HHSEARCH alignment of GI: 255764495 and SCOP domain: d1auia_

Alignment
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]}
Probab=94.67  E-value=0.055  Score=28.91  Aligned_cols=79  Identities=13%  Similarity=0.195  Sum_probs=44.4

Q ss_pred             CCCHHHHHHHHHHCCCEEEEECCCCCCEEEEEECCC---CCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCEEEEEEE
Q ss_conf             279789999998749819999876753247871699---86899995762357788887785489999538983899999
Q gi|255764495|r  208 MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK---KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGK  284 (309)
Q Consensus       208 ~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~~~~~~~---~~~~~~~~~s~~~~~~~~~~~~~y~li~i~~~~~~~~v~~~  284 (309)
                      +.+..++.+.|++.+..+++-||.=...-.......   +.-.++.+-|++..-...  ++.=.++.++.+    .+.+.
T Consensus       246 ~FG~~a~~~FL~~n~L~~IIR~HE~~~~Gy~~~~~~~~~~~~~viTVFSApnYc~~~--nN~aavl~~~~~----~~~i~  319 (473)
T d1auia_         246 FYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVY--NNKAAVLKYENN----VMNIR  319 (473)
T ss_dssp             EECHHHHHHHHHHTTCSEEEECCSCCTTSEEECCBCTTTSSBSEEEECCCSSGGGTS--CCCEEEEEEETT----EEEEE
T ss_pred             EECHHHHHHHHHHCCCCEEEECCCCHHHHHHHHCCCCCCCCCCEEEECCCCCCCCCC--CCEEEEEEECCC----CCCEE
T ss_conf             989389999999759968998682445253342388667888789973798767776--873687751488----74347


Q ss_pred             EEECCCCC
Q ss_conf             95137761
Q gi|255764495|r  285 RYTLSPDS  292 (309)
Q Consensus       285 r~~~~~d~  292 (309)
                      .+...|..
T Consensus       320 qf~~~~hp  327 (473)
T d1auia_         320 QFNCSPHP  327 (473)
T ss_dssp             EECCCCCC
T ss_pred             EECCCCCC
T ss_conf             84379995


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Protein phosphatase-2B (PP-2B, calcineurin A subunit)
species: Human (Homo sapiens) [TaxId: 9606]