BLAST/PSIBLAST alignment of GI: 255764495 and GI: 315121809 at iteration 1
>gi|315121809|ref|YP_004062298.1| putative phosphoesterase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 294
>gi|313495211|gb|ADR51810.1| putative phosphoesterase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 294
 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/301 (69%), Positives = 242/301 (80%), Gaps = 7/301 (2%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           MFVLAHISDIH+S   SF ELS KRIIGL NWHF RKKYFS  + +LL+NDIL HN++H+
Sbjct: 1   MFVLAHISDIHISCPLSFSELSLKRIIGLANWHFGRKKYFSHTMVDLLVNDILSHNINHL 60

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +ITGDIVN T N+EI  + HWL++I NPHDISIV GNHDAY + +K+KSL AW DYI  D
Sbjct: 61  AITGDIVNMTTNQEISEAIHWLKNIVNPHDISIVLGNHDAYTNSSKKKSLRAWSDYIAGD 120

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           T     KK FPYLR+RNNIALIGCSTAIATPPFSANGYFGQEQ H TSKLLRKA K+G F
Sbjct: 121 TP-PIEKKQFPYLRVRNNIALIGCSTAIATPPFSANGYFGQEQDHDTSKLLRKAKKEGLF 179

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++MMHHPP LDTS++YNRMFGI+RF+ MI  EGA+L+LHGHTH NSLHWI   KKLIPV
Sbjct: 180 RVVMMHHPPFLDTSTIYNRMFGIKRFKDMILREGAELMLHGHTHRNSLHWIDGAKKLIPV 239

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLV 308
           VGIA+A       K  ASYNLFYIEKK++ WTL GKRYTLS DS  +QK+ S+IF +TL 
Sbjct: 240 VGIAAACH-----KKNASYNLFYIEKKHDCWTLRGKRYTLS-DSNGVQKNCSNIFNETLS 293

Query: 309 L 309
           L
Sbjct: 294 L 294