HHSEARCH alignment of GI: 255764495 and SCOP domain: d1xm7a_

Alignment
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]}
Probab=99.30  E-value=3.2e-11  Score=89.67  Aligned_cols=148  Identities=21%  Similarity=0.258  Sum_probs=84.5

Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHH--CCCCEEEECCCCCCCCCHHHHHHHHHH
Q ss_conf             899411142788541000222100012100000123308999999999962--699799993744448998999999999
Q gi|255764495|r   12 LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVSITGDIVNFTCNREIFTSTHW   89 (309)
Q Consensus        12 i~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~i~~--~~pD~vvitGDl~~~~~~~~~~~~~~~   89 (309)
                      |-.+||+|||...-..               .|......+.-+.+++..++  ...|.|++.||++......  +.+.++
T Consensus         4 i~fiSD~Hfgh~~i~~---------------~r~f~~~~~~~~~ii~~wn~~V~~~D~v~~LGD~~~~~~~~--~~~~~~   66 (188)
T d1xm7a_           4 MYFISDTHFYHENIIN---------------LNPEVRFKGFEIVILTNLLKVLKPEDTLYHLGDFTWHFNDK--NEYLRI   66 (188)
T ss_dssp             EEEEBCCCBTCTTHHH---------------HSTTTCCTTHHHHHHHHHHTTCCTTCEEEECSCCBSCSCCT--TSHHHH
T ss_pred             EEEEECCCCCCCCHHH---------------CCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCH--HHHHHH
T ss_conf             8999476789810444---------------18989999999999999996268898899948841357878--999999


Q ss_pred             HHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCCCCCCCEECH
Q ss_conf             98618997189994588422220356766432454313444445556212799719879998328888887554760089
Q gi|255764495|r   90 LRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQ  169 (309)
Q Consensus        90 ~~~l~~~~~v~~v~GNHD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~~~~~g~~~~  169 (309)
                      +++|.  .+.+.|.||||......        ...+.             .  ......++                   
T Consensus        67 l~~L~--g~~~lI~GNHD~~~~~~--------~~~~~-------------~--~~~~~~~~-------------------  102 (188)
T d1xm7a_          67 WKALP--GRKILVMGNHDKDKESL--------KEYFD-------------E--IYDFYKII-------------------  102 (188)
T ss_dssp             HHHSS--SEEEEECCTTCCCHHHH--------TTTCS-------------E--EESSEEEE-------------------
T ss_pred             HHHCC--CCEEEEECCCCCHHHHH--------HHCHH-------------H--HHHHHHHH-------------------
T ss_conf             99779--96599845777505555--------30106-------------6--77788985-------------------


Q ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCEE
Q ss_conf             9999999998524336970899983768887643110127978999999874981999987675324
Q gi|255764495|r  170 EQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL  236 (309)
Q Consensus       170 ~q~~~l~~~L~~~~~~~~~~iv~~Hhpp~~~~~~~~~~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~  236 (309)
                                    ..+...++++|+|+.........  ...+.+.++..+.+.++.|+||+|.+..
T Consensus       103 --------------~~~g~~i~l~H~P~~~~~~~~~~--~~~~~~~~~~~~~~~~~~lhGH~H~~~~  153 (188)
T d1xm7a_         103 --------------EHKGKRILLSHYPAKDPITERYP--DRQEMVREIYFKENCDLLIHGHVHWNRE  153 (188)
T ss_dssp             --------------EETTEEEEEESSCSSCSSCCSCH--HHHHHHHHHHHHTTCSEEEECCCCCCSC
T ss_pred             --------------HHCCEEEEEEECCCCCCCCCCCC--CCHHHHHHHHHHCCCEEEEEEECCCCCC
T ss_conf             --------------40881799996787555554545--4134788888743954999941258765


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Hypothetical protein aq 1666
domain: Hypothetical protein aq 1666
species: Aquifex aeolicus [TaxId: 63363]