HHSEARCH alignment of GI: 255764495 and SCOP domain: d2qfra2

Alignment
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
Probab=99.91  E-value=3.7e-22  Score=161.61  Aligned_cols=194  Identities=18%  Similarity=0.154  Sum_probs=125.6

Q ss_pred             EEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHHHHH-HHHHCCCCEEEECCCCCC-----CCCHHH
Q ss_conf             27889941114278854100022210001210000012330899999999-996269979999374444-----899899
Q gi|255764495|r    9 MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLIN-DILLHNVDHVSITGDIVN-----FTCNRE   82 (309)
Q Consensus         9 m~ri~hlSDlHlg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~-~i~~~~pD~vvitGDl~~-----~~~~~~   82 (309)
                      -+||+.++|++...                            ...+.+.+ .+...+||+|+++||++.     ......
T Consensus         7 p~~F~v~GD~g~~~----------------------------~~~~~~~~~~~~~~~pdfvl~~GDl~Y~~~~~~~~~~~   58 (312)
T d2qfra2           7 PYTFGLIGDLGQSF----------------------------DSNTTLSHYELSPKKGQTVLFVGDLSYADRYPNHDNVR   58 (312)
T ss_dssp             CEEEEEECSCCSBH----------------------------HHHHHHHHHHHCSSCCSEEEECSCCCCGGGSGGGCTHH
T ss_pred             CEEEEEEEECCCCC----------------------------CHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCHHH
T ss_conf             88999996389998----------------------------54999999997089988999898887678886531589


Q ss_pred             HHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHH--HHHHHHHHHHCCCCCCCCCCCCCEEEEECCCEEEEEECCCCCCCC
Q ss_conf             999999998618997189994588422220356--766432454313444445556212799719879998328888887
Q gi|255764495|r   83 IFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE--KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPP  160 (309)
Q Consensus        83 ~~~~~~~~~~l~~~~~v~~v~GNHD~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~s~~~~~~  160 (309)
                      ++...+.++.+....|+++++||||........  .....+...+..............|....+++++++||+..... 
T Consensus        59 wd~~~~~~~~~~~~~P~~~~~GNHD~~~~~~~~~~~~~~~~~~~f~~P~~~~~~~~~~~Ysf~~g~v~fi~Lds~~~~~-  137 (312)
T d2qfra2          59 WDTWGRFTERSVAYQPWIWTAGNHEIEFAPEINETEPFKPFSYRYHVPYEASQSTSPFWYSIKRASAHIIVLSSYSAYG-  137 (312)
T ss_dssp             HHHHHHHHHHHHTTSCEEECCCGGGTCCBGGGTBCSTTHHHHHHCCCCGGGGTCSSTTSEEEEETTEEEEECCTTSCCS-
T ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCEEEEEECCEEEEEEECCCCCC-
T ss_conf             9999999888764464898325100255654566645542132136875456788885489998888899764355654-


Q ss_pred             CCCCCEECHHHHHHHHHHHHHCCCCC-CEEEEEEECCCCCCCCCCCC-CCCCHHHHHHHHHHCCCEEEEECCCCCCEEE
Q ss_conf             55476008999999999985243369-70899983768887643110-1279789999998749819999876753247
Q gi|255764495|r  161 FSANGYFGQEQAHATSKLLRKANKKG-FFRIIMMHHPPVLDTSSLYN-RMFGIQRFQKMIWHEGADLILHGHTHLNSLH  237 (309)
Q Consensus       161 ~~~~g~~~~~q~~~l~~~L~~~~~~~-~~~iv~~Hhpp~~~~~~~~~-~~~~~~~l~~~l~~~~v~lvl~GH~H~~~~~  237 (309)
                            ...+|++||++.|+.+..+. .++|+++|||+......... .....+.+.++|.+++|+++|+||.|..++.
T Consensus       138 ------~~~~Q~~WL~~~L~~~~~~~~~w~iv~~H~P~y~~~~~~~~~~~~~r~~l~~l~~~~~Vdlv~~GH~H~YeRt  210 (312)
T d2qfra2         138 ------RGTPQYTWLKKELRKVKRSETPWLIVLMHSPLYNSYNHHFMEGEAMRTKFEAWFVKYKVDVVFAGHVHAYERS  210 (312)
T ss_dssp             ------TTSHHHHHHHHHHHTCCTTTCCEEEEECSSCSSCCBSTTTTTTHHHHHHHHHHHHHTTCSEEEECSSSSEEEE
T ss_pred             ------CHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCEEEE
T ss_conf             ------1679999999999987635888899980566300377886431568999999999709689998367536997


SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Purple acid phosphatase-like
domain: Plant purple acid phosphatase, catalytic domain
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]