEECSSSHHH
T ss_pred             HHHHHHHHCCCCCEEEEECHHHHCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCCHH
T ss_conf             999999983974268760335424215368899999999986398899988999327


No 71 
>1nln_A Adenain; thiol hydrolase, viral proteinase, peptide cofactor; 1.60A {Human adenovirus 2} SCOP: d.3.1.7 PDB: 1avp_A
Probab=22.78  E-value=26  Score=12.87  Aligned_cols=25  Identities=32%  Similarity=0.513  Sum_probs=16.2

Q ss_pred             EECCCCCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             411142788541000222100012100
Q gi|255764495|r   15 ISDIHLSYSPSFFELSPKRIIGLVNWH   41 (309)
Q Consensus        15 lSDlHlg~~~~~~~~~~~~~~~~~~~~   41 (309)
                      ++|||++  +.+-..+.||+.|+++..
T Consensus        12 v~~Lg~~--~~FLGtFDkrFPGFl~~~   36 (204)
T 1nln_A           12 VKDLGCG--PYFLGTYDKRFPGFVSPH   36 (204)
T ss_dssp             HHHTTCG--GGEEEEECTTCCCCCCTT
T ss_pred             HHHCCCC--CCCCCCCCCCCCCCCCCC
T ss_conf             9974998--764421357787755777


No 72 
>1gc5_A ADP-dependent glucokinase; ALFA/beta sandwichs, induced-fitting, transferase; HET: ADP; 2.30A {Thermococcus litoralis} SCOP: c.72.1.3
Probab=22.74  E-value=27  Score=12.76  Aligned_cols=57  Identities=11%  Similarity=-0.018  Sum_probs=29.5

Q ss_pred             HHHHHHHHHHHHHC--CCCEEEECCC--CC----CCCCHHH-HHHHHHHHHHHC-CCCCEEEEECCC
Q ss_conf             89999999999626--9979999374--44----4899899-999999998618-997189994588
Q gi|255764495|r   50 KEVANLLINDILLH--NVDHVSITGD--IV----NFTCNRE-IFTSTHWLRSIG-NPHDISIVPGNH  106 (309)
Q Consensus        50 ~~~l~~~~~~i~~~--~pD~vvitGD--l~----~~~~~~~-~~~~~~~~~~l~-~~~~v~~v~GNH  106 (309)
                      ...++.+.+.+.+.  +||++|++|=  |-    +.+...+ ++.+.+.+..+. ...|+++=.|..
T Consensus       217 l~~~e~f~~~l~e~~~~~dl~vlSGlqml~~~~~d~~~~~~~l~~~~~~l~~l~~~~i~iH~ElAs~  283 (467)
T 1gc5_A          217 VYMRREFREGFEEITRNVELAIISGLQVLKEYYPDGTTYKDVLDRVESHLNILNRYNVKSHFEFAYT  283 (467)
T ss_dssp             TCCCHHHHHSHHHHHTTCSEEEECCGGGCCSBCTTSCBHHHHHHHHHHHHHHHHHTTCEEEEECCCC
T ss_pred             CCCCHHHHHHHHHHCCCCCEEEEECHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCC
T ss_conf             7336999999987345877899864010445588766799999999999973474688479985343


No 73 
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV}
Probab=22.36  E-value=28  Score=12.71  Aligned_cols=54  Identities=6%  Similarity=-0.017  Sum_probs=26.3

Q ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCC
Q ss_conf             999999962699799993744448998999999999986189971899945884
Q gi|255764495|r   54 NLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD  107 (309)
Q Consensus        54 ~~~~~~i~~~~pD~vvitGDl~~~~~~~~~~~~~~~~~~l~~~~~v~~v~GNHD  107 (309)
                      +.+++.+.+..+|+|++--.+-+..-.+-.+..++.-..-....|+.++.++-+
T Consensus        48 ~~al~~l~~~~~dlii~D~~mp~~~G~el~~~ir~~~~~~~~~~pii~lt~~~~  101 (143)
T 3m6m_D           48 EQVLDAMAEEDYDAVIVDLHMPGMNGLDMLKQLRVMQASGMRYTPVVVLSADVT  101 (143)
T ss_dssp             HHHHHHHHHSCCSEEEEESCCSSSCHHHHHHHHHHHHHTTCCCCCEEEEESCCC
T ss_pred             HHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCEEEEEECCCC
T ss_conf             999999752899999983888999889999999862843358993999978899


Done!