BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764495|ref|YP_003065022.2| putative phosphoesterase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (309 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|255764495|ref|YP_003065022.2| putative phosphoesterase protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254547846|gb|ACT57082.2| putative phosphoesterase protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 309

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/309 (100%), Positives = 309/309 (100%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI
Sbjct: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60

Query: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
           LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA
Sbjct: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
           WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR
Sbjct: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
           KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK
Sbjct: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
           NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS
Sbjct: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300

Query: 301 DIFYDTLVL 309
           DIFYDTLVL
Sbjct: 301 DIFYDTLVL 309


>gi|315121809|ref|YP_004062298.1| putative phosphoesterase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495211|gb|ADR51810.1| putative phosphoesterase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 294

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/301 (69%), Positives = 242/301 (80%), Gaps = 7/301 (2%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           MFVLAHISDIH+S   SF ELS KRIIGL NWHF RKKYFS  + +LL+NDIL HN++H+
Sbjct: 1   MFVLAHISDIHISCPLSFSELSLKRIIGLANWHFGRKKYFSHTMVDLLVNDILSHNINHL 60

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +ITGDIVN T N+EI  + HWL++I NPHDISIV GNHDAY + +K+KSL AW DYI  D
Sbjct: 61  AITGDIVNMTTNQEISEAIHWLKNIVNPHDISIVLGNHDAYTNSSKKKSLRAWSDYIAGD 120

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           T     KK FPYLR+RNNIALIGCSTAIATPPFSANGYFGQEQ H TSKLLRKA K+G F
Sbjct: 121 TP-PIEKKQFPYLRVRNNIALIGCSTAIATPPFSANGYFGQEQDHDTSKLLRKAKKEGLF 179

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++MMHHPP LDTS++YNRMFGI+RF+ MI  EGA+L+LHGHTH NSLHWI   KKLIPV
Sbjct: 180 RVVMMHHPPFLDTSTIYNRMFGIKRFKDMILREGAELMLHGHTHRNSLHWIDGAKKLIPV 239

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLV 308
           VGIA+A       K  ASYNLFYIEKK++ WTL GKRYTLS DS  +QK+ S+IF +TL 
Sbjct: 240 VGIAAACH-----KKNASYNLFYIEKKHDCWTLRGKRYTLS-DSNGVQKNCSNIFNETLS 293

Query: 309 L 309
           L
Sbjct: 294 L 294


>gi|241205764|ref|YP_002976860.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859654|gb|ACS57321.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 302

 Score =  325 bits (833), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 203/300 (67%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   PS    EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPSLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR+ G+P + S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRAFGDPANTSVVPGNHDAYVPGAYEKSMRAWYDYVR 120

Query: 127 SDTTCST---GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         + +FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLAPPQWQDDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 181 EAGLFRVVMIHHPPIRGATAFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  + +DIF
Sbjct: 241 QPVPVVGIASASQGPGSVKPPAAYNLFSIDGSPGAWELSGERFSLNRAGDAVMPESTDIF 300


>gi|327193481|gb|EGE60376.1| putative phosphoesterase protein [Rhizobium etli CNPAF512]
          Length = 306

 Score =  321 bits (823), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 201/300 (67%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 5   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 64

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR +G+P   S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 65  HLAVTGDLVNLASGIEIRAAAAWLRELGDPAHTSVVPGNHDAYVPGAYEKSMRAWYDYVR 124

Query: 127 SDTTC---STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         + +FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 125 GDLAPPQWQEDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 184

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 185 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 244

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  +  DIF
Sbjct: 245 QPVPVVGIASASQGPGSIKPAAAYNLFSIDGSPGAWELSGERFSLNRAGDAVIPESVDIF 304


>gi|190892804|ref|YP_001979346.1| phosphoesterase [Rhizobium etli CIAT 652]
 gi|190698083|gb|ACE92168.1| putative phosphoesterase protein [Rhizobium etli CIAT 652]
          Length = 312

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 146/300 (48%), Positives = 201/300 (67%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 11  MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 70

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR +G+P   S+VPGNHDAY+ GA EKS+ AW +Y+ 
Sbjct: 71  HLAVTGDLVNLASGIEIRAAAAWLRELGDPAHTSVVPGNHDAYVPGAYEKSMRAWYEYVR 130

Query: 127 SDTTC---STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         + +FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 131 GDLAPPQWQEDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 190

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 191 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 250

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  +  DIF
Sbjct: 251 QPVPVVGIASASQGPGSIKPAAAYNLFSIDGSPGAWELSGERFSLNRAGDAVIPESVDIF 310


>gi|15966127|ref|NP_386480.1| hypothetical protein SMc02712 [Sinorhizobium meliloti 1021]
 gi|307305682|ref|ZP_07585429.1| metallophosphoesterase [Sinorhizobium meliloti BL225C]
 gi|307317685|ref|ZP_07597124.1| metallophosphoesterase [Sinorhizobium meliloti AK83]
 gi|15075397|emb|CAC46953.1| Hypothetical protein SMc02712 [Sinorhizobium meliloti 1021]
 gi|306896843|gb|EFN27590.1| metallophosphoesterase [Sinorhizobium meliloti AK83]
 gi|306902385|gb|EFN32981.1| metallophosphoesterase [Sinorhizobium meliloti BL225C]
          Length = 300

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 149/292 (51%), Positives = 197/292 (67%), Gaps = 5/292 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL+ KRI G VNWH NR ++      + L+ DI + N D
Sbjct: 1   MFKLAHISDVHLGPLPDLSLRELASKRITGFVNWHRNRVRHLFPGTLDCLMKDIEVRNPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN   + EI   T WL   G+P++IS+VPGNHDAY+ GA EK  HAW  ++ 
Sbjct: 61  HLAITGDLVNLASSLEIEAVTEWLAEAGDPNEISVVPGNHDAYVPGAYEKITHAWYPFMR 120

Query: 127 SDTTCSTGKK---LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   S   K    FPY+R+R  +ALIGCSTA+ATPPF+A+GYFG  QA AT  LLR+A 
Sbjct: 121 GDDGPSGWMKKHACFPYMRVRGKVALIGCSTAVATPPFAASGYFGPRQARATVNLLRQAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FRI+M+HHPP+   +S++ RM GI+RF   I   GA+L+LHGHTHLN+LHW+K   
Sbjct: 181 EAGLFRIVMIHHPPIRGATSMHKRMIGIRRFAATISAGGAELVLHGHTHLNTLHWLKGHT 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
             +PVVGIASASQ    +KP A+YNLF ++ +   W L  +RY ++PD+  +
Sbjct: 241 GPVPVVGIASASQGPGGSKPVAAYNLFSVDGEPGDWRLTRERYAINPDATGV 292


>gi|116253249|ref|YP_769087.1| phosphoesterase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257897|emb|CAK08995.1| putative phosphoesterase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 312

 Score =  315 bits (808), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 204/300 (68%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   PS    EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 11  MFKLAHISDVHLGPLPSLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 70

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV++TGD+VN     EI  +  WLR++G+P D S+VPGNHDAY+ G+ EKS+ AW DY+ 
Sbjct: 71  HVAVTGDLVNLASGIEIRAAAAWLRALGDPADTSVVPGNHDAYVPGSYEKSMRAWYDYVR 130

Query: 127 SDTTCST---GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         + +FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 131 GDLAPPQWPENRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNILRAAG 190

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 191 EAGLFRVVMIHHPPIRGATAFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQM 250

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  + +DIF
Sbjct: 251 QPVPVVGIASASQGPGSIKPPAAYNLFSIDGSPGAWELRGERFSLNRAGDAVMPESADIF 310


>gi|209550379|ref|YP_002282296.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536135|gb|ACI56070.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 302

 Score =  313 bits (803), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 206/300 (68%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G+P D S+VPGNHDAY+ GA EKS+ AW +Y+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRALGDPADTSVVPGNHDAYVPGAYEKSMRAWYEYVR 120

Query: 127 SDTTC---STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D +       + +FPYLRIR+ +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLSPPQWQEDRHIFPYLRIRDKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 181 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++++    ++  + +DIF
Sbjct: 241 QPVPVVGIASASQGPGSIKPPAAYNLFSIDGSPGAWELSGERFSVNRSGDAVMAESADIF 300


>gi|150397483|ref|YP_001327950.1| metallophosphoesterase [Sinorhizobium medicae WSM419]
 gi|150028998|gb|ABR61115.1| metallophosphoesterase [Sinorhizobium medicae WSM419]
          Length = 300

 Score =  311 bits (796), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 146/292 (50%), Positives = 195/292 (66%), Gaps = 5/292 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL+ KRI G VNWH NR ++      + L+ DI   + D
Sbjct: 1   MFKLAHISDVHLGPLPDLSLRELASKRITGFVNWHRNRVRHLFPGTLDCLMKDIEKRDPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN   + EI   T WL   G P +IS+VPGNHDAY+ GA EKS HAW  ++ 
Sbjct: 61  HLAITGDLVNLASSLEIEAVTEWLTEAGEPDEISVVPGNHDAYVPGAYEKSTHAWYPFMR 120

Query: 127 SDTTCSTGKK---LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   S   K    FPY+R+R ++ALIGCSTA+ATPPF+A+GYFG  QA  T  LLR+A 
Sbjct: 121 GDDAPSGWVKKHACFPYMRVRGSVALIGCSTAVATPPFAASGYFGPRQARETVNLLRRAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FRI+M+HHPP+   +S++ RM GI+RF   I   GA+++LHGHTHLNSL+W+K   
Sbjct: 181 EAGLFRIVMIHHPPIRGATSMHKRMIGIRRFAATISAGGAEMVLHGHTHLNSLYWLKGHA 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
             +PV+GIASASQ    +KP A+YNLF ++ +   W L  +RY ++PD+  +
Sbjct: 241 GPVPVIGIASASQGPGGSKPVAAYNLFSVDGEPGDWRLTRERYAINPDATGV 292


>gi|86358665|ref|YP_470557.1| putative phosphatase protein [Rhizobium etli CFN 42]
 gi|86282767|gb|ABC91830.1| putative phosphatase protein [Rhizobium etli CFN 42]
          Length = 312

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 146/300 (48%), Positives = 204/300 (68%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 11  MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFASTLDLLLDDIRTHRAD 70

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G+P D S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 71  HLAVTGDLVNLASGIEIRAAAAWLRALGDPADTSVVPGNHDAYVPGAYEKSMRAWYDYVR 130

Query: 127 SDTTC---STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         +++FPYLR+R+ +A++GCSTA+ATPPF+A+G+F   QA  T  +LR A 
Sbjct: 131 GDLAPPQWQEDRRIFPYLRVRDKVAIVGCSTAVATPPFAASGFFSARQARDTVNMLRAAG 190

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ + RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 191 EAGLFRVVMIHHPPIRGATAFHKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 250

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  +  DIF
Sbjct: 251 QPVPVVGIASASQGPGSIKPPAAYNLFSIDGAPGAWELTGERFSLNRTGDAMMPESVDIF 310


>gi|325293623|ref|YP_004279487.1| hypothetical protein AGROH133_07855 [Agrobacterium sp. H13-3]
 gi|325061476|gb|ADY65167.1| hypothetical protein AGROH133_07855 [Agrobacterium sp. H13-3]
          Length = 316

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 206/304 (67%), Gaps = 7/304 (2%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  +F EL+ KRI G VNWH NR+K+   +    L++D+   + D
Sbjct: 1   MFKLAHISDVHLGPLPKLTFRELASKRITGFVNWHRNRRKHLFTDTLEKLLDDLEAKSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN     EI  +  WL  +G+P  IS+VPGNHDAY+SGA +K++ AW  Y+ 
Sbjct: 61  HLAITGDLVNLATGIEIRAAADWLEEVGDPEKISVVPGNHDAYVSGAHDKAMRAWYPYVR 120

Query: 127 SDTTCST---GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   +     +K+FPY+R+R  +ALIGCST+IATPPFSA GYFG  QA AT++LL+KA 
Sbjct: 121 GDGDPAEWDDDRKIFPYMRVRGPVALIGCSTSIATPPFSATGYFGNRQARATAELLKKAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE- 242
           ++G FR++M+HHPP+   ++ + RMFGI+RF   +   GA+L+LHGHTHLN+++W+    
Sbjct: 181 EQGLFRVVMIHHPPIRGAAAAHKRMFGIRRFAAALGVGGAELVLHGHTHLNTVYWLNTHH 240

Query: 243 -KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
            ++ IPVVGIASASQ     KP+A+YNLF+I      W +  +R++L+     I  +   
Sbjct: 241 GQEHIPVVGIASASQGPGGEKPRAAYNLFHISGGPGTWNVACERHSLNDTGTGIGLEDIR 300

Query: 302 IFYD 305
           +FY+
Sbjct: 301 VFYE 304


>gi|222149376|ref|YP_002550333.1| hypothetical protein Avi_3243 [Agrobacterium vitis S4]
 gi|221736360|gb|ACM37323.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 302

 Score =  308 bits (789), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 147/292 (50%), Positives = 194/292 (66%), Gaps = 5/292 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISDIHL   P  +F EL+ KRI G VNWH NR K+        L+ DI     D
Sbjct: 1   MFKLAHISDIHLGPMPHLTFRELASKRITGYVNWHRNRAKHMVSGTLEALVADIHAKAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G P   S+VPGNHDAY+ GA EK++HAW DY+ 
Sbjct: 61  HLTVTGDLVNLASGLEINKAAEWLRTVGPPATTSVVPGNHDAYVPGAHEKAMHAWYDYVR 120

Query: 127 SDTTCSTGKK---LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            DT     +K   L+P  R R  + LIGCST+IATPPFSA+GYF   QA  T++LLR+A 
Sbjct: 121 GDTDPDIWRKDFKLWPTFRRRGPVGLIGCSTSIATPPFSASGYFSSRQARETAQLLRQAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           ++G FR++++HHPPV   +S + RM GI+RF   I   GA+L+LHGHTHLN+L+W+ N  
Sbjct: 181 EEGLFRVVLIHHPPVRGAASQHKRMIGIRRFAAAISLGGAELVLHGHTHLNTLNWLHNRH 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
             +PVVGIASASQ   + KPQA+YNLF I   +  W L+ +RY L+ D+  +
Sbjct: 241 GRVPVVGIASASQGPGNKKPQAAYNLFSISGASGAWVLDWERYALTGDTSEV 292


>gi|222086630|ref|YP_002545164.1| phosphatase protein [Agrobacterium radiobacter K84]
 gi|221724078|gb|ACM27234.1| phosphatase protein [Agrobacterium radiobacter K84]
          Length = 316

 Score =  308 bits (788), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 143/300 (47%), Positives = 195/300 (65%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL+ KRI G VNWH NR+K+      +LL++DI     D
Sbjct: 16  MFKLAHISDVHLGPLPRLSIRELASKRITGFVNWHRNRRKHLFGGTLDLLLDDIRAKQAD 75

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI T+  WL+++G+P   S+VPGNHDAY+ GA EK++ AW  Y+ 
Sbjct: 76  HLAVTGDLVNLGSGIEIRTAAEWLKTVGDPAFTSVVPGNHDAYVPGAYEKAMRAWYPYVQ 135

Query: 127 SDTTCST---GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         + +FPYLRIR+ +ALIGCSTA+ATPPF+A+G+F   QA  T  +LR A 
Sbjct: 136 GDLAPPEWPEDQHVFPYLRIRDRVALIGCSTAVATPPFAASGFFSARQARETVNMLRAAG 195

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   +S Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW+    
Sbjct: 196 EAGLFRVVMIHHPPIRGATSFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLNGPT 255

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +PVVGIASASQ     KP A+YNLF I      W L+ +R++L+     ++    D+ 
Sbjct: 256 GPVPVVGIASASQGPGGLKPAAAYNLFTIAGHPGAWELKAERFSLNAHGDGVETQGVDVL 315


>gi|227822882|ref|YP_002826854.1| putative phosphohydrolase, Icc family [Sinorhizobium fredii NGR234]
 gi|227341883|gb|ACP26101.1| putative phosphohydrolase, Icc family [Sinorhizobium fredii NGR234]
          Length = 302

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 144/301 (47%), Positives = 199/301 (66%), Gaps = 5/301 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  SF EL+ KRI G VNWH NR ++        L++DI   + D
Sbjct: 1   MFKLAHISDVHLGPLPDLSFRELASKRITGFVNWHRNRARHLFPGTLESLMDDIEKRDPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN   + EI   T WL   G+P DIS+VPGNHDAY+ GA EK+  AW  ++ 
Sbjct: 61  HLAITGDLVNLASSLEIQAVTEWLTEAGDPEDISVVPGNHDAYVPGAYEKTARAWFPFMR 120

Query: 127 SDTTCSTGKK---LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D+  +   K    FPY+R+R ++ALIGCSTA+ATPPF+A+GYFG  QA AT  LLR A 
Sbjct: 121 GDSGPAGWMKDHHCFPYIRVRGSVALIGCSTAVATPPFAASGYFGPRQARATVNLLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   +S++ RM GI+RF   I   GA+L++HGHTHLN+++W++   
Sbjct: 181 EAGLFRVVMIHHPPIRGATSMHKRMIGIRRFAATISSGGAELVIHGHTHLNTVYWLRGHA 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +PVVGIASASQ    +KP A+YNLF I+ +   W L  +R+ L  D+ ++    +  F
Sbjct: 241 APVPVVGIASASQGPGGSKPVAAYNLFSIDGEPGAWRLTRERFALGADAKTVSLAETTQF 300

Query: 304 Y 304
           +
Sbjct: 301 H 301


>gi|15889538|ref|NP_355219.1| hypothetical protein Atu2263 [Agrobacterium tumefaciens str. C58]
 gi|15157419|gb|AAK88004.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 316

 Score =  305 bits (780), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 204/304 (67%), Gaps = 7/304 (2%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  +F EL+ KRI G VNWH NR+K+   +    L++D+   + D
Sbjct: 1   MFKLAHISDVHLGPLPKLTFRELASKRITGFVNWHRNRRKHLFTDTLEKLLDDLETKSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN     EI  +  WL  +G+P   S+VPGNHDAY+SGA +K++ AW  Y+ 
Sbjct: 61  HLAITGDLVNLATGIEIRAAADWLEEVGDPEKTSVVPGNHDAYVSGAHDKAMQAWYPYVR 120

Query: 127 SDTTCST---GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   +     +K+FPY+R+R  +ALIGCST+IATPPFSA GYFG  QA AT++LL+KA 
Sbjct: 121 GDGDPAEWDDDRKIFPYMRVRGPVALIGCSTSIATPPFSATGYFGNRQARATAELLKKAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE- 242
           ++G FR++M+HHPP+   ++ + RMFG++RF   +   GA+L+LHGHTHLN+++W+    
Sbjct: 181 EQGLFRVVMIHHPPIRGAAAAHKRMFGMRRFAAALGVGGAELVLHGHTHLNTVYWLNTHH 240

Query: 243 -KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
            +  IPVVGI+SASQ     KP+A+YNLF+I      W +  +R++L+     +  +   
Sbjct: 241 GEDHIPVVGISSASQGPGGEKPRAAYNLFHISGGPGTWNVACERHSLNETGTGVALEDIR 300

Query: 302 IFYD 305
           +FY+
Sbjct: 301 VFYE 304


>gi|13472484|ref|NP_104051.1| hypothetical protein mll2796 [Mesorhizobium loti MAFF303099]
 gi|14023230|dbj|BAB49837.1| mll2796 [Mesorhizobium loti MAFF303099]
          Length = 321

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 131/288 (45%), Positives = 181/288 (62%), Gaps = 3/288 (1%)

Query: 5   YTTIMFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL 62
           Y   MF LAHISD+HL   P  S+ +L+ KR++G VNW  NR+++    V + +  DI  
Sbjct: 9   YEGWMFRLAHISDVHLGPLPDVSYRDLASKRVLGYVNWQRNRRRHMHDAVIDAITADIKT 68

Query: 63  HNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWK 122
            N DH+++TGD+VN   + EI  + HWL ++G+PHD+S+VPGNHDAY+ GA +K   +W 
Sbjct: 69  QNPDHLAVTGDLVNLALDGEIEMAKHWLETLGSPHDVSVVPGNHDAYVPGAFDKVCRSWA 128

Query: 123 DYITSD-TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
            +++ D       +  FPYLR+R N+AL+G STA AT PF ANG+F + QA    K+LR 
Sbjct: 129 AWMSGDGVNTPVDRNAFPYLRVRGNVALVGVSTARATAPFMANGFFMEGQAERLGKILRD 188

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
              +G FR IM+HHPPV    S + R+FGI RF K+I   GA+L+LHGH+HL SL  I  
Sbjct: 189 TGGQGLFRAIMIHHPPVRGAVSQHKRLFGIARFHKVIRKNGAELVLHGHSHLPSLFQIGL 248

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
               +PVVG+A+A Q   S  P A YNLF I+ +   W +   R  L+
Sbjct: 249 RGTKVPVVGVAAAGQAPGSKHPAAQYNLFDIDGEKGNWRIRLTRRGLT 296


>gi|218509337|ref|ZP_03507215.1| putative phosphoesterase protein [Rhizobium etli Brasil 5]
          Length = 237

 Score =  268 bits (686), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 120/237 (50%), Positives = 162/237 (68%), Gaps = 5/237 (2%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR +G+P   S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRELGDPAHTSVVPGNHDAYVPGAYEKSMRAWYDYVR 120

Query: 127 SDTTC---STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         + +FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLAPPQWQEDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++
Sbjct: 181 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLR 237


>gi|260462516|ref|ZP_05810723.1| metallophosphoesterase [Mesorhizobium opportunistum WSM2075]
 gi|259031712|gb|EEW32981.1| metallophosphoesterase [Mesorhizobium opportunistum WSM2075]
          Length = 309

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 178/284 (62%), Gaps = 3/284 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S+ +L+ KR++G VNW  NR+++    V + ++ D+   + D
Sbjct: 1   MFRLAHISDVHLGPLPDVSYRDLASKRVLGYVNWQRNRRRHMHDAVIDTIVADVKAQSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   + EI  + HWL ++G P D+S+VPGNHDAY+ GA +K   +W  +++
Sbjct: 61  HLAVTGDLVNLALDGEIEMARHWLETLGPPQDVSVVPGNHDAYVPGAFDKVCRSWAAWMS 120

Query: 127 SDT-TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D       +  FP+LR+R N+ALIG STA AT PF ANG+F + QA    K+LR    +
Sbjct: 121 GDGINTPVDRNAFPFLRVRGNVALIGVSTARATAPFMANGFFMEGQADRLGKILRDTGGQ 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR IM+HHPPV      + R+FGI RF K+I   GA+L+LHGH+HL SL  I      
Sbjct: 181 GLFRAIMIHHPPVRGAVPQHKRLFGIARFHKIIRRHGAELVLHGHSHLPSLFQIGVRGAK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
           +PVVG+A+A Q      P A YNLF I+ + + W +   R  L+
Sbjct: 241 VPVVGVAAAGQAPGGKHPAAQYNLFDIDGEKDNWRIRLTRRGLT 284


>gi|319403806|emb|CBI77390.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 298

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/282 (45%), Positives = 189/282 (67%), Gaps = 5/282 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS  EL  KR+ G +NW   R      +   +L++ +     D
Sbjct: 5   MFYLAHISDVHLSPLPQPSLLELCGKRLTGYLNWKKKRNNQMKSDALEILMHALKQKKPD 64

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   + +WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 65  HIVISGDLVNLSLDKEFTQARNWLLAQNNPENISLTFGNHDAYVRGAFQKACTYFQPWIK 124

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD   S+ K  FPY+RIRNNIA+IG S+AIATPPF A+GYFG++QA   S+ L +A K+G
Sbjct: 125 SD---SSQKNPFPYMRIRNNIAIIGASSAIATPPFQASGYFGKQQAKTLSQFLNEAEKQG 181

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP    +S + +++GI+RF K++ H G +LILHGHTHL +L+ I+ + + I
Sbjct: 182 LFRVVMIHHPPFHHATSWHKKLWGIERFLKVVKHHGCELILHGHTHLPTLNIIEGKVRKI 241

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG++SASQ   S KP AS+NLF IE  +  W  + +RY +
Sbjct: 242 PIVGVSSASQSFGSKKPPASFNLFAIEYLHNQWHCQLQRYCI 283


>gi|90418313|ref|ZP_01226225.1| putative metallophophoesterase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337985|gb|EAS51636.1| putative metallophophoesterase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 319

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 178/278 (64%), Gaps = 4/278 (1%)

Query: 7   TIMFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKK-YFSKEVANLLINDILLH 63
           T MF LAH+SDIHL   P  S  EL+ KR+ G VNWH NR++  F   +ANL I D+   
Sbjct: 2   TGMFRLAHLSDIHLGPLPELSIRELASKRVTGYVNWHRNRRRVMFGDTLANL-IQDLQQE 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+++TGD+VN     E   +  WL  +G PHD+S+VPGNHDAY+ GA ++S   W +
Sbjct: 61  APDHIAVTGDLVNLATKVETMAARIWLEELGKPHDVSVVPGNHDAYVPGALKRSYREWYE 120

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           Y+  D   +     FPY+R+R  +A+ G STA AT PF A G F + QA A +K L  A 
Sbjct: 121 YMIGDNPLNAIGNSFPYVRVRGPVAIFGVSTAEATAPFFATGTFRRRQAMALAKQLEHAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
             G FR++++HHPP+  +++ + R+ G Q F K+I   GA+L+LHGHTHL++LHW+K  +
Sbjct: 181 AHGQFRVVLIHHPPISGSTAWHKRLIGKQFFSKVIHEMGAELVLHGHTHLDTLHWLKGPQ 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
            ++PVVG+ SASQ   S+ P + YNLF I+ +   W+L
Sbjct: 241 GMVPVVGVPSASQAPGSSHPASRYNLFEIDGEPGKWSL 278


>gi|49475919|ref|YP_033960.1| hypothetical protein BH11990 [Bartonella henselae str. Houston-1]
 gi|49238727|emb|CAF27982.1| hypothetical protein BH11990 [Bartonella henselae str. Houston-1]
          Length = 300

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 185/284 (65%), Gaps = 3/284 (1%)

Query: 7   TIMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           T MF LAHISD+HLS    PSFFEL  KR+ G +NW   RK   +      LI  +   N
Sbjct: 3   TPMFCLAHISDMHLSPLPKPSFFELFGKRLTGYLNWQKKRKGQMATNTLETLIEALKKKN 62

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+ I+GD+VN   ++E   + +WL + G P +IS+  GNHDAY+ GA +K+   ++ +
Sbjct: 63  PDHLVISGDLVNLALDKEFEQARNWLLNQGQPQNISLTFGNHDAYVRGAFQKACTLFQPW 122

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
           IT D         FPY+RIR N+A+IG S+AIATPPF A+GYFG+ QA A S+LL +A +
Sbjct: 123 ITGDFPQKNAPP-FPYIRIRKNVAIIGASSAIATPPFQASGYFGKMQAQALSQLLNEAAR 181

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +  FR+IM+HHPP    +S + +++GI+RF ++I H G +LILHGHTHL +L+ IK +  
Sbjct: 182 RNLFRVIMIHHPPFHHATSWHKKLWGIERFLEVIKHHGCELILHGHTHLPTLNIIKGKMG 241

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
            IP+VG+ASA+Q      P A +N F IE+ N+ W  + +RY+L
Sbjct: 242 KIPIVGVASAAQAFGDTPPPAGFNFFSIEQFNQQWHCQLQRYSL 285


>gi|114705049|ref|ZP_01437957.1| hypothetical protein FP2506_08931 [Fulvimarina pelagi HTCC2506]
 gi|114539834|gb|EAU42954.1| hypothetical protein FP2506_08931 [Fulvimarina pelagi HTCC2506]
          Length = 311

 Score =  261 bits (668), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 174/276 (63%), Gaps = 3/276 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH+SDIHL   P  S  EL+ KR+ G VNWH NR++    +    L+ D+     D
Sbjct: 1   MFRLAHLSDIHLGPLPELSLRELASKRVTGYVNWHRNRRRSMFGDTLTDLVLDMKHQRPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN    +E   +  WL  +G PHD+S+VPGNHDAY+ GA ++S H W DY+ 
Sbjct: 61  HIAVTGDLVNLATKKETVAARIWLEQLGVPHDVSLVPGNHDAYVPGALKRSFHEWHDYLI 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   +     FPYLR+R  IA+ G STA A+ PF A G F + QA A +KLL      G
Sbjct: 121 GDNPLAAIGNSFPYLRVRGKIAIFGVSTAEASAPFFATGSFRRGQALALAKLLESCRSTG 180

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK-KL 245
            FR++++HHPP+   +S + R+ G Q F K+I   GA+L+LHGHTHL++L+W++    + 
Sbjct: 181 HFRVVLIHHPPISGAASWHKRLIGKQFFSKVIRDVGAELVLHGHTHLDTLYWLEGPGHRK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
           +PVVG+ SASQ   S KP A YNLF I+ +   W+L
Sbjct: 241 VPVVGVPSASQSPGSEKPAARYNLFEIDGEPGNWSL 276


>gi|319406812|emb|CBI80445.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 294

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 129/282 (45%), Positives = 188/282 (66%), Gaps = 5/282 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS +EL  KR+ G +NW   R      +    L++ +     D
Sbjct: 1   MFYLAHISDVHLSPLPQPSLWELCGKRLTGYLNWKKKRNNQMKSDALETLMHALKQKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   + +WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 61  HIVISGDLVNLSLDKEFTQARNWLLAQNNPENISLTFGNHDAYVRGAFQKACTYFQPWIK 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD +    K  FPY+RIRNNIA+IG S+AIATPPF A+GYFG++QA   S+ L +A K+G
Sbjct: 121 SDFS---QKNPFPYMRIRNNIAIIGASSAIATPPFQASGYFGKKQAKILSQFLNEAAKQG 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           FFR++M+HHPP    +S Y +++GI+RF +++ H G +LILHGHTHL +L+ I+ +   I
Sbjct: 178 FFRVVMIHHPPFHHATSWYKKLWGIERFLEVVKHHGCELILHGHTHLPTLNIIEEKISKI 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           PVVG++SASQ   S KP AS+NLF I+  +  W  + +RY +
Sbjct: 238 PVVGVSSASQSFGSKKPPASFNLFAIKYLHHQWHCQLQRYGI 279


>gi|239832447|ref|ZP_04680776.1| metallophosphoesterase [Ochrobactrum intermedium LMG 3301]
 gi|239824714|gb|EEQ96282.1| metallophosphoesterase [Ochrobactrum intermedium LMG 3301]
          Length = 300

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 187/300 (62%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISDIHLS  P   + EL+ KRI G +NW  NRK      V + LI D+   + D
Sbjct: 1   MFRLAHISDIHLSPLPRVRYRELASKRITGYINWLRNRKNAMHGTVLDSLIADMQAQSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL  +GNP+D+S+VPGNHDAY+ GA +KS   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLTRLGNPNDVSVVPGNHDAYVPGALDKSCRKWEPWMR 120

Query: 127 SDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   ++G +  FPY+R+R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGIDNSGNRPQFPYMRVRGPVALIGVSSARATAPFMASGDFRSAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FRI+M+HHPP+   +  + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRIVMIHHPPIHGATPAHKRLYGIRRFQKIIRKHGAELVLHGHTHLVTHYEIDGPNGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PVV + SASQ    +KP A YN+F I+++ E  W+   + + +S  S  I K    + Y
Sbjct: 241 VPVVSVPSASQNFGGHKPAARYNIFGIDRRPEGGWSCLMEEHGVSDASEKITKLNERVLY 300


>gi|153008931|ref|YP_001370146.1| metallophosphoesterase [Ochrobactrum anthropi ATCC 49188]
 gi|151560819|gb|ABS14317.1| metallophosphoesterase [Ochrobactrum anthropi ATCC 49188]
          Length = 303

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 129/301 (42%), Positives = 186/301 (61%), Gaps = 4/301 (1%)

Query: 8   IMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +MF LAHISDIHLS  P   + EL+ KRI G +NW  NRK      V + LI+D+     
Sbjct: 3   LMFRLAHISDIHLSPLPRVRYRELASKRITGYINWLRNRKNAMHGTVLDTLIDDMQAQTP 62

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGD+VN   N EI  +  WL  +G+P D+S+VPGNHDAY+ GA +KS   W+ ++
Sbjct: 63  DHIAVTGDLVNLALNLEIDIAHDWLSKLGSPDDVSVVPGNHDAYVPGALDKSCRKWEPWM 122

Query: 126 TSDTTCST-GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
             D   +   +  FPY+R+R  +ALIG S+A AT PF A+G F  EQ    + +L +A  
Sbjct: 123 RGDGIDNKDNRPQFPYMRVRGPVALIGVSSARATAPFMASGDFRSEQGKRLAAMLDEAGA 182

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +G FRI+M+HHPP+   +  + R++GI+RFQK+I   GA+L+LHGHTHL + + I     
Sbjct: 183 RGLFRIVMIHHPPIYGATPAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPNG 242

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIF 303
            IPV+ + SASQ    +KP A YN+F I+K+ +  W+   + + +S  S  I K    + 
Sbjct: 243 KIPVISVPSASQNFGGHKPAARYNIFNIDKRPDGSWSCLMEEHGVSDASEKITKLNERVL 302

Query: 304 Y 304
           Y
Sbjct: 303 Y 303


>gi|319781807|ref|YP_004141283.1| metallophosphoesterase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167695|gb|ADV11233.1| metallophosphoesterase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 307

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 128/288 (44%), Positives = 180/288 (62%), Gaps = 3/288 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S+ +L+ KR++G VNW  NR+++    V + ++ DI  +  D
Sbjct: 1   MFRLAHISDVHLGPLPDVSYRDLASKRVLGYVNWQRNRRRHMHDAVIDTIVADIKANTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   + EI  + HWL ++G PHD+S+VPGNHDAY+ GA +K   +W  +++
Sbjct: 61  HLAVTGDLVNLALDGEIEMARHWLETLGPPHDVSVVPGNHDAYVPGAFDKVCRSWAAWMS 120

Query: 127 SD-TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D       +  FPYLR+R N+ALIG STA AT PF ANG+F + Q     K+L+    +
Sbjct: 121 GDGVNTPVDRNAFPYLRVRGNVALIGVSTARATAPFMANGFFMEGQGDRLGKILQDTAGQ 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR+IM+HHPPV      + R+FGI RF K+I   GADL+LHGH+HL SL +I      
Sbjct: 181 GLFRVIMIHHPPVRGAVPQHKRLFGIARFNKIIRRHGADLVLHGHSHLPSLFFIGGRGVR 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
           IP VG+A+A Q      P A YNLF I+ +   W +   R  L+  S+
Sbjct: 241 IPAVGVAAAGQAPGGKHPAAQYNLFDIDGEKGNWRIRLTRRGLTGPSI 288


>gi|306844563|ref|ZP_07477152.1| phosphohydrolase, Icc family protein [Brucella sp. BO1]
 gi|306275174|gb|EFM56930.1| phosphohydrolase, Icc family protein [Brucella sp. BO1]
          Length = 303

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 129/302 (42%), Positives = 185/302 (61%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADLLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGKRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACTMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|240850132|ref|YP_002971525.1| hypothetical protein Bgr_05230 [Bartonella grahamii as4aup]
 gi|240267255|gb|ACS50843.1| hypothetical protein Bgr_05230 [Bartonella grahamii as4aup]
          Length = 296

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 126/282 (44%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS FELS KR+ G +NW   RK      V   LI+ +     D
Sbjct: 1   MFYLAHISDVHLSPLPQPSLFELSGKRLTGYLNWQRKRKSQMVTNVLETLIDALNKKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN   ++E   +  WL ++G P DIS+  GNHDAY+ GA +K+   +K +IT
Sbjct: 61  HLVISGDLVNLALDKEFEQAHRWLLNLGQPQDISLTFGNHDAYVRGAFQKACTLFKPWIT 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D    +   LFPY+RIR N+A+I  S+AIATPPF A+GYFG+ QA      L++A ++ 
Sbjct: 121 GDVPQKSAF-LFPYMRIRKNVAIIATSSAIATPPFQASGYFGKMQAQTLPLFLKEAAQRN 179

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP    +S + ++  I+RF  +I + G +LILHGHTHL +L++I+   K I
Sbjct: 180 LFRVVMIHHPPFPKATSWHKKLRDIKRFLDVIKYHGCELILHGHTHLPTLNYIEGPIKKI 239

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG+ SASQ     KP A +NLF IE+    W  + +RY++
Sbjct: 240 PIVGVPSASQAFGDKKPPAGFNLFSIERLQNQWHCQLQRYSI 281


>gi|148559695|ref|YP_001259438.1| hypothetical protein BOV_1512 [Brucella ovis ATCC 25840]
 gi|148370952|gb|ABQ60931.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 303

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 185/302 (61%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVYGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|265984605|ref|ZP_06097340.1| metallophosphoesterase [Brucella sp. 83/13]
 gi|306837914|ref|ZP_07470774.1| phosphohydrolase, Icc family protein [Brucella sp. NF 2653]
 gi|264663197|gb|EEZ33458.1| metallophosphoesterase [Brucella sp. 83/13]
 gi|306407002|gb|EFM63221.1| phosphohydrolase, Icc family protein [Brucella sp. NF 2653]
          Length = 303

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 129/302 (42%), Positives = 185/302 (61%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGKRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNADGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|17986735|ref|NP_539369.1| Icc family phosphohydrolase [Brucella melitensis bv. 1 str. 16M]
 gi|189024678|ref|YP_001935446.1| phosphohydrolase, Icc family [Brucella abortus S19]
 gi|225628004|ref|ZP_03786040.1| Icc family phosphohydrolase [Brucella ceti str. Cudo]
 gi|237815956|ref|ZP_04594953.1| Icc family phosphohydrolase [Brucella abortus str. 2308 A]
 gi|256255496|ref|ZP_05461032.1| putative phosphohydrolase, Icc family protein [Brucella ceti B1/94]
 gi|260546983|ref|ZP_05822722.1| metallophosphoesterase [Brucella abortus NCTC 8038]
 gi|260565215|ref|ZP_05835699.1| metallophosphoesterase [Brucella melitensis bv. 1 str. 16M]
 gi|260755281|ref|ZP_05867629.1| metallophosphoesterase [Brucella abortus bv. 6 str. 870]
 gi|260758502|ref|ZP_05870850.1| metallophosphoesterase [Brucella abortus bv. 4 str. 292]
 gi|260762326|ref|ZP_05874669.1| metallophosphoesterase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884296|ref|ZP_05895910.1| metallophosphoesterase [Brucella abortus bv. 9 str. C68]
 gi|261214545|ref|ZP_05928826.1| metallophosphoesterase [Brucella abortus bv. 3 str. Tulya]
 gi|261219690|ref|ZP_05933971.1| metallophosphoesterase [Brucella ceti M13/05/1]
 gi|261222702|ref|ZP_05936983.1| metallophosphoesterase [Brucella ceti B1/94]
 gi|261318172|ref|ZP_05957369.1| metallophosphoesterase [Brucella pinnipedialis B2/94]
 gi|261322579|ref|ZP_05961776.1| metallophosphoesterase [Brucella ceti M644/93/1]
 gi|261325623|ref|ZP_05964820.1| metallophosphoesterase [Brucella neotomae 5K33]
 gi|261758741|ref|ZP_06002450.1| metallophosphoesterase [Brucella sp. F5/99]
 gi|265989203|ref|ZP_06101760.1| metallophosphoesterase [Brucella pinnipedialis M292/94/1]
 gi|265991617|ref|ZP_06104174.1| metallophosphoesterase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995455|ref|ZP_06108012.1| metallophosphoesterase [Brucella melitensis bv. 3 str. Ether]
 gi|265998666|ref|ZP_06111223.1| metallophosphoesterase [Brucella ceti M490/95/1]
 gi|265999369|ref|ZP_05466008.2| metallophosphoesterase [Brucella melitensis bv. 2 str. 63/9]
 gi|297248833|ref|ZP_06932551.1| icc family phosphohydrolase [Brucella abortus bv. 5 str. B3196]
 gi|17982361|gb|AAL51633.1| putative phosphohydrolases, icc family [Brucella melitensis bv. 1
           str. 16M]
 gi|189020250|gb|ACD72972.1| putative phosphohydrolase, Icc family [Brucella abortus S19]
 gi|225617167|gb|EEH14213.1| Icc family phosphohydrolase [Brucella ceti str. Cudo]
 gi|237789254|gb|EEP63465.1| Icc family phosphohydrolase [Brucella abortus str. 2308 A]
 gi|260096033|gb|EEW79910.1| metallophosphoesterase [Brucella abortus NCTC 8038]
 gi|260151283|gb|EEW86377.1| metallophosphoesterase [Brucella melitensis bv. 1 str. 16M]
 gi|260668820|gb|EEX55760.1| metallophosphoesterase [Brucella abortus bv. 4 str. 292]
 gi|260672758|gb|EEX59579.1| metallophosphoesterase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675389|gb|EEX62210.1| metallophosphoesterase [Brucella abortus bv. 6 str. 870]
 gi|260873824|gb|EEX80893.1| metallophosphoesterase [Brucella abortus bv. 9 str. C68]
 gi|260916152|gb|EEX83013.1| metallophosphoesterase [Brucella abortus bv. 3 str. Tulya]
 gi|260921286|gb|EEX87939.1| metallophosphoesterase [Brucella ceti B1/94]
 gi|260924779|gb|EEX91347.1| metallophosphoesterase [Brucella ceti M13/05/1]
 gi|261295269|gb|EEX98765.1| metallophosphoesterase [Brucella ceti M644/93/1]
 gi|261297395|gb|EEY00892.1| metallophosphoesterase [Brucella pinnipedialis B2/94]
 gi|261301603|gb|EEY05100.1| metallophosphoesterase [Brucella neotomae 5K33]
 gi|261738725|gb|EEY26721.1| metallophosphoesterase [Brucella sp. F5/99]
 gi|262553290|gb|EEZ09124.1| metallophosphoesterase [Brucella ceti M490/95/1]
 gi|262766568|gb|EEZ12357.1| metallophosphoesterase [Brucella melitensis bv. 3 str. Ether]
 gi|263002401|gb|EEZ14976.1| metallophosphoesterase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093500|gb|EEZ17534.1| metallophosphoesterase [Brucella melitensis bv. 2 str. 63/9]
 gi|264661400|gb|EEZ31661.1| metallophosphoesterase [Brucella pinnipedialis M292/94/1]
 gi|297176002|gb|EFH35349.1| icc family phosphohydrolase [Brucella abortus bv. 5 str. B3196]
          Length = 303

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 185/302 (61%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|261315734|ref|ZP_05954931.1| metallophosphoesterase [Brucella pinnipedialis M163/99/10]
 gi|261304760|gb|EEY08257.1| metallophosphoesterase [Brucella pinnipedialis M163/99/10]
          Length = 303

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 185/302 (61%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLVLNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|260565941|ref|ZP_05836411.1| metallophosphoesterase [Brucella suis bv. 4 str. 40]
 gi|261755510|ref|ZP_05999219.1| metallophosphoesterase [Brucella suis bv. 3 str. 686]
 gi|260155459|gb|EEW90539.1| metallophosphoesterase [Brucella suis bv. 4 str. 40]
 gi|261745263|gb|EEY33189.1| metallophosphoesterase [Brucella suis bv. 3 str. 686]
          Length = 303

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 185/302 (61%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEK-KNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|306843090|ref|ZP_07475712.1| phosphohydrolase, Icc family protein [Brucella sp. BO2]
 gi|306286695|gb|EFM58248.1| phosphohydrolase, Icc family protein [Brucella sp. BO2]
          Length = 300

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 183/300 (61%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGKRPQFPYMRQRGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNMFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|254719597|ref|ZP_05181408.1| putative phosphohydrolase, Icc family protein [Brucella sp. 83/13]
          Length = 300

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/300 (43%), Positives = 183/300 (61%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGKRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNADGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|261752852|ref|ZP_05996561.1| metallophosphoesterase [Brucella suis bv. 5 str. 513]
 gi|261742605|gb|EEY30531.1| metallophosphoesterase [Brucella suis bv. 5 str. 513]
          Length = 303

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 128/302 (42%), Positives = 184/302 (60%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR +M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRAVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|49474499|ref|YP_032541.1| hypothetical protein BQ09400 [Bartonella quintana str. Toulouse]
 gi|49240003|emb|CAF26417.1| hypothetical protein BQ09400 [Bartonella quintana str. Toulouse]
          Length = 300

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 179/284 (63%), Gaps = 3/284 (1%)

Query: 7   TIMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           T MF LAHISD+HLS    PS  EL  KR  G +NW   RK   +      LI+ +    
Sbjct: 3   TPMFYLAHISDVHLSPLPQPSLVELLGKRFTGYLNWQKKRKNQMATNALETLIDTLKKKK 62

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+ I+GD++N   ++E   + +WL + G P +IS+  GNHDAY+ GA +K+   ++ +
Sbjct: 63  PDHLVISGDLINLALDKEFEQARNWLLNQGQPQNISLTFGNHDAYVRGAFQKACTLFQPW 122

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
           IT D         FPY+RIR N+A+IG S+AIATPPF A+GYFG+ QA   ++LL +   
Sbjct: 123 ITGDFPQKNALP-FPYMRIRKNVAIIGASSAIATPPFQASGYFGKMQAQTLAQLLNETAA 181

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +  FR+IM+HHPP    +S + +++GI+RF K+I H G DL+LHGHTHL +L+ ++    
Sbjct: 182 RNLFRVIMIHHPPFHHATSWHKKLWGIERFLKVIKHHGCDLVLHGHTHLPTLNIVEGTMG 241

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
            IP+VG+ASASQ    N P A +NLF IE+ +  W  + +RY+L
Sbjct: 242 KIPIVGVASASQAFGDNPPPAGFNLFSIERFHHQWHCQLQRYSL 285


>gi|62290448|ref|YP_222241.1| hypothetical protein BruAb1_1553 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700371|ref|YP_414945.1| metallo-phosphoesterase [Brucella melitensis biovar Abortus 2308]
 gi|225853042|ref|YP_002733275.1| metallophosphoesterase [Brucella melitensis ATCC 23457]
 gi|254689750|ref|ZP_05153004.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           6 str. 870]
 gi|254694239|ref|ZP_05156067.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           3 str. Tulya]
 gi|254697895|ref|ZP_05159723.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254710601|ref|ZP_05172412.1| putative phosphohydrolase, Icc family protein [Brucella
           pinnipedialis B2/94]
 gi|254714784|ref|ZP_05176595.1| putative phosphohydrolase, Icc family protein [Brucella ceti
           M644/93/1]
 gi|254717845|ref|ZP_05179656.1| putative phosphohydrolase, Icc family protein [Brucella ceti
           M13/05/1]
 gi|254730785|ref|ZP_05189363.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           4 str. 292]
 gi|256032095|ref|ZP_05445709.1| putative phosphohydrolase, Icc family protein [Brucella
           pinnipedialis M292/94/1]
 gi|256045187|ref|ZP_05448086.1| putative phosphohydrolase, Icc family protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256061617|ref|ZP_05451758.1| putative phosphohydrolase, Icc family protein [Brucella neotomae
           5K33]
 gi|256114138|ref|ZP_05454892.1| putative phosphohydrolase, Icc family protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|256160291|ref|ZP_05457985.1| putative phosphohydrolase, Icc family protein [Brucella ceti
           M490/95/1]
 gi|256258003|ref|ZP_05463539.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           9 str. C68]
 gi|256369980|ref|YP_003107491.1| hypothetical protein BMI_I1578 [Brucella microti CCM 4915]
 gi|260169230|ref|ZP_05756041.1| putative phosphohydrolase, Icc family protein [Brucella sp. F5/99]
 gi|294852882|ref|ZP_06793555.1| icc family phosphohydrolase [Brucella sp. NVSL 07-0026]
 gi|62196580|gb|AAX74880.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616472|emb|CAJ11537.1| Metallo-phosphoesterase [Brucella melitensis biovar Abortus 2308]
 gi|225641407|gb|ACO01321.1| metallophosphoesterase [Brucella melitensis ATCC 23457]
 gi|256000143|gb|ACU48542.1| hypothetical protein BMI_I1578 [Brucella microti CCM 4915]
 gi|294821471|gb|EFG38470.1| icc family phosphohydrolase [Brucella sp. NVSL 07-0026]
 gi|326409584|gb|ADZ66649.1| putative phosphohydrolase, Icc family [Brucella melitensis M28]
 gi|326539288|gb|ADZ87503.1| metallophosphoesterase [Brucella melitensis M5-90]
          Length = 300

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 183/300 (61%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|161619507|ref|YP_001593394.1| metallophosphoesterase [Brucella canis ATCC 23365]
 gi|254704817|ref|ZP_05166645.1| metallophosphoesterase [Brucella suis bv. 3 str. 686]
 gi|161336318|gb|ABX62623.1| metallophosphoesterase [Brucella canis ATCC 23365]
          Length = 300

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 183/300 (61%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEK-KNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|163843817|ref|YP_001628221.1| metallophosphoesterase [Brucella suis ATCC 23445]
 gi|163674540|gb|ABY38651.1| metallophosphoesterase [Brucella suis ATCC 23445]
          Length = 300

 Score =  252 bits (644), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 183/300 (61%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYCELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEK-KNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|254708232|ref|ZP_05170060.1| putative phosphohydrolase, Icc family protein [Brucella
           pinnipedialis M163/99/10]
          Length = 300

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 183/300 (61%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLVLNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|23502428|ref|NP_698555.1| hypothetical protein BR1564 [Brucella suis 1330]
 gi|23348417|gb|AAN30470.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 300

 Score =  252 bits (643), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 182/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V   LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLGSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEK-KNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|254702285|ref|ZP_05164113.1| putative phosphohydrolase, Icc family protein [Brucella suis bv. 5
           str. 513]
          Length = 300

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 182/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR +M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRAVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|121602306|ref|YP_989290.1| Ser/Thr protein phosphatase family protein [Bartonella
           bacilliformis KC583]
 gi|120614483|gb|ABM45084.1| Ser/Thr protein phosphatase family protein [Bartonella
           bacilliformis KC583]
          Length = 294

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 127/282 (45%), Positives = 181/282 (64%), Gaps = 5/282 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISDIHLS    PSF EL  KR+ G +NW   RK   +  V   L+  I   N D
Sbjct: 1   MFYLAHISDIHLSPVPQPSFSELFGKRLTGYLNWQKKRKNQMTTGVLETLMCTIKEKNPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   + +WL + G PHDIS+  GNHDAY+  A +K+   ++ +I 
Sbjct: 61  HLVISGDLVNLSLDKEFKQARNWLLTQGQPHDISLTFGNHDAYVRRALQKACTIFQPWIQ 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D      K  FPY+RIR+NIA+IG S+AIATPPF A+GYFG++QA   S+LL +A  + 
Sbjct: 121 GDLP---QKNAFPYMRIRDNIAIIGASSAIATPPFQASGYFGKKQAQILSQLLDEAAARN 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++ +HHPP    +  + +++GI RF  +I   G +LILHGHTHL +L+ I+ +K+ I
Sbjct: 178 LFRVVTIHHPPFHHATLWHKKLWGIGRFLDVIKRYGCELILHGHTHLPTLNIIEEKKRKI 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG+ASASQ      P A++N F IE  +  W  + +RY++
Sbjct: 238 PIVGVASASQGCGGKNPPANFNFFTIEHAHHQWHCQLQRYSI 279


>gi|319405244|emb|CBI78849.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 294

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 125/282 (44%), Positives = 179/282 (63%), Gaps = 5/282 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS FEL  KR+ G +NW   R      +    L+  +     D
Sbjct: 1   MFYLAHISDVHLSPLPQPSLFELCGKRLTGYLNWKKKRNNQMKADALETLMRALKQKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN    +E   +  WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 61  HIVISGDLVNLALEKEFTQARSWLLAQNNPQNISLTFGNHDAYVRGAFQKACTYFQPWIK 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD      K  FPY+RIR+NIA+IG S+AIATP F A+GYF ++QA   S+ L +A  +G
Sbjct: 121 SDFP---QKNPFPYMRIRDNIAIIGASSAIATPFFQASGYFDKQQAKILSQFLTEAATRG 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           FFR++++HHPP    +S + +++GI+RF K++   G +LILHGHTHL +L+ I+ E   I
Sbjct: 178 FFRVVIIHHPPFHHATSWHKKLWGIERFLKVVKQHGCELILHGHTHLPTLNTIEGEMSKI 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG++SASQ   S KP AS+NLF IE  +  W  + +RY +
Sbjct: 238 PIVGVSSASQSFGSKKPPASFNLFAIEYLHHQWHCQLQRYGI 279


>gi|110634536|ref|YP_674744.1| metallophosphoesterase [Mesorhizobium sp. BNC1]
 gi|110285520|gb|ABG63579.1| metallophosphoesterase [Chelativorans sp. BNC1]
          Length = 307

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 129/293 (44%), Positives = 178/293 (60%), Gaps = 5/293 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH SDIHL   P  S+ EL  KRI G +NWH  R+      + +L+ NDIL    D
Sbjct: 1   MFRLAHFSDIHLGPLPELSYRELISKRITGYINWHRRRRVNLDNGIIDLISNDILASAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   +REI  +  WL S+G P DIS+VPGNHDAY+  A  K+  AW  Y+T
Sbjct: 61  HIALTGDLVNLALDREIEMAQLWLESLGTPADISVVPGNHDAYVPHALNKACRAWGAYMT 120

Query: 127 SDTTCS-TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           +D     T +  FPY+R+R  +A+IG S+A AT PF A+GYF +EQ     +LL +A  +
Sbjct: 121 ADGAEPITDRHQFPYMRVRGPVAIIGLSSARATAPFLASGYFTEEQESRACELLEEAADR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             FR++++HHPPV   +  + R+FGI RFQ M+   GA+L+LHGHTHL ++H I      
Sbjct: 181 KLFRVLLIHHPPVRGATGQHKRLFGISRFQSMVRKYGAELVLHGHTHLPTVHRIDGSNGA 240

Query: 246 -IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG-KRYTLSPDSLSIQ 296
            +PVVG+A+A Q   +  P A YNLF I      W ++  +R    P    +Q
Sbjct: 241 SVPVVGVAAAGQAHGAALPAAHYNLFEIMGAPGTWQVQLIRRGVAEPGGKVVQ 293


>gi|319898478|ref|YP_004158571.1| hypothetical protein BARCL_0302 [Bartonella clarridgeiae 73]
 gi|319402442|emb|CBI75983.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 298

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 123/282 (43%), Positives = 177/282 (62%), Gaps = 5/282 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS  EL  KR+ G +NW   R      +    L++ +     D
Sbjct: 5   MFYLAHISDVHLSPLPQPSLLELCGKRLTGYLNWTKKRNNQMKTDALETLMHALKQKKPD 64

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD++N   ++E   +  WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 65  HIVISGDLINLALDKEFTQARSWLLAQNNPQNISLTFGNHDAYVRGAFQKACTCFQPWIK 124

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD      K  FPY+RIRNNIA+IG S+AIATPPF A GYF ++QA   S+ L +A  + 
Sbjct: 125 SDFP---QKNPFPYMRIRNNIAIIGASSAIATPPFQAAGYFDKKQAKILSQFLSEAATRN 181

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FRI+ +HHPP    +S + +++G++RF K+I H G +LILHGHTHL +L+ I+ +    
Sbjct: 182 LFRIVTIHHPPFHHATSWHKKLWGVERFLKIIKHHGCELILHGHTHLPTLNIIEGKMGKT 241

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG+ASASQ   S KP A++NLF IE  +  W  + +RY +
Sbjct: 242 PIVGVASASQSFGSKKPPANFNLFTIEYLHHQWHCQLERYGI 283


>gi|163758543|ref|ZP_02165630.1| hypothetical protein HPDFL43_14007 [Hoeflea phototrophica DFL-43]
 gi|162283833|gb|EDQ34117.1| hypothetical protein HPDFL43_14007 [Hoeflea phototrophica DFL-43]
          Length = 291

 Score =  241 bits (615), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 164/268 (61%), Gaps = 1/268 (0%)

Query: 28  ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTST 87
           EL+ KRI G +NW  NR+K+        L++ +     DHV+ITGD+VN     EI  + 
Sbjct: 11  ELASKRITGYLNWQRNRRKHLFGNTLEQLLDGMRAEAPDHVAITGDLVNLATRTEIEAAR 70

Query: 88  HWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNI 147
            WL +  +P + + VPGNHDAY+ GA  +S  AW+ +I SD   S GK LFP  R R  +
Sbjct: 71  LWLETHFDPANATFVPGNHDAYVPGAFARSTEAWEPWIASDNPASQGK-LFPNCRRRGPV 129

Query: 148 ALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNR 207
           ALIG STA AT PF A G FG +QA A  KLL +A+  G FR++M+HHPPV   +  + R
Sbjct: 130 ALIGLSTANATLPFMATGDFGHKQAIAAGKLLDQAHDDGLFRVLMIHHPPVRGATRWHKR 189

Query: 208 MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASY 267
           M G   F KM+   GA+L+LHGHTHL++LH++      +PVVGIASASQ   S++P A +
Sbjct: 190 MRGTGHFSKMLKLHGAELVLHGHTHLDTLHYLAGRHGDVPVVGIASASQGPDSHRPTAGF 249

Query: 268 NLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           N+F I+   + W L  +R  LS D   +
Sbjct: 250 NMFEIDGDRDTWKLVHRRMKLSGDGAGL 277


>gi|218662697|ref|ZP_03518627.1| putative phosphoesterase protein [Rhizobium etli IE4771]
          Length = 247

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 149/213 (69%), Gaps = 3/213 (1%)

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKK---LFPYLRIRNNIALI 150
           G+P + S+VPGNHDAY+ GA EKS+ AW DY+  D   +  ++   +FPYLR+R  +A++
Sbjct: 34  GDPAETSVVPGNHDAYVPGAYEKSMRAWYDYVRGDLAPAQWQEDRHIFPYLRVRGKVAIV 93

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
           GCSTA+ATPPF+A+G+FG  QA  T  +LR A + G FR++M+HHPP+   ++ Y RM G
Sbjct: 94  GCSTAVATPPFAASGFFGARQARDTVNMLRAAGEAGLFRVVMIHHPPIRGATTFYKRMIG 153

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
           I+RF  +I   GA+L+LHGHTHLN+LHW++ + + +PVVGIASASQ   S KP A+YNLF
Sbjct: 154 IRRFAAVISTGGAELVLHGHTHLNTLHWLRGQVQPVPVVGIASASQGPGSIKPAAAYNLF 213

Query: 271 YIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            I+     W L G+R++L+    ++     DIF
Sbjct: 214 SIDGSPGAWELSGERFSLNRAGDAVISGSVDIF 246


>gi|319408922|emb|CBI82579.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 294

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 121/282 (42%), Positives = 187/282 (66%), Gaps = 5/282 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS  EL  KR+ G  NW   RK   +  V + L++ +     +
Sbjct: 1   MFYLAHISDVHLSPLPQPSLSELFGKRLTGYFNWQKKRKSQMTTSVLDTLMHALKKEKPN 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   +  WL + G+P +IS+  GNHDAY+ GA +K+  A++ +IT
Sbjct: 61  HLVISGDLVNLSLDKEFEQACRWLCAQGHPENISLTLGNHDAYVRGAFQKACIAFQPWIT 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D        +FPY+R+R+N+A+I  S+AIATP F A GYF + QA   S+LL +A  + 
Sbjct: 121 GDIP---QNNVFPYMRVRDNVAIISASSAIATPFFQAAGYFDKMQAQTLSQLLNEAAARD 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FRI+M+HHPP  + +S Y +++GI++F  +I H G +LILHGHTHL +L++I+ + K +
Sbjct: 178 LFRIVMIHHPPFHNATSWYKKLWGIEKFLDVIKHHGCELILHGHTHLPTLNFIEGKMKKV 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG++SASQ   S KP A++NLF IE+ ++ W  + +R+++
Sbjct: 238 PIVGVSSASQAFGSKKPPANFNLFAIERSHQQWHCQLQRHSI 279


>gi|163867927|ref|YP_001609131.1| hypothetical protein Btr_0711 [Bartonella tribocorum CIP 105476]
 gi|161017578|emb|CAK01136.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 296

 Score =  233 bits (593), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 124/282 (43%), Positives = 175/282 (62%), Gaps = 3/282 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS FELS KR+ G +NW   RK   +  V   LI+ +     D
Sbjct: 1   MFYLAHISDVHLSPLPKPSLFELSGKRLTGYLNWQKKRKNQITINVLETLIDALNQKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN   ++E   +  WL ++G P DIS+  GNHDAY+ GA +K+   +K +IT
Sbjct: 61  HLVISGDLVNLALDKEFEQAHRWLLNLGQPQDISLTFGNHDAYVRGALQKACTLFKPWIT 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D    +    FPY+RIR ++A+I  S+AIATPPF A+GYFG+ QA     LL +A ++ 
Sbjct: 121 GDVPQKSVFP-FPYMRIRKDVAIIAASSAIATPPFHASGYFGKMQAQMLPHLLNEAAQRN 179

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP    +S + ++   +RF  +I H G +LILHGHTHL +L + +   K I
Sbjct: 180 LFRVVMIHHPPFPKATSWHKKLRDTKRFLNVIKHHGCELILHGHTHLPTLKYTEGPTKKI 239

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG+ SASQ     KP A +NLF IE     W  + +RY++
Sbjct: 240 PIVGVPSASQAFGDKKPPAGFNLFSIEHLRNQWHCQLQRYSI 281


>gi|304393664|ref|ZP_07375592.1| metallophosphoesterase [Ahrensia sp. R2A130]
 gi|303294671|gb|EFL89043.1| metallophosphoesterase [Ahrensia sp. R2A130]
          Length = 309

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 118/301 (39%), Positives = 164/301 (54%), Gaps = 8/301 (2%)

Query: 9   MFVLAHISDIHLSYSPSFFE--LSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P F    L  KR++G  NW  NRK      V   LI+  L  N D
Sbjct: 1   MFKLAHISDVHLGPLPPFKRSALLSKRVLGYANWRLNRKGDLHSGVLGNLIDHTLATNPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN     EI     WL  +G P DIS++PGNHD Y+ GA  + +  WK ++ 
Sbjct: 61  HLAITGDLVNLALPEEIELIHQWLTGLGAPEDISVIPGNHDTYVPGALRRIIERWKPWMQ 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   +     FPY R R  +ALIG ++  AT PF A G +  +Q   TS++L++A   G
Sbjct: 121 GDKPVAGNP--FPYRRDRGAVALIGTNSGRATAPFLATGSWRAQQDSDTSEMLQRAKADG 178

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP  + ++ + R+ G +RF++MI  EGA+LILHGHTH+ S   I      +
Sbjct: 179 QFRVVMIHHPPFPNATAQHKRLIGAKRFRRMIAREGAELILHGHTHIVSDERIDGPDGPV 238

Query: 247 PVVGIASASQKVHS----NKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
           PV+G+ SAS          +P A YNLF I      W    +++        I +   DI
Sbjct: 239 PVIGVPSASHGPRLTPSIGRPGARYNLFEISGNQGAWRCRQQQFGYGDGQQKISELADDI 298

Query: 303 F 303
            
Sbjct: 299 I 299


>gi|118593631|ref|ZP_01551007.1| Metallo-phosphoesterase [Stappia aggregata IAM 12614]
 gi|118433742|gb|EAV40403.1| Metallo-phosphoesterase [Stappia aggregata IAM 12614]
          Length = 312

 Score =  225 bits (574), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 110/288 (38%), Positives = 160/288 (55%), Gaps = 8/288 (2%)

Query: 10  FVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL     P   +L  KRI+G +NW  NR +         L++D+     DH
Sbjct: 4   FRLAHLSDPHLGPLPDPKLLQLFSKRILGYLNWRRNRSRIMGGSYLEQLVDDMKRQAPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     EI  +  WL  IG P ++S+VPGNHDAY+ GA  ++  AW  Y+  
Sbjct: 64  IAVTGDLVNIALPLEISGARTWLEEIGAPENVSVVPGNHDAYVPGAVRRARAAWWPYMRG 123

Query: 128 DTTC------STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
           D         +  +  FPY+R R+ IAL+G +T  A+ P+ A G  G +Q+      L  
Sbjct: 124 DGAGDVPPNGTKSQATFPYVRKRDGIALVGVTTGRASGPWFATGRAGSKQSKRLRATLDD 183

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
             + GFFR++M+HHPP    +  + R+    R + ++   GA+LILHGHTH++S   I+ 
Sbjct: 184 LGRDGFFRVVMLHHPPFPHATHWHKRLSDASRVRAVVKRAGAELILHGHTHIDSFEHIEG 243

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
               +PVVG+ SA+      KP A YNLF IEK NE WT + + +  S
Sbjct: 244 PDGRVPVVGVPSATSAPGGKKPAARYNLFRIEKTNEGWTCQMEEHGFS 291


>gi|328542773|ref|YP_004302882.1| Ser/Thr protein phosphatase family protein [polymorphum gilvum
           SL003B-26A1]
 gi|326412519|gb|ADZ69582.1| Ser/Thr protein phosphatase family protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 308

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 160/274 (58%), Gaps = 6/274 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH SD HL     P   +L  KRI+G VNW  NR +  S +    L++D+     D
Sbjct: 1   MFRLAHFSDPHLGPLPDPRLSQLLSKRILGYVNWRRNRARAMSGDFLVRLLDDMRAAAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV++TGD+VN     EI  +  WL S+  P D+S+VPGNHDAY+ GA + +L AW+ Y+T
Sbjct: 61  HVALTGDLVNIALPLEIEAARAWLESLSAPDDLSLVPGNHDAYVPGALKSALEAWRPYMT 120

Query: 127 SDTTCST---GKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
            D   +    G ++ FP++R R+ IA++G STA A+ P+ A G  G  QA    + L + 
Sbjct: 121 GDARPALEPHGHQVQFPFVRKRDGIAIVGVSTARASAPWLATGKIGIAQARRLEEALARL 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +G FR++M+HHPP    ++ + R+    R +  I   GA+L+LHGHTH++S   +K  
Sbjct: 181 GAEGLFRVVMIHHPPFRKATAWHKRLQDASRVRAAIRKAGAELVLHGHTHVDSRETLKGP 240

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
              IPV+G+ SA+      KP A YNLF I  ++
Sbjct: 241 DGPIPVIGVPSATNAPGGRKPGARYNLFDIAPRD 274


>gi|307944145|ref|ZP_07659486.1| metallophosphoesterase [Roseibium sp. TrichSKD4]
 gi|307772491|gb|EFO31711.1| metallophosphoesterase [Roseibium sp. TrichSKD4]
          Length = 306

 Score =  219 bits (557), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 165/294 (56%), Gaps = 5/294 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           M  LAH+SD HL    +P   +L  KRI+G +NW  +R K         L+ D+     D
Sbjct: 1   MLKLAHLSDPHLGPLPNPKLIQLFSKRILGYLNWWQHRSKNMGGNHLEQLVADMQDQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ITGD+VN     EI  +  WL  +G+P  +++VPGNHDAY+ GA +K+  AW  Y++
Sbjct: 61  HVAITGDLVNIALPLEIIGARTWLEGVGSPEHVTVVPGNHDAYVPGALKKARDAWLPYMS 120

Query: 127 SDTTCSTG---KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +D   +     +  FP++R R NIAL+G STA AT P+ A G  G +Q+ A    L++  
Sbjct: 121 ADNGLAADHPDEASFPFVRRRKNIALVGVSTARATGPWFATGRVGSKQSRALRDTLKELG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPP    ++ + R+    R + MI   GA+L+LHGHTH++S   I+   
Sbjct: 181 DEGLFRVVMIHHPPFPKATNWHKRLSDASRVRAMIKRVGAELVLHGHTHIDSFKEIEGPN 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
             +PV+G+ SA+      KP A YN+F I+     W ++      +     I+K
Sbjct: 241 GPVPVIGVPSATSAPGGKKPAARYNIFEIDGSARNWNVQMTERGFTGSDSQIEK 294


>gi|254500795|ref|ZP_05112946.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
 gi|222436866|gb|EEE43545.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
          Length = 308

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 159/282 (56%), Gaps = 8/282 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH+SD HL     P   +L  KR++G +NW  NR K         LI D+     D
Sbjct: 1   MFKLAHLSDPHLGPLPDPKLLQLFSKRLLGYLNWQRNRSKIMGGNHLEQLIEDMKAQAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WL  +G P  +S+VPGNHDAY+ GA +K+  AW  Y+ 
Sbjct: 61  HIAVTGDLVNIALPLEISGARAWLDELGAPDQVSVVPGNHDAYVRGAVKKARTAWWPYMR 120

Query: 127 SDTTCST------GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
            D            +  FPY+R R +IA+IG +T  AT P+ A+G  G +Q      +L 
Sbjct: 121 GDGEDDVPSEKVGSEATFPYVRKRGDIAIIGVTTGRATAPWFASGRVGTKQTRRLRAILE 180

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
           +  ++  FR++++HHPP  + +  + R+    R + ++   GA+LILHGHTH++S   I+
Sbjct: 181 ELAEEKLFRVVLIHHPPFKNATKWHKRLSDASRLRTVVKRAGAELILHGHTHIDSFENIE 240

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
                +PV+G+ SA+     +KP A YNLF I ++N+ WT +
Sbjct: 241 GPNGPVPVIGVPSATSAPGGHKPAARYNLFSIARENDGWTCQ 282


>gi|90422893|ref|YP_531263.1| metallophosphoesterase [Rhodopseudomonas palustris BisB18]
 gi|90104907|gb|ABD86944.1| metallophosphoesterase [Rhodopseudomonas palustris BisB18]
          Length = 298

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 99/276 (35%), Positives = 156/276 (56%), Gaps = 6/276 (2%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           +F LAH+SD HL   P  +  EL+ KRI+G +NW  NR     ++V + L+ D+  H  D
Sbjct: 3   VFTLAHLSDPHLPPMPVATLRELAGKRILGYLNWTKNRHAIHRRDVLDALMADLRAHRPD 62

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN    +E   +  W+  +G P  +S++PGNHD Y+ G  E+    + DY++
Sbjct: 63  HIAVTGDLVNLALEQEFAPARRWIEQVGPPDRVSVIPGNHDRYVRGTAERFAETFPDYMS 122

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   +    +FP+LR R  + +IG STA+ T P  A G+ G+ Q  A    L   +   
Sbjct: 123 GDDRSNA--VVFPFLRRRGPLVIIGVSTAVPTAPLRATGWLGEAQRAALEAQLASLDGDP 180

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++++HHP  L + + + R+      Q ++   G DL+LHGH H++S  W+   +  I
Sbjct: 181 AFRVLLIHHP--LRSKARHKRLTDSAELQALLGRHGVDLVLHGHDHVHSTIWVDGPRAPI 238

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           PVVG+ SAS     ++P A+YNLF I +  E W  +
Sbjct: 239 PVVGVPSASAGPDGHRPPAAYNLFSIARDGERWRCD 274


>gi|218682884|ref|ZP_03530485.1| putative phosphoesterase protein [Rhizobium etli CIAT 894]
          Length = 212

 Score =  208 bits (530), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 120/172 (69%), Gaps = 3/172 (1%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGD+VN     EI  +  WLR +G+P D S+VPGNHDAY+ GA EKS+ AW DY+
Sbjct: 1   DHLAVTGDLVNLASGIEIRAAAAWLRELGDPADTSVVPGNHDAYVPGAYEKSMRAWYDYV 60

Query: 126 TSDTTC---STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
             D         + +FPYLRIR  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A
Sbjct: 61  RGDLAPPQWQEDRHIFPYLRIRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAA 120

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLN 234
            + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHL 
Sbjct: 121 GEAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLK 172


>gi|27377568|ref|NP_769097.1| hypothetical protein bll2457 [Bradyrhizobium japonicum USDA 110]
 gi|27350712|dbj|BAC47722.1| bll2457 [Bradyrhizobium japonicum USDA 110]
          Length = 293

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 148/275 (53%), Gaps = 8/275 (2%)

Query: 10  FVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL     P   EL+ KR+ G VNW  NR KY  +EV + L+ D+     DH
Sbjct: 4   FTLAHLSDPHLPPLPKPRLIELAGKRVFGYVNWTRNRHKYQRREVLDALVADVKAQAPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN   + E   +  WL  +G P  ++ +PGNHDAY+     +    +  Y+ S
Sbjct: 64  IAVTGDLVNLALDAEFAPARTWLDGVGPPDRVTTIPGNHDAYVRATYHRFGETFAPYLAS 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FP LR R  +ALI  STA+ T P  A G  G+ Q  A  ++L +   +  
Sbjct: 124 D----NGSAGFPALRRRGPLALISLSTAVPTLPLMATGTLGRAQLAALERVLERLATEDV 179

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L + + + RM        ++   G +L+LHGH H++S  W +     IP
Sbjct: 180 FRVLLVHHP--LKSDARHKRMTDAADLLALLKRHGVELVLHGHDHIHSTMWFEGPNGNIP 237

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
            +G+ SAS   H   P A+YNLF IEK N  W  E
Sbjct: 238 AIGVPSASALAHGRYPAAAYNLFTIEKDNAGWRCE 272


>gi|146339005|ref|YP_001204053.1| putative metallo-phosphoesterase [Bradyrhizobium sp. ORS278]
 gi|146191811|emb|CAL75816.1| putative metallo-phosphoesterase [Bradyrhizobium sp. ORS278]
          Length = 295

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 157/275 (57%), Gaps = 7/275 (2%)

Query: 10  FVLAHISDIHLS--YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL+  + P   EL+ KR +G +NW  NR KY   ++ +LLI+D+     D 
Sbjct: 5   FTLAHLSDPHLAPQHRPRLSELAGKRALGYLNWTRNRYKYHRLDILDLLISDLHAQMPDQ 64

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VNF    E   +  WLR++G P  ++ +PGNHDAY+   + +   ++  Y   
Sbjct: 65  IAVTGDLVNFALESEFPVAQAWLRTVGPPDKVTAIPGNHDAYVRSTRLRFAESFAAYFGG 124

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D   + G   FP LR R  +ALI  S+A+ + PF A G  G  Q  A  +LL+    +  
Sbjct: 125 D---AEGPATFPSLRRRGPLALISLSSAVPSAPFMATGRIGSAQLAALEQLLQSIAHEPL 181

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L +++   R+   +    ++   G +L+LHGH H++S  WI   ++ IP
Sbjct: 182 FRVLLVHHP--LRSANRMKRLIDSKELIALLARHGVELVLHGHDHVHSTIWIDGPERKIP 239

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           VVG+ SAS   H + P A+YN+F I  +  +W  +
Sbjct: 240 VVGVPSASSLAHGHTPAAAYNIFAIAAEGNHWRCD 274


>gi|86751303|ref|YP_487799.1| metallophosphoesterase [Rhodopseudomonas palustris HaA2]
 gi|86574331|gb|ABD08888.1| Metallophosphoesterase [Rhodopseudomonas palustris HaA2]
          Length = 292

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 101/277 (36%), Positives = 154/277 (55%), Gaps = 8/277 (2%)

Query: 8   IMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + F LAH+SD HL     P   +L+ KR++G +NW  NR     +++ + L+ D+     
Sbjct: 1   MTFTLAHLSDPHLPPLPKPRLADLASKRLLGYLNWTRNRHNIHRRDILDALVADLQAQRP 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGD+VN     E   +  WL S+G P  +S+VPGNHDAY++         + DYI
Sbjct: 61  DHIAVTGDLVNIALAEEFPPARQWLDSVGPPDRVSLVPGNHDAYVAATAPLIAETFADYI 120

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D     G   FPYLR R+ +A+IG STA+ T PF A G+ G  Q      LL++ + +
Sbjct: 121 RGD----DGAAGFPYLRRRDAVAIIGVSTAVPTAPFMATGWLGDAQRARLETLLQRLDSE 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             FR++++HHP  L + S + R+        ++     DL+LHGH H+++   I   +  
Sbjct: 177 RAFRVLLIHHP--LRSRSRHKRLTDSAELIALLQRHPVDLVLHGHDHVHATIRIDTPRGP 234

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           IPVVG+ SAS     ++P A+YNLF I + N+ W  E
Sbjct: 235 IPVVGVPSASAFNDHHRPSAAYNLFAISEANDGWRCE 271


>gi|92118726|ref|YP_578455.1| metallophosphoesterase [Nitrobacter hamburgensis X14]
 gi|91801620|gb|ABE63995.1| metallophosphoesterase [Nitrobacter hamburgensis X14]
          Length = 318

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 153/277 (55%), Gaps = 5/277 (1%)

Query: 10  FVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL+   +P+  +L+ KR +G +NW  +R     ++V + L+ D+     DH
Sbjct: 21  FTLAHLSDPHLAPLPAPNLHQLAGKRALGYLNWKRSRHAIHRRDVLDALVADVRAQAPDH 80

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           ++ITGD+VN     E   +  WL S+G P D+++VPGNHDAY+   K+++   W  Y+  
Sbjct: 81  IAITGDLVNLALPDEFTRARAWLESVGAPADVTVVPGNHDAYVRVTKKQT-SEWAGYLHG 139

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D   +     FP+LR R  + LIG S+A+ T PF A G  G+ Q  A  +   +      
Sbjct: 140 DGAEAGAPLAFPFLRRRGPLTLIGVSSAVPTAPFMATGTLGRAQLDALDRGFSQLASDPN 199

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L + S Y R+        ++   G DLILHGH H++S  W +     IP
Sbjct: 200 FRVLLVHHP--LSSKSSYKRLTDADALLTILGRHGVDLILHGHDHIHSTMWFEGPHGRIP 257

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGK 284
            VG+ SAS   + + P A+YNLF I +  + W  E +
Sbjct: 258 AVGVPSASAVPYRHYPAAAYNLFSITRDGDAWRCEQR 294


>gi|254470109|ref|ZP_05083513.1| metallo-phosphoesterase [Pseudovibrio sp. JE062]
 gi|211960420|gb|EEA95616.1| metallo-phosphoesterase [Pseudovibrio sp. JE062]
          Length = 270

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 147/243 (60%), Gaps = 7/243 (2%)

Query: 54  NLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGA 113
           + LI DI     DH+++ GD+VN    +E+  +  WL ++G+P ++S+ PGNHDAY+ GA
Sbjct: 7   DALIRDIHAQQPDHIALCGDLVNIALPKEVAGAKDWLATVGSPENLSLTPGNHDAYVPGA 66

Query: 114 KEKSLHAWKDYITSDTTCSTGKKL-----FPYLRIRNNIALIGCSTAIATPPFSANGYFG 168
            +++  AW+ Y+ SD        L     FP++R R+N+ +IG STA AT PF A G+  
Sbjct: 67  LKQAYGAWRPYMQSDPDLGLTPPLGTDPHFPFVRRRSNVTIIGLSTAKATGPFMATGHIS 126

Query: 169 QEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILH 228
             Q    +  LR A ++G FR++M+HHPPV + +S Y R+ G  RF+ +I   GA+LILH
Sbjct: 127 ANQLRELADQLRHAKERGDFRVVMLHHPPVRNATSWYKRLVGSSRFRNIIAEHGAELILH 186

Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT--LEGKRY 286
           GHTH  +   I   +  +PV+ + SAS  + S+KP A YNLF IEK    W+  +E + +
Sbjct: 187 GHTHRATRMEINGPEGPVPVICVPSASNGLSSHKPPARYNLFTIEKDGSGWSCIMEERGF 246

Query: 287 TLS 289
           T +
Sbjct: 247 TTA 249


>gi|91978511|ref|YP_571170.1| metallophosphoesterase [Rhodopseudomonas palustris BisB5]
 gi|91684967|gb|ABE41269.1| metallophosphoesterase [Rhodopseudomonas palustris BisB5]
          Length = 292

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 153/277 (55%), Gaps = 8/277 (2%)

Query: 8   IMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + F LAH+SD HL     P   +L+ KR++G +NW  NR+    +++ + L+ D+     
Sbjct: 1   MTFTLAHLSDPHLPPLPKPRLADLANKRVLGYLNWTRNRQSIHRRDILDALVADLQAQTP 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGD+VN   + E   +  WL  +G P  +S+VPGNHDAY++    +    + DYI
Sbjct: 61  DHIAVTGDLVNIALDDEFAPARRWLDGVGPPERVSVVPGNHDAYVAATAPRFGETFADYI 120

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D     G   FPYLR R+ IA+IG S+A+ T PF A G+ G  Q      +L+    +
Sbjct: 121 RGD----DGATGFPYLRRRDRIAIIGVSSAVPTAPFMATGWLGDAQRARLETMLQSLASE 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             FR++++HHP  L + S + R+        ++     DL+LHGH H+++   I      
Sbjct: 177 RVFRVLLIHHP--LRSRSRFKRLTDSAELIALLQRHPVDLVLHGHDHVHATIRIDAPSGP 234

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           IPVVG+ SAS     ++P A+YNLF I + N+ W  E
Sbjct: 235 IPVVGVPSASAFKDHHRPSAAYNLFAISEGNDGWRCE 271


>gi|148253756|ref|YP_001238341.1| putative metallo-phosphoesterase [Bradyrhizobium sp. BTAi1]
 gi|146405929|gb|ABQ34435.1| putative metallo-phosphoesterase [Bradyrhizobium sp. BTAi1]
          Length = 297

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 155/275 (56%), Gaps = 5/275 (1%)

Query: 10  FVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL+    P   EL+ KR +G +NW  NR KY  +++ +LL++D+     D 
Sbjct: 5   FTLAHLSDPHLAPLPRPRLAELAGKRALGYLNWTRNRYKYHRRDILDLLVSDLHTQMPDQ 64

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VNF    E   +  WL+++G P  ++ +PGNHDAY+   + +   ++  Y   
Sbjct: 65  IAVTGDLVNFALESEFPLAQAWLKTVGPPDKVTAIPGNHDAYVRSTRLRFAESFAAYFGG 124

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FP LR R  +ALI  S+A+ + PF A G  G  Q  A  +LL+    +  
Sbjct: 125 DAP-QEGPATFPSLRRRGPLALISLSSAVPSGPFMATGRLGSAQLAALEQLLQSIAHEQL 183

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L +++   R+   +    ++   G +LILHGH H++S  WI   ++ IP
Sbjct: 184 FRVLLVHHP--LRSANRMKRLTDAKDLIALLARHGVELILHGHDHVHSTIWIDGPERKIP 241

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
            VG+ SAS   H + P A+YN+F I +   +W  +
Sbjct: 242 TVGVPSASSIAHGHYPAAAYNIFAISRAGNHWRCD 276


>gi|154245314|ref|YP_001416272.1| metallophosphoesterase [Xanthobacter autotrophicus Py2]
 gi|154159399|gb|ABS66615.1| metallophosphoesterase [Xanthobacter autotrophicus Py2]
          Length = 301

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 154/293 (52%), Gaps = 6/293 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           M+VLAH+SD HL   P     EL  KR  G++NW   R++ F       LI D+L    D
Sbjct: 1   MYVLAHLSDPHLGPIPEARISELLGKRFFGMMNWIGARRRNFGAATLAPLITDLLAQAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ +TGD+VN +   E  T   +L S+G P  +S+VPGNHDAY+  A    L  W  ++ 
Sbjct: 61  HICVTGDLVNVSLPAEFDTGATFLASLGAPDKVSVVPGNHDAYVRSAMHYHLEHWAPFLA 120

Query: 127 SDTT---CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D T        + FPY+R R  +A++G STA+ T  F A+G  G+ Q      LL +  
Sbjct: 121 GDNTHPHTPVDVEAFPYVRRRGAVAVVGVSTAVPTAVFLASGEMGRAQRARLKTLLEQLK 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV +    +  +    + + ++   GA+L+LHGH H  SL  I+   
Sbjct: 181 AEGLFRVVMIHHPPVGE-RPFHRDLRDAAKVRAVLAEAGAELVLHGHDHRASLGQIEAAG 239

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
            LIPVVG+ SAS    S +    Y L+ I      W  + +R   + D  S+Q
Sbjct: 240 GLIPVVGVPSASAGPASERGPGGYCLYRISGGPGAWRCDMERRGYAKDVTSVQ 292


>gi|218461019|ref|ZP_03501110.1| putative phosphoesterase protein [Rhizobium etli Kim 5]
          Length = 191

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 95/191 (49%), Positives = 131/191 (68%), Gaps = 5/191 (2%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G+P + S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRALGDPAETSVVPGNHDAYVPGAYEKSMRAWYDYVR 120

Query: 127 SDTTCST---GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   +     + +FPYLR+R+ +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLAPAQWQEDRHIFPYLRVRDKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMH 194
           + G FR++M+H
Sbjct: 181 EAGLFRVVMIH 191


>gi|75676818|ref|YP_319239.1| metallophosphoesterase [Nitrobacter winogradskyi Nb-255]
 gi|74421688|gb|ABA05887.1| metallophosphoesterase [Nitrobacter winogradskyi Nb-255]
          Length = 301

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 157/301 (52%), Gaps = 5/301 (1%)

Query: 10  FVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
             LAH+SD HL   P     +L+ KR IG +NW   R     ++V + L+ DI   + DH
Sbjct: 4   LTLAHLSDPHLGPLPPLRLHQLAGKRAIGYLNWKRGRHAIHRRDVLDALVADIKAQSPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD++N     E   +  WL  +G PH++++VPGNHDAY+    +K +  W+DY+  
Sbjct: 64  IAVTGDLINLALPDEFTQARAWLSQVGAPHNVTLVPGNHDAYVR-PTQKQISEWEDYMRG 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FP+LR R  + LIG S+++ T PF A G  G +Q  A  + L +      
Sbjct: 123 DNAGEGTPLSFPFLRRRGPLTLIGASSSVPTRPFMATGRLGPKQLDALDRGLSQLESDPN 182

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L +   Y R+        ++   G +LILHGH H++S  W    +  IP
Sbjct: 183 FRVLLIHHP--LSSKDSYKRLTDADALLDLLKRRGVNLILHGHDHIHSTMWFDGPQGRIP 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTL 307
            +G+ SAS   H + P A+YNLF I      W  E +    +  +   +K+ S++    L
Sbjct: 241 AIGVPSASAMPHRHYPPAAYNLFSITPDGNGWRCEQQVRGFADQAAIERKEVSELQRTQL 300

Query: 308 V 308
           +
Sbjct: 301 I 301


>gi|296445940|ref|ZP_06887891.1| metallophosphoesterase [Methylosinus trichosporium OB3b]
 gi|296256608|gb|EFH03684.1| metallophosphoesterase [Methylosinus trichosporium OB3b]
          Length = 293

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 147/279 (52%), Gaps = 7/279 (2%)

Query: 8   IMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + FVLAH+SD H+     PS  EL+ KR+ G  NW   R ++   +V   ++ DI     
Sbjct: 1   MAFVLAHLSDAHIGPIPQPSLRELAGKRMTGYANWLSKRAQFHDMDVLARIVADIAAQQP 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV +TGDIVN   + EI  +  WL ++G P  +S  PGNHDAY+  A  +    +  + 
Sbjct: 61  DHVVMTGDIVNIGLDAEIEAARDWLMTLGGPEQVSFTPGNHDAYVRAAVARVAETFAPWT 120

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           +S+         FPYLR R  IALIG  +A+ T PF A+G  G  Q      LL +  ++
Sbjct: 121 SSEAGAG-----FPYLRRRGGIALIGLDSAVPTAPFVASGRLGSAQLGRLGALLEQTREE 175

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G  R++++HHPP    +     +     F+  I   GA+L+LHGH H  S+H +      
Sbjct: 176 GLARVVLLHHPPHQGGAKPLRGLDDAGAFEATIARHGAELVLHGHNHAISVHRLPGRDGS 235

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGK 284
            PVVG ASAS K  ++   A+YNL+ IE+      + G+
Sbjct: 236 TPVVGTASASAKPGAHYRAAAYNLYSIERGERGVVVTGR 274


>gi|323137673|ref|ZP_08072749.1| metallophosphoesterase [Methylocystis sp. ATCC 49242]
 gi|322396970|gb|EFX99495.1| metallophosphoesterase [Methylocystis sp. ATCC 49242]
          Length = 293

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/272 (36%), Positives = 148/272 (54%), Gaps = 6/272 (2%)

Query: 8   IMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + F+LAH+SD H+     P+  EL  KR+ G VNW + R       V + L+ D+     
Sbjct: 1   MTFLLAHLSDAHIGPIPRPNLAELLGKRVTGYVNWLYKRAGQHDMGVLSRLVEDMKAQKP 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV +TGDIVN     EI  +  WL S+G P ++S  PGNHDAY++ A +     +  + 
Sbjct: 61  DHVLMTGDIVNIGLPAEIALARDWLASLGGPEEVSYTPGNHDAYVADATQLVHEVFAPWT 120

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             +T  +     FPYLR R  +ALIG  + + T PF A+G  G+EQ  A   LL +   +
Sbjct: 121 AGETAAAG----FPYLRRRGGVALIGLDSGVPTGPFIASGRLGEEQLSALGALLEQTKTE 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G  R++ +HHPP +  + +   +     F+ +I   GA+L+LHGH H  SL  I      
Sbjct: 177 GLARVVFLHHPPHVGGARILRGLDDAAAFEDVIARHGAELVLHGHNHKPSLAHIAGPLAA 236

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE 277
            PVVG+ASAS +   + P A+YNL+ I ++ +
Sbjct: 237 APVVGVASASARPGGHYPAAAYNLYSIGREGD 268


>gi|316935907|ref|YP_004110889.1| metallophosphoesterase [Rhodopseudomonas palustris DX-1]
 gi|315603621|gb|ADU46156.1| metallophosphoesterase [Rhodopseudomonas palustris DX-1]
          Length = 293

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 150/276 (54%), Gaps = 8/276 (2%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           +F LAH+SD HL   P      L+ KR +G +NW  NR +   +++ + L+ D+     D
Sbjct: 3   VFTLAHLSDPHLPLPPKTGLRHLASKRALGYLNWRRNRHQIHRRDILDRLVADLQAQQPD 62

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD++N     E   +  WL S+G    +S+VPGNHDAY+     +    + DYI+
Sbjct: 63  HIAVTGDLMNIALLNEFAPARQWLESVGPADRVSLVPGNHDAYVRSTAHRFAETFPDYIS 122

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D         FPYLR R  IA+IG S+A+ T P  A G+ G  Q  A   LL+  + + 
Sbjct: 123 GDDAVPG----FPYLRRREGIAIIGVSSAVPTAPLRATGWLGAAQRAALETLLQSLSGER 178

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            F+++++HHP  L + S + R+        ++     DL+LHGH H+++   I+     I
Sbjct: 179 VFKVLLIHHP--LQSRSRHKRLTDSAELIALLQRHPVDLVLHGHDHVHATVRIETPSGAI 236

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           PVVG+ SAS     ++P A+YNLF I + N+ W  E
Sbjct: 237 PVVGVPSASAMNDRHRPSAAYNLFKISEGNDGWRCE 272


>gi|158422516|ref|YP_001523808.1| putative phosphohydrolase [Azorhizobium caulinodans ORS 571]
 gi|158329405|dbj|BAF86890.1| putative phosphohydrolase [Azorhizobium caulinodans ORS 571]
          Length = 322

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 149/286 (52%), Gaps = 8/286 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MFVLAH+SD HL   P     EL  KR  G++NW   R++ F       L+ D+     D
Sbjct: 22  MFVLAHLSDPHLGPIPEARLSELLGKRFFGMMNWIGARRRNFGASTLAPLMADLAAQAPD 81

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN +   E  T   +L S+G P  +S++PGNHDAY+  A    L  W  ++ 
Sbjct: 82  HIAVTGDLVNVSLPAEFDTGATFLASLGTPDKVSVIPGNHDAYVRSAMTYHLERWAPFLA 141

Query: 127 SDTT---CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D T        + FPY+R R  IA++G STAI T  F A+G  G+ Q      LLR+  
Sbjct: 142 GDETHPGTPVDTEAFPYVRRRGPIAIVGVSTAIPTAVFLASGKAGKAQLERLRALLRQLK 201

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++++HHPPV +  S +  +      +  +   GA+L+LHGH H  SL  I+   
Sbjct: 202 AEGLFRVVLIHHPPVGERHS-HRDLRDAPAVRAALVEAGAELVLHGHDHRASLGHIEGVA 260

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT--LEGKRYT 287
             IPVVG+ SAS      +    YNL+ I      W   +E + Y 
Sbjct: 261 PPIPVVGVPSASAGPEDGRGAGRYNLYRISGGPGAWVCDMESRGYA 306


>gi|39937451|ref|NP_949727.1| metallophosphoesterase [Rhodopseudomonas palustris CGA009]
 gi|39651310|emb|CAE29832.1| Metallo-phosphoesterase [Rhodopseudomonas palustris CGA009]
          Length = 293

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 147/275 (53%), Gaps = 8/275 (2%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P  S   L+ KR +G +NW  NR     +++ + L+ D+     DH
Sbjct: 4   FTLAHLSDPHLPLPPKTSLRHLASKRALGYLNWRRNRHLIHRRDILDTLVADLQAQQPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL S+G    +S+VPGNHDAY+     +    + DYI+ 
Sbjct: 64  IAVTGDLVNIALVNEFAPARQWLESVGPADRVSLVPGNHDAYVRSTAHRFAETFPDYISG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FPYLR R  IA+IG S+A+ T P  A G+ G  Q  A   LL+    +  
Sbjct: 124 DDATPG----FPYLRRREAIAIIGVSSAVPTAPLRATGWLGAPQRAALEALLQSLAGERV 179

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           F+++++HHP  L + S + R+        ++     DL+LHGH H+++   I      IP
Sbjct: 180 FKVLLIHHP--LQSRSRHKRLTDAADLIALLQRHPVDLVLHGHDHVHATVRIDTPFGAIP 237

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           VVG+ SAS     ++P A+YNLF I + N+ W  E
Sbjct: 238 VVGVPSASAMNDRHRPSAAYNLFKISEGNDGWRCE 272


>gi|115523419|ref|YP_780330.1| metallophosphoesterase [Rhodopseudomonas palustris BisA53]
 gi|115517366|gb|ABJ05350.1| metallophosphoesterase [Rhodopseudomonas palustris BisA53]
          Length = 299

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 95/272 (34%), Positives = 148/272 (54%), Gaps = 5/272 (1%)

Query: 10  FVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD+HL   P+    EL+ KR++G +NW  NR     +EV + L+ D+L    D 
Sbjct: 4   FTLAHLSDVHLPPLPAVRPLELANKRVLGYLNWKKNRHTIHRREVLDSLVADMLAQAPDQ 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN    +E      WL S+G P  +++VPGNHDAY+   + +       ++  
Sbjct: 64  IAVTGDLVNLALEQEFSPVAAWLDSVGPPDRVTVVPGNHDAYVRSTQHRFAETLHPFLRG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FP+LR R  +ALIG S+A+ T P  A G  G+ Q  A  +LL +   +  
Sbjct: 124 D-DAGEGVVRFPFLRRRGPLALIGLSSAVPTAPLMAVGRLGEAQLAALEQLLAQLAGEDS 182

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L + S    +        ++   G  L+LHGH H+++  W++     IP
Sbjct: 183 FRVLLVHHP--LTSRSRQKWLADAPELLALLRRCGVHLVLHGHDHVHATVWVEGPTAPIP 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYW 279
           V+G+ SAS     + P A YNLF + + N+ W
Sbjct: 241 VIGVPSASAMASGHHPGAGYNLFSVHRDNDAW 272


>gi|85714290|ref|ZP_01045278.1| metallophosphoesterase [Nitrobacter sp. Nb-311A]
 gi|85698737|gb|EAQ36606.1| metallophosphoesterase [Nitrobacter sp. Nb-311A]
          Length = 301

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 94/275 (34%), Positives = 146/275 (53%), Gaps = 5/275 (1%)

Query: 10  FVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
             LAH+SD HL   P     +L+ KR IG +NW   R     ++V + L+ DI   + DH
Sbjct: 4   LTLAHLSDPHLGPLPPLRLHQLAGKRAIGYLNWKRGRHAIHRRDVLDTLVADIKAQSPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD++N     E   +  WL  +G PH++++VPGNHDAY+    +K +  W+DY+  
Sbjct: 64  IAVTGDLINLALPGEFTQARAWLGDVGTPHNVTLVPGNHDAYVR-PTQKQISEWEDYMRG 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D+        FP+LR R  + LIG S+++ T PF A G+ G  Q  A  + L +      
Sbjct: 123 DSAREGAPLSFPFLRRRGPLTLIGVSSSVPTGPFMATGWLGSSQLDALDRGLAQLESDPS 182

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           F ++++HHP  L +   + R+        ++     +LILHGH H++S  W + +   IP
Sbjct: 183 FHVLLIHHP--LSSKDSHKRLTDADALLALLKRRNVNLILHGHDHIHSTMWFEGQHGRIP 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
            +G+ SAS   H + P A+YNLF I      W  E
Sbjct: 241 AIGVPSASATPHRHYPPAAYNLFSITHDGSSWRCE 275


>gi|217978415|ref|YP_002362562.1| metallophosphoesterase [Methylocella silvestris BL2]
 gi|217503791|gb|ACK51200.1| metallophosphoesterase [Methylocella silvestris BL2]
          Length = 300

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 151/270 (55%), Gaps = 10/270 (3%)

Query: 8   IMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANL--LINDILLH 63
           ++F LAH++D H+     P   EL  KR+ G +NW   R ++   ++A L  ++ D+   
Sbjct: 4   VLFRLAHLTDPHIGPLPRPRRRELLGKRVTGYLNW--RRGRHLVHDMATLSHIVADVKAQ 61

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
           N DH+++TGDI N     E   +  WL ++G   D+S VPGNHDAY+ G+      A+  
Sbjct: 62  NPDHIAMTGDIANIGLPAEFQLARKWLETLGPSEDVSFVPGNHDAYVRGSLPDLARAFAP 121

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           + T +T        +PYLR+R N+ALIG S+A+ TP F A+G  G+ Q      +L    
Sbjct: 122 WTTGETETPA---RYPYLRVRGNVALIGLSSAVPTPFFIASGRLGRRQLEWADAMLADCA 178

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI-KNE 242
            +   R++M+HHPP +D + L   +   + F++MIW  GA+LILHGH H  S+ ++    
Sbjct: 179 TRDLIRVVMLHHPPQVDAAGLARGLIDAREFEEMIWRRGAELILHGHNHKTSVTYLDAGR 238

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYI 272
            +  PVVG  SAS    + + +A Y++F I
Sbjct: 239 SRKTPVVGAPSASSARLAARHRAGYHVFEI 268


>gi|298292489|ref|YP_003694428.1| metallophosphoesterase [Starkeya novella DSM 506]
 gi|296929000|gb|ADH89809.1| metallophosphoesterase [Starkeya novella DSM 506]
          Length = 308

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 103/287 (35%), Positives = 160/287 (55%), Gaps = 10/287 (3%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MFVLAH++D HL   P   F EL+ KR +G++NW   R+  F+    +LL+ DI     D
Sbjct: 1   MFVLAHVTDAHLGPLPRARFAELAGKRALGVINWRRGRQHRFNIATIDLLVADIKAMAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     E  T  ++LRS+G+ HD+++VPGNHDAY+      SL  W DY+ 
Sbjct: 61  HIAVTGDLVNVGLAAEFATGLNFLRSLGDGHDVTVVPGNHDAYVRSTAHHSLLNWGDYMR 120

Query: 127 SDTTCS--TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
            D      T ++ FP++R R+ +ALIG STA+ T PF A G  G+ Q     K+L +   
Sbjct: 121 GDGVNGDVTAEEAFPFVRRRDGVALIGVSTAVPTHPFMATGKVGKAQRARLGKVLDELAA 180

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE-K 243
           +G FR++M+HHPP     + + R+   +  +++    GA+LI+ GH H+  +  +     
Sbjct: 181 EGLFRVVMIHHPPC-GWRAGHKRLIDEEAVREVFARHGAELIICGHDHVPMVEMLPGPHS 239

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYW----TLEGKRY 286
            LIPVV   S +           Y+L+ IE+ +  +    TLE + +
Sbjct: 240 GLIPVVEAPSFAAGPDDRHWPGGYHLYRIERIDAAFPWRCTLEARGF 286


>gi|300023904|ref|YP_003756515.1| metallophosphoesterase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525725|gb|ADJ24194.1| metallophosphoesterase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 301

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 95/267 (35%), Positives = 151/267 (56%), Gaps = 7/267 (2%)

Query: 7   TIMFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           T  F LAH SD+H+S    F     + KR++G +NW   R++     VA+ LI D     
Sbjct: 2   TETFTLAHFSDVHMSPVVGFGWRYWNAKRVLGYLNWQRKRRRVHVTAVADRLIADAHSLR 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH++ITGD+VN     E   +  WLRS+G+P  +++VPGNHD Y S   ++ +  W  Y
Sbjct: 62  PDHIAITGDLVNLGLPAEHEAALAWLRSVGSPASVTVVPGNHDIYSSMHGDRGVVRWAAY 121

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
           +  +         FP++R    +AL+G ++A+ TPPF A+G  G  Q     + L + ++
Sbjct: 122 MGGEEDTLA----FPFVRRVGPLALVGLNSAVETPPFFASGSLGSHQLEIAREQLLRLDE 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
            G  R++++HHPP+ D ++   R+     F  ++   GA+L+L+GH H  ++ W+ + KK
Sbjct: 178 DGAIRVVLIHHPPLADMTTPRRRLNDAAHFAHLLERTGAELVLYGHNHTPAIDWLPSRKK 237

Query: 245 LIPVVGIASASQKV-HSNKPQASYNLF 270
            IP++G ASAS    H ++P A YNLF
Sbjct: 238 PIPLIGAASASAGTEHGDEPLARYNLF 264


>gi|118581152|ref|YP_902402.1| metallophosphoesterase [Pelobacter propionicus DSM 2379]
 gi|118503862|gb|ABL00345.1| metallophosphoesterase [Pelobacter propionicus DSM 2379]
          Length = 332

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 153/280 (54%), Gaps = 16/280 (5%)

Query: 10  FVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           FVLAH+SD HLS  P     +L  KR++G  +W+  R+      V + L+ND+     DH
Sbjct: 27  FVLAHLSDPHLSPLPGVHPRDLLNKRLLGYFSWYRRRRHIHCPHVLDALLNDLAQAAPDH 86

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V+ITGD+ N     E   +  WL  +G+P  + +VPGNH+ Y++    ++   W DY+  
Sbjct: 87  VAITGDLTNLGLPDEFRQAARWLERVGSPARVMVVPGNHECYVAAPWRETFGRWADYLAG 146

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D   + G  ++P LR+R  +ALIG STA  + PF A G  G+EQ      LL +  ++G 
Sbjct: 147 DGAVADG--VYPRLRVRGGVALIGLSTARPSLPFMAVGSLGKEQLDRLEDLLEQTGRRGL 204

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL-- 245
            R++++HHPPV  + +   R+     F  +I  +GA+LILHGH H      +  E++L  
Sbjct: 205 LRVVLLHHPPVPGSIAWRKRLTDASGFAAVIGRQGAELILHGHAH------VSMERELVA 258

Query: 246 --IPVVGIASASQKVHSNKP--QASYNLFYIEKKNEYWTL 281
             +PV G++S+S     + P   ASY L+   ++ + W +
Sbjct: 259 GTVPVFGVSSSSSSSSQSAPLRTASYTLYRFRRRGDVWEV 298


>gi|261883775|ref|ZP_06007814.1| metallophosphoesterase [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 213

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 89/213 (41%), Positives = 132/213 (61%), Gaps = 4/213 (1%)

Query: 18  IHLSYSPSFF---ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           + L+ +P      EL+ KRI G +NW  +RK      V + LI D+L    DH+++TGD+
Sbjct: 1   MRLTLTPGILVESELASKRITGYINWLRSRKSAMHGTVLDSLIADMLAQTPDHIAVTGDL 60

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
           VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++      + G
Sbjct: 61  VNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMRGAGVDNKG 120

Query: 135 KK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMM 193
           ++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L KA  +G FR++M+
Sbjct: 121 RRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDKAGARGLFRVVMI 180

Query: 194 HHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLI 226
           HHPPV   +S + R++GI+RFQK+I    A+L+
Sbjct: 181 HHPPVHGATSAHKRLYGIRRFQKIIREHEAELV 213


>gi|182680342|ref|YP_001834488.1| metallophosphoesterase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182636225|gb|ACB96999.1| metallophosphoesterase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 306

 Score =  185 bits (470), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 103/299 (34%), Positives = 154/299 (51%), Gaps = 12/299 (4%)

Query: 8   IMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + F+LAH+SD H+     P   EL  KR+ G +NW   R      E    L+ D+  H+ 
Sbjct: 1   MTFLLAHLSDPHIGPLPVPRRRELLGKRLTGYLNWQRGRSTAHDMETLGRLVADLKSHHP 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGDI+N     E      WL S+G P ++S VPGNHDAY+ GA       +K + 
Sbjct: 61  DHIAVTGDILNLGLAAEFPLGRLWLESLGQPENVSFVPGNHDAYVRGALPDLARTFKPWT 120

Query: 126 TSDTTC--------STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSK 177
             +           S    L+PYLR R  +ALIG ++ +  PPF A+G  G++Q      
Sbjct: 121 AGEHPLGESLPFGQSMATALYPYLRRRGPVALIGLASGVPMPPFIASGRLGRQQLAGAET 180

Query: 178 LLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH 237
           LL++A  +   R+IM+HHPP  +       +   + F +MI   GA+LILHGH H  S+ 
Sbjct: 181 LLKEAAAQNCIRVIMLHHPPWAE-GKFGRGLVDARPFAEMIGRVGAELILHGHEHRPSVT 239

Query: 238 WIKNEK-KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           ++   K + +P+VG+ SAS    S    A+Y+LF IE       ++   + L  D  +I
Sbjct: 240 YLTGPKGRRVPIVGVPSASLVRGSPYRYAAYHLFAIEGTGAEPRIKASAWGLLADGKTI 298


>gi|299134628|ref|ZP_07027820.1| metallophosphoesterase [Afipia sp. 1NLS2]
 gi|298590438|gb|EFI50641.1| metallophosphoesterase [Afipia sp. 1NLS2]
          Length = 298

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 141/270 (52%), Gaps = 5/270 (1%)

Query: 10  FVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P     EL  KR IG  NW   R     ++V   L+ D+   N DH
Sbjct: 4   FTLAHLSDPHLGPMPPARLTELLGKRAIGYANWKRRRHMIHRRDVLAQLLADLHAQNPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL SIG+ HD+S+VPGNHDAY   A+ +   +W DY+  
Sbjct: 64  IAVTGDLVNVALPAEFTQARAWLESIGSVHDVSLVPGNHDAYARVARGQFALSWADYMRG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FPYLR R  +ALIG +TA+ + PF A G  G+ Q  A   LL K   +  
Sbjct: 124 DDATEVG---FPYLRRRGPLALIGLTTAVPSAPFMATGRIGRAQLAALDSLLIKLKNEPL 180

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++++HHP          R+        ++   G DL+LHGH H ++  W++ ++    
Sbjct: 181 CRVVLVHHPLRSARGRWSARLTDAPALIDILTRHGVDLVLHGHDHRHATVWLQGQRGRFA 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNE 277
            +G+ SAS     +   A+Y L  I +K++
Sbjct: 241 SIGVPSASASFGGHHQPAAYQLISIARKDD 270


>gi|209886135|ref|YP_002289992.1| metallophosphoesterase [Oligotropha carboxidovorans OM5]
 gi|209874331|gb|ACI94127.1| metallophosphoesterase [Oligotropha carboxidovorans OM5]
          Length = 300

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 146/291 (50%), Gaps = 10/291 (3%)

Query: 10  FVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P     EL  KR+IG  NW   R     ++V +LL+ D+     DH
Sbjct: 4   FTLAHLSDPHLGPMPPARLIELFGKRVIGYTNWKRRRHAIHRRDVLSLLLADLHAQRPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL ++G+  D+S+VPGNHDAY   A+ +   +W DY+  
Sbjct: 64  IAVTGDLVNVALPAEFTQARAWLETVGSAQDVSLVPGNHDAYARAARGQFALSWADYMRG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FPYLR R  +ALIG +TA+ + PF A G  G+ Q     +LL +   +  
Sbjct: 124 DGETEVH---FPYLRRRGPLALIGLTTAVPSAPFMATGRIGRAQLAGLDRLLARIATEPL 180

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++++HHP          R+        ++   G +L+LHGH H ++  W K  +    
Sbjct: 181 CRVVLIHHPLRSAPGRWSARLTDAPALIALLERHGVNLVLHGHDHRHATVWFKGSRGRFA 240

Query: 248 VVGIASASQKVHSNKPQASYNLF-YIEKKNEYWTL----EGKRYTLSPDSL 293
            +G+ SAS     +   A+Y L  + E   + WT+     G     SPDS+
Sbjct: 241 SIGVPSASASTGGHHQAAAYQLISFEEDAAKGWTISRRVRGFGSDASPDSI 291


>gi|192293234|ref|YP_001993839.1| metallophosphoesterase [Rhodopseudomonas palustris TIE-1]
 gi|192286983|gb|ACF03364.1| metallophosphoesterase [Rhodopseudomonas palustris TIE-1]
          Length = 293

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 148/275 (53%), Gaps = 8/275 (2%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P  S   L+ KR +G +NW  NR     +++ + L+ D+     DH
Sbjct: 4   FTLAHLSDPHLPLPPKTSLRHLASKRALGYLNWRRNRHLIHRRDILDTLVADLQAQQPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL S+G    +S+VPGNHDAY+     +    + DYI+ 
Sbjct: 64  IAVTGDLVNIALVNEFAPARQWLESVGPADRVSLVPGNHDAYVRSTAHRFAETFPDYISG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FPYLR R  IA+IG S+A+ T P  A G+ G  Q  A   LL+    +  
Sbjct: 124 DDATPG----FPYLRRRETIAIIGVSSAVPTAPLRATGWLGALQLAALEALLQSLAGERV 179

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           F+++++HHP  L + S + R+        ++     DL+LHGH H+++   I+     IP
Sbjct: 180 FKVLLIHHP--LQSRSRHKRLTDAADLIALLQRHPVDLVLHGHDHVHATVRIETPFGTIP 237

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           VVG+ SAS     ++P A+Y+LF I + N+ W  E
Sbjct: 238 VVGVPSASAMNDRHRPSAAYSLFKISEGNDGWRCE 272


>gi|170747325|ref|YP_001753585.1| metallophosphoesterase [Methylobacterium radiotolerans JCM 2831]
 gi|170653847|gb|ACB22902.1| metallophosphoesterase [Methylobacterium radiotolerans JCM 2831]
          Length = 307

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 107/290 (36%), Positives = 148/290 (51%), Gaps = 12/290 (4%)

Query: 8   IMFVLAHISDIHLS--YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + F LAH+SD H+         +L  KR  G  NW   R +     V   L+ D+     
Sbjct: 1   MTFRLAHLSDPHVGPLGRVRLRQLIGKRATGYANWRRGRSRSHDMTVLEALVTDLKAQGA 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
            HV+ TGD+ N     E  T+  +L ++G+P  +S VPGNHDAY+ G+ E  L A   Y 
Sbjct: 61  GHVACTGDLCNIGLPSEWETARTFLEALGSPEAVSFVPGNHDAYVRGSLEGLLAACGRY- 119

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK-ANK 184
           T D + S G   FPYLR R  +AL+G S+AI T PF A G  G  Q  A   LLR  A +
Sbjct: 120 TGDDSGSWGH--FPYLRRRGPLALVGLSSAIPTKPFVATGRLGASQLAAAETLLRALATE 177

Query: 185 KGF-FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN-E 242
            G  FR++M+HHPP    +S    +     F  M+   GADLILHGH H+ S   I   +
Sbjct: 178 PGRPFRVVMIHHPPQPGGASPGRELKDAAAFTAMVGRAGADLILHGHNHVTSTARIAGPD 237

Query: 243 KKLIPVVGIASASQKVHSNKP----QASYNLFYIEKKNEYWTLEGKRYTL 288
            + +PV+G  SAS +   +      +ASY LF I +  + + +  +R  L
Sbjct: 238 GRTVPVIGAPSASARPDGHGAIASRRASYLLFEIGRAEQGYAVTARRRGL 287


>gi|301058950|ref|ZP_07199919.1| Ser/Thr phosphatase family protein [delta proteobacterium NaphS2]
 gi|300446946|gb|EFK10742.1| Ser/Thr phosphatase family protein [delta proteobacterium NaphS2]
          Length = 350

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 149/291 (51%), Gaps = 8/291 (2%)

Query: 10  FVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           FVLAH+SD H++++      +L  KR+ G + W F R     +E+  +L  D+     DH
Sbjct: 28  FVLAHLSDPHMAWAGPVKKRDLLNKRLAGYLKWRFFRNTEHRREILTILKEDLDNTRPDH 87

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           + ITGD+ +     E   +  WL+S+G P  +++VPGNHDAY+    +++   W DY+ S
Sbjct: 88  IVITGDLTHLGLPAEFKKARTWLQSLGTPSQVTVVPGNHDAYVRSDWDRTFACWLDYMRS 147

Query: 128 DTTCSTGKK------LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
           D  C  G +      LFP LR+R  IALIG  +A  + P  A G  G  Q      +L++
Sbjct: 148 DPPCRNGGRVRGLDDLFPTLRVRGRIALIGLCSAHPSAPHLAIGTVGGPQLRKLETVLKQ 207

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
              +G FRI+ +HHPP+    S   R+      + ++   GA+L+LHGH H  +L+ +  
Sbjct: 208 TGDRGLFRIVAIHHPPLSGIVSRRKRLTDAHALRGVVARCGAELMLHGHAHRMALNTLDT 267

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
                PV G  SAS     ++ +A Y++F +        +   R   SPD+
Sbjct: 268 RSGRTPVAGAPSASSSSSDHQRRARYHVFTLTASENACNVHMGRRVYSPDA 318


>gi|188582396|ref|YP_001925841.1| metallophosphoesterase [Methylobacterium populi BJ001]
 gi|179345894|gb|ACB81306.1| metallophosphoesterase [Methylobacterium populi BJ001]
          Length = 316

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 145/278 (52%), Gaps = 8/278 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   R  +   ++   LI D+     D
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRCHHHDMDLLGALIADLHGQGAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARLFLEALGPGERVSFVPGNHDAYVRGSLEGLLAACGGWTA 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR--KANK 184
           +D   S   +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  +LLR   A  
Sbjct: 121 ADDGQS---RLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGSVQIDAAERLLRDLAAAP 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI-KNEK 243
               R++M+HHPP    ++    +     F  MI   GADLILHGH H+ S+  I   + 
Sbjct: 178 DRPCRVVMIHHPPHPGGAAAGRELKDAADFAAMIGRAGADLILHGHNHVGSVAQILGPDG 237

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
           + +PVVG  SAS +      +ASY L+ +   +  + +
Sbjct: 238 RPVPVVGAPSASARTLLTNRRASYYLYTVTPHDSGYRI 275


>gi|85703077|ref|ZP_01034181.1| hypothetical protein ROS217_20087 [Roseovarius sp. 217]
 gi|85672005|gb|EAQ26862.1| hypothetical protein ROS217_20087 [Roseovarius sp. 217]
          Length = 319

 Score =  172 bits (437), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 148/282 (52%), Gaps = 9/282 (3%)

Query: 6   TTIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           T     LAH+SD HL  +    +  +  KR + L++WH  R+ +   E+   LI D+  H
Sbjct: 11  TGAGITLAHLSDPHLPLTGPVPWRAVLNKRALSLLSWHRKRRHHHRPEILAALIADMQRH 70

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +++TGD+ N     E   +  WL S+GNP  + ++PGNHDA I GA E     W  
Sbjct: 71  APDLIAVTGDLTNLGLESEYRAARRWLESLGNPARVMVIPGNHDALIRGAWEAGAAQWHP 130

Query: 124 YITSDTTCSTG--KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
           Y   D   +T      FPY+R R  +ALIG S+A+ATPP  A+G  G  Q    + LLR 
Sbjct: 131 YWQGDAAPATAHVSDAFPYMRRRGMLALIGVSSAVATPPAFASGAVGPAQLARLAHLLRA 190

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
           A  +G  R++M+HHPP+  T S    +      ++++  EG +L+LHGH+H      +  
Sbjct: 191 ARDEGLCRVMMIHHPPLDGTVSARKALRDGAALRRVLQAEGVELVLHGHSHRTHHQTLAT 250

Query: 242 EKKLIPVVGIASASQKVHSNKPQ-ASYNLFYIEKKNEYWTLE 282
                 V+G+ SAS    S  P+ A+Y+L+++   +  W ++
Sbjct: 251 RDGAAAVIGVPSAS----SLSPEAAAYHLYHLTPMSGGWVID 288


>gi|170744851|ref|YP_001773506.1| metallophosphoesterase [Methylobacterium sp. 4-46]
 gi|168199125|gb|ACA21072.1| metallophosphoesterase [Methylobacterium sp. 4-46]
          Length = 298

 Score =  172 bits (435), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 147/288 (51%), Gaps = 8/288 (2%)

Query: 9   MFVLAHISDIHLS--YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   RK      V   L+ D+     D
Sbjct: 1   MFRLAHLTDPHVGPLSRPRLRQLLSKRATGWVNWSRGRKLTHDMAVLEALVADLRAAAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ TGD+ N     E  T+  +L ++G P  +S VPGNHDAY+ G+ +  L A   +  
Sbjct: 61  HIACTGDLCNIGLPSEWETARMFLEALGGPEAVSFVPGNHDAYVRGSLDGLLDAVGPWTR 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK-- 184
            D   + G++ FPYLR R  +AL+G S+AI T PF A+G  G  Q  A   LL    +  
Sbjct: 121 DD---AGGERAFPYLRRRGPLALVGLSSAIPTAPFVASGRLGTRQIAAAEALLGSLAREP 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHW-IKNEK 243
           +   R++M+HHPP +  +     +      + MI   GADL+LHGH H+ S+ + I  + 
Sbjct: 178 EAPCRVVMIHHPPHVGGALPGRNLTDASAVEAMIRRVGADLVLHGHNHVGSVAFVIGPDG 237

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
           + +PV+G  SAS +  +    A Y+L+   +    + +      L PD
Sbjct: 238 RRVPVIGAPSASARGGALSHCAGYHLYEFARTATGYAVTATLRGLLPD 285


>gi|197105520|ref|YP_002130897.1| hypothetical protein PHZ_c2057 [Phenylobacterium zucineum HLK1]
 gi|196478940|gb|ACG78468.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 303

 Score =  172 bits (435), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 86/270 (31%), Positives = 143/270 (52%), Gaps = 9/270 (3%)

Query: 10  FVLAHISDIHL---SYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           F LAH+SD HL   + +    +++ KR +  + W   R ++ S  V + LI D+     D
Sbjct: 4   FRLAHLSDPHLPPPARALRLADMASKRALSRLAWRRKRHRH-SPAVLDALIADLRRCAPD 62

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+ NF  + E   +  WLR++G+P  +++ PGNHDA ++         W  ++ 
Sbjct: 63  HIAITGDLTNFATHEEFAAAAEWLRTLGDPASVTVSPGNHDALVAHRTPDRFAPWAPWLG 122

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                 T +  FP++R+R  +A++   TA+ T    A G  GQ+Q       LR+A  +G
Sbjct: 123 D-----TPQADFPHVRVRGCVAIVNACTAVPTAWRLAQGALGQDQIARLEAALRRAKAEG 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            +RI+++HHPP     S    +    RF+ ++   GA+L+LHGH H   LH I   +  I
Sbjct: 178 LYRIVLLHHPPAEGAVSARKALTDAGRFRAVLEAVGAELVLHGHAHDALLHRIPGPQGAI 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           PV+G+ SAS     + P A + L  + +++
Sbjct: 238 PVLGVPSASAPPGGHDPAAQWRLIEVTRRS 267


>gi|254562136|ref|YP_003069231.1| metallophosphatase/metallophosphoesterase [Methylobacterium
           extorquens DM4]
 gi|254269414|emb|CAX25380.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens DM4]
          Length = 315

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 99/270 (36%), Positives = 144/270 (53%), Gaps = 10/270 (3%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   R ++   ++   LI D+    VD
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQGVD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 120

Query: 127 SDTTCSTGK-KLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR--KAN 183
           +D     G+ +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR     
Sbjct: 121 AD----DGQIRLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPAQIEAAERVLRDLATA 176

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN-E 242
                R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I   +
Sbjct: 177 PDRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGPD 236

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYI 272
            + +PVVG  SAS +      +ASY L+ +
Sbjct: 237 GRPVPVVGAPSASARTLLTNRRASYYLYTV 266


>gi|240139723|ref|YP_002964200.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens AM1]
 gi|240009697|gb|ACS40923.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens AM1]
          Length = 315

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 99/270 (36%), Positives = 144/270 (53%), Gaps = 10/270 (3%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   R ++   ++   LI D+    VD
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQGVD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 120

Query: 127 SDTTCSTGK-KLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR--KAN 183
           +D     G+ +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR     
Sbjct: 121 AD----DGQIRLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPVQIEAAERMLRDLATA 176

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN-E 242
                R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I   +
Sbjct: 177 PDRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGPD 236

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYI 272
            + +PVVG  SAS +      +ASY L+ +
Sbjct: 237 GRPVPVVGAPSASARTLLTNRRASYYLYTV 266


>gi|163852389|ref|YP_001640432.1| metallophosphoesterase [Methylobacterium extorquens PA1]
 gi|163663994|gb|ABY31361.1| metallophosphoesterase [Methylobacterium extorquens PA1]
          Length = 331

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 99/270 (36%), Positives = 144/270 (53%), Gaps = 10/270 (3%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   R ++   ++   LI D+    VD
Sbjct: 17  MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQGVD 76

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 77  HVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 136

Query: 127 SDTTCSTGK-KLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR--KAN 183
           +D     G+ +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR     
Sbjct: 137 AD----DGQIRLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPVQIEAAERVLRDLATA 192

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN-E 242
                R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I   +
Sbjct: 193 PDRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGPD 252

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYI 272
            + +PVVG  SAS +      +ASY L+ +
Sbjct: 253 GRPVPVVGAPSASARTLLTNRRASYYLYTV 282


>gi|218531148|ref|YP_002421964.1| metallophosphoesterase [Methylobacterium chloromethanicum CM4]
 gi|218523451|gb|ACK84036.1| metallophosphoesterase [Methylobacterium chloromethanicum CM4]
          Length = 315

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 99/270 (36%), Positives = 144/270 (53%), Gaps = 10/270 (3%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   R ++   ++   LI D+    VD
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQGVD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 120

Query: 127 SDTTCSTGK-KLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR--KAN 183
           +D     G+ +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR     
Sbjct: 121 AD----DGQIRLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPVQIEAAERVLRDLATA 176

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN-E 242
                R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I   +
Sbjct: 177 PDRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGPD 236

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYI 272
            + +PVVG  SAS +      +ASY L+ +
Sbjct: 237 GRPVPVVGAPSASARTLLTNRRASYYLYTV 266


>gi|258593791|emb|CBE70132.1| putative metallo-phosphoesterase (modular protein) [NC10 bacterium
           'Dutch sediment']
          Length = 428

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 148/287 (51%), Gaps = 8/287 (2%)

Query: 4   RYTTIMFVLAHISDIHLS--YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL 61
           R    +F +AH+SD+HL+     +  +L  KR +G ++W   R+      + + L +D+ 
Sbjct: 94  RLMNGVFRVAHLSDLHLTSLVDVTIRDLLNKRALGYLSWRLRRRHEHVPAILDALRHDLS 153

Query: 62  LHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAW 121
               DH+ ITGD+ +     E   +  WL ++G P D++I+PGNHDAY+    + +   W
Sbjct: 154 GLTPDHIVITGDLTHIGLPSEFQQAQQWLETLGAPTDVTIIPGNHDAYVRAPWDDTFALW 213

Query: 122 KDYITSDTTCSTG------KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHAT 175
             Y+TSD    TG      +  FP +R+R ++ LIG ++A  + PF A G  G  Q    
Sbjct: 214 TPYMTSDPGSQTGGQQAPGESFFPSVRVRGHVVLIGATSARPSAPFFATGSLGTAQMARL 273

Query: 176 SKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNS 235
             LL    ++G FRI+++HHPP+        R+        ++   G ++I+HGH H + 
Sbjct: 274 GDLLDLTRRQGLFRILLIHHPPLAAIVQWRKRLTDGAALISLLARHGVEMIIHGHAHRSY 333

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           +  I +    + V+G+ SAS +  + + +A+Y+++ +   +  W + 
Sbjct: 334 VGHIPSAHGEMSVIGVPSASARGANPERRAAYHVYEVRPLSHGWEVR 380


>gi|220927299|ref|YP_002502601.1| metallophosphoesterase [Methylobacterium nodulans ORS 2060]
 gi|219951906|gb|ACL62298.1| metallophosphoesterase [Methylobacterium nodulans ORS 2060]
          Length = 298

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 101/290 (34%), Positives = 150/290 (51%), Gaps = 12/290 (4%)

Query: 9   MFVLAHISDIHLS--YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   R +     V   LI D+L    D
Sbjct: 1   MFRLAHLTDPHVGPLSKPRLRQLLSKRATGWVNWTRGRHRTHDMAVLEALIADLLAAAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ TGD+ N     E  T+  +L ++G P  +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HIACTGDLCNIGLPSEWETARVFLEALGGPEAVSFVPGNHDAYVRGSLEGLLGAVGPWTR 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL----RKA 182
            D   +  ++ FPYLR R  +AL+G S+AI T PF A+G  G  Q  A   LL    R+ 
Sbjct: 121 DD---AGRERAFPYLRRRGPLALVGLSSAIPTAPFVASGRLGSRQLAAAEALLGSLAREP 177

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHW-IKN 241
            +    R++M+HHPP +  +     +     F+ +I   GADL+LHGH H+ S+ + I  
Sbjct: 178 ERP--CRVVMIHHPPHVGGALPGRNLTDSSAFEAVIRRVGADLVLHGHNHVGSVAFLIGP 235

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
           + + +PV+G  SAS +  +    A Y+L+  E+    + +      L PD
Sbjct: 236 DGRRVPVIGAPSASARGGTLTHCAGYHLYGFERTATGYAVTATLRGLLPD 285


>gi|296115282|ref|ZP_06833922.1| putative metallophosphoesterase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978185|gb|EFG84923.1| putative metallophosphoesterase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 303

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 149/286 (52%), Gaps = 14/286 (4%)

Query: 10  FVLAHISDIHLSYSP---SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
            ++AH SD HL+         +L  KR++  ++W   R+ + +  +  ++  DI  HNVD
Sbjct: 4   ILIAHASDPHLAIDTLRIRAGDLLNKRVLSYLSWQRRRRIHRTAALQRVM-EDIAAHNVD 62

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            +++TGD+ N     E   +  WL  +  P  +++VPGNHDA +S     ++  W  ++ 
Sbjct: 63  MLALTGDLTNLGLPDECAQAERWLSRL--PMPVTVVPGNHDALVSSDWHATIGRWSPWM- 119

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                  G   FP++R    +ALIG ++A  TP F+A+G  G  QA   + +L +  ++G
Sbjct: 120 -------GPLPFPFVRRVGPVALIGLNSAHPTPCFNASGDIGAHQAARLAAVLEETGQQG 172

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
             R+IM+HHPP+   +S    +    RF   I   GA+L+LHGHTH+++L  +      +
Sbjct: 173 LCRVIMIHHPPLAHLTSRRKSLRDAGRFGACIAQHGAELVLHGHTHVSTLATLPGRNGPV 232

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
           PV+G+ASAS         AS+NL ++      + +E  R  + PD 
Sbjct: 233 PVMGVASASTDTSDPARAASWNLVHVSSFMTGYRMEITRRIMLPDG 278


>gi|149202538|ref|ZP_01879510.1| metallophosphoesterase [Roseovarius sp. TM1035]
 gi|149143820|gb|EDM31854.1| metallophosphoesterase [Roseovarius sp. TM1035]
          Length = 319

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/282 (33%), Positives = 148/282 (52%), Gaps = 9/282 (3%)

Query: 6   TTIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           T     LAH+SD HL  +    +  +  KR + L++WH  R+ +   E+  +LI D+  H
Sbjct: 11  TGAGITLAHLSDPHLPLTGPVPWHSVLNKRALSLLSWHRKRRHHHRPEILAMLIADMRAH 70

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +++TGD+ N     E   +  WL ++G P  + ++PGNH+A I GA +     W  
Sbjct: 71  APDQIAVTGDLTNLGLESEYRAARRWLENLGRPERVMVIPGNHEALIRGAWDAGAAQWLP 130

Query: 124 YITSDTTCSTG--KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
           Y   D    T      FPY+R R  +ALIG S+A+ATPP  A+G  G  Q    + +LRK
Sbjct: 131 YWQGDAAPVTVDVSDAFPYMRRRGMLALIGVSSAVATPPAFASGAVGPAQLARLAPMLRK 190

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
           A   G  R++M+HHPP+  T S    +     F+ ++  EG +L+LHGH+H +    ++ 
Sbjct: 191 ARGAGLCRVLMIHHPPLDGTVSARKALRDAAAFRAVLQAEGVELVLHGHSHRHHHQTLET 250

Query: 242 EKKLIPVVGIASASQKVHSNKPQ-ASYNLFYIEKKNEYWTLE 282
                PV+G+ SAS    S  P+ A+Y+L+ I      W ++
Sbjct: 251 RDGPTPVIGVPSAS----SLYPEAAAYHLYQIRPTAAGWEID 288


>gi|23008783|ref|ZP_00050080.1| COG1409: Predicted phosphohydrolases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 265

 Score =  160 bits (405), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/238 (36%), Positives = 125/238 (52%), Gaps = 7/238 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   R ++   ++   L+ D+    VD
Sbjct: 6   MFRLAHLTDPHIGPLPRPRLRQLLSKRATGYVNWRRGRGRHHDMDLLGALVADLHGQGVD 65

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  T+  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 66  HVACTGDLCNLGLPDEWETARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 125

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR--KANK 184
            D   +   + FPYLR R  +AL+G S+AI T PF+A+G  G  Q  A  +LL    A  
Sbjct: 126 DDAGQA---RSFPYLRRRGPLALVGLSSAIPTKPFAASGRLGPAQIEAAERLLHGLGAEA 182

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
           +   R++M+HHPP    ++    +     F  MI   GADLILHGH H+ S+  I   
Sbjct: 183 ERPCRVVMIHHPPHPGGAAAGRELKDAANFSAMIGRAGADLILHGHNHVGSVGRIAGR 240


>gi|295690094|ref|YP_003593787.1| metallophosphoesterase [Caulobacter segnis ATCC 21756]
 gi|295431997|gb|ADG11169.1| metallophosphoesterase [Caulobacter segnis ATCC 21756]
          Length = 302

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 138/271 (50%), Gaps = 11/271 (4%)

Query: 9   MFVLAHISDIHLSYSPSFF---ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           ++ +AH+SD HL   P  F   ++  KR++  + W   RK +   EV + L+ D+     
Sbjct: 3   IYRIAHLSDPHLPPPPGAFGWKDVFTKRLLSRIAWRKKRKVH-RPEVLSALVADLKASAP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV I+GD+ NF  + EI  +  WL S+G P D ++ PGNHDA       +    W  ++
Sbjct: 62  DHVVISGDLTNFASHTEIAAARKWLESLGEPTDFTVSPGNHDALAGAGGPERFAIWAPWL 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D     G+  FP +R+R  +A+    +A+ T P  A G  G+EQ       L      
Sbjct: 122 GDD-----GESRFPQVRLRGPVAIFNLCSAVPTAPHLATGRLGEEQLRKLDAALADPAYD 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN-EKK 244
           GFF+++++HHPP     S    +      ++++   GADL+LHGH H   L  ++  +  
Sbjct: 177 GFFKLVVLHHPPHEGAVSKRKSLDDGHALREVLERRGADLVLHGHAHEALLGALRGPDGA 236

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKK 275
            +PV+G+ SAS + + + P A +N   IE +
Sbjct: 237 TVPVLGVPSASARPNRHGP-ARWNAIEIEPR 266


>gi|167645645|ref|YP_001683308.1| metallophosphoesterase [Caulobacter sp. K31]
 gi|167348075|gb|ABZ70810.1| metallophosphoesterase [Caulobacter sp. K31]
          Length = 307

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 79/273 (28%), Positives = 141/273 (51%), Gaps = 10/273 (3%)

Query: 9   MFVLAHISDIHLSYSPSFF---ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +F LAHISD+HLS     F   +L  KR++  + W    +++   E+   ++ D++    
Sbjct: 3   IFRLAHISDLHLSPPKGAFGWRDLLSKRLLSRIAWRRKHREH-RPEILARVVADLIAQAP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV+ITGD+ N+    E   +  WL ++G   D+++ PGNHDA +     ++  AW  ++
Sbjct: 62  DHVAITGDLTNYASPAEFEAARLWLETLGPSRDVTVSPGNHDALVDAEGVEAFAAWTPWL 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                   G+  FP +R+R+ +A+    +A+ T P  A G  G+ Q    + LL     +
Sbjct: 122 -----GDAGETRFPQVRVRDGVAVFNLCSAVPTAPHLATGRLGEAQLRRLAALLSDPAYR 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK-K 244
             FR++++HHPP+    +    +  +   + ++  +GADLILHGH H   +  +   +  
Sbjct: 177 DDFRVLLIHHPPIPGAVARRKSLEDVDALRAVLAEQGADLILHGHAHDAMVATVPGPRGA 236

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNE 277
           +IPV+G+ SAS       P A ++   I ++ +
Sbjct: 237 MIPVLGVPSASAMGGRGHPAARWHAVEIAREAD 269


>gi|330994317|ref|ZP_08318245.1| metallophosphoesterase [Gluconacetobacter sp. SXCC-1]
 gi|329758784|gb|EGG75300.1| metallophosphoesterase [Gluconacetobacter sp. SXCC-1]
          Length = 305

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/297 (28%), Positives = 143/297 (48%), Gaps = 14/297 (4%)

Query: 10  FVLAHISDIHLS---YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
             +AH+SD HL      P   +   KR+   ++W  +R+     E+   ++ D+    VD
Sbjct: 4   ITIAHLSDPHLPTEMAPPRLADRLNKRMFSHISWRRHRRFIHRPEILARVMADMAATPVD 63

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            +++TGD+ N     E   +  WL  +  P   +++PGNHD  +    ++++  W+ ++ 
Sbjct: 64  MIAVTGDLTNMGLPGECRNALRWLERM--PAPCTVIPGNHDTLVHADWQQTVGLWQPWM- 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                  G   FP++R   ++ALIG S+A+ TP F A G  G  QA     LL +  ++G
Sbjct: 121 -------GALPFPFVRRVGSVALIGVSSAVPTPWFRATGTLGVRQAARLRTLLHETGRQG 173

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
             RI+M+HHPPV   +     +     F   I HEGA+++LHGH H +S+  +   +  +
Sbjct: 174 LCRIVMIHHPPVAGLAVARKALRDPDNFAACIAHEGAEMVLHGHIHTSSISSLPGPQGAV 233

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           PV+GIASAS +       A +N   + + +  + L   R    PD          +F
Sbjct: 234 PVLGIASASARSADPLRAAGWNRITVHRGDTGYALGVTRRCF-PDGGQAVTSQETVF 289


>gi|209964083|ref|YP_002296998.1| phosphoesterase, putative [Rhodospirillum centenum SW]
 gi|209957549|gb|ACI98185.1| phosphoesterase, putative [Rhodospirillum centenum SW]
          Length = 323

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 133/281 (47%), Gaps = 10/281 (3%)

Query: 9   MFVL--AHISDIHLSYSPS---FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           MF L  AH +D HL   P+   +  L  KR+ G ++W   R +    EV   L++DI   
Sbjct: 1   MFALRFAHFTDPHLPLPPAGPGWTALLSKRLFGYLSWRRRRHRIHRPEVLAALLDDIRAR 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+  TGD+ N +   E   +  WL +   P D+++VPGNHDA +     + L  W+ 
Sbjct: 61  KPDHLVCTGDLANISLPAEFERARVWLEATAAPRDLTLVPGNHDALVPVPWVRGLGLWEP 120

Query: 124 YITSDT-----TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
           ++  D        + G+ LFP LR+R  +A IG S+A+ T P  A G  GQ Q      L
Sbjct: 121 WMRGDPGTGPDGTAGGEGLFPSLRVRGAVAFIGLSSAVPTAPLLATGRVGQTQLRRLEAL 180

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHW 238
           L++    G +R++++HHP    T      +      + ++   GA+L+LHGH H      
Sbjct: 181 LQEQGAAGRYRVVLLHHPLADGTVRARKALTDRAAVRAVLARAGAELVLHGHAHCARFAA 240

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYW 279
           +      IP +   SAS   H     A ++L  + +  + W
Sbjct: 241 LPGPLGPIPSLTAPSASAVAHGRYDAARWSLVEVRRTPDGW 281


>gi|58040481|ref|YP_192445.1| hypothetical protein GOX2053 [Gluconobacter oxydans 621H]
 gi|58002895|gb|AAW61789.1| Hypothetical protein GOX2053 [Gluconobacter oxydans 621H]
          Length = 313

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 83/280 (29%), Positives = 136/280 (48%), Gaps = 14/280 (5%)

Query: 10  FVLAHISDIHLSYSPSFF-ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
             LAHISD HL   P  + E   KR + L++W  +R+    ++    L+ DI   +VD +
Sbjct: 29  VTLAHISDPHLPPPPVHWREALNKRALSLLSWKKHRRYVHLEQTCAALVKDIGRSDVDTI 88

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+ NF    E   +  WL ++  P    ++PGNHD  +       LH W+ +    
Sbjct: 89  LVSGDLTNFGTPDEFAAAARWLDAL--PAQALVIPGNHDCMVRQPDSAGLHQWERW---- 142

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                  + +PY+RI+N +A++G ++ I T PF A G     Q      LL++  ++G  
Sbjct: 143 -----SARQYPYVRIQNGVAIVGVNSGIPTAPFMACGRVAHRQRERLEALLQELGREGLC 197

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++M+HHPP          +   +    +    GA+++LHGH+H  +L  I      IP+
Sbjct: 198 RVVMIHHPPRRGLVPWRKSLLDHREVAAVFRRAGAEIVLHGHSHDATLTHIAGTD--IPL 255

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           +G+ASAS        QA +N   I    + WT+   R+ L
Sbjct: 256 LGVASASLTDERPHRQACWNRLSIHPYGKGWTITLARHRL 295


>gi|16125410|ref|NP_419974.1| hypothetical protein CC_1158 [Caulobacter crescentus CB15]
 gi|221234153|ref|YP_002516589.1| Icc family phosphohydrolase [Caulobacter crescentus NA1000]
 gi|13422478|gb|AAK23142.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220963325|gb|ACL94681.1| phosphohydrolase, Icc family [Caulobacter crescentus NA1000]
          Length = 305

 Score =  146 bits (368), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 130/273 (47%), Gaps = 11/273 (4%)

Query: 9   MFVLAHISDIHLSYSPSFFELS---PKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           ++ +AH+SD HL   P  F L     KR++  + W   RK +   EV   L+ D+     
Sbjct: 3   IYRIAHLSDPHLPPPPGAFGLRDVFTKRLLSRIAWRKKRKVH-RPEVLAALVADLQATAP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV I+GD+ NF    EI T+  WL  +G   D ++ PGNHDA       +    W  ++
Sbjct: 62  DHVVISGDLTNFASPVEIATARSWLEGLGAASDHTVSPGNHDALAGVGGPERFAIWSPWL 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                  TG+  FP +R+R  +A+    +A+ T P  A G  GQ+Q       L      
Sbjct: 122 -----GDTGEASFPQVRVRGPVAIFNLCSAVPTAPHLATGRLGQDQIERLDAALSDPAYA 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE-KK 244
             FR++++HHPP     S   R+      + ++   GADL+LHGH H   +  +      
Sbjct: 177 SLFRLVVLHHPPHPGAVSKRKRLEDQDALRAVLARHGADLVLHGHAHEALVGSLPGPGGA 236

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNE 277
            IPV+G+ SAS K   + P A ++   IE + E
Sbjct: 237 TIPVLGVPSASAKPSRHAP-ARWHQIEIEPRPE 268


>gi|121595373|ref|YP_987269.1| metallophosphoesterase [Acidovorax sp. JS42]
 gi|120607453|gb|ABM43193.1| metallophosphoesterase [Acidovorax sp. JS42]
          Length = 307

 Score =  145 bits (366), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 125/250 (50%), Gaps = 14/250 (5%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIG---LVNWHFNRKKYFSK-EVANLLINDILLHNV 65
             LAH+SD+HL + P+   LSP++ +    L  W + R++   + ++ + L  D+  H V
Sbjct: 4   LTLAHVSDLHLPFEPA---LSPRQRLSKRQLSAWSWQRRRALHRTDILDALAQDLRAHAV 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+ +TGDI NF+   E   +  WL ++  P  ISIVPGNHDA +     + L  W+ + 
Sbjct: 61  DHILVTGDITNFSLPGEFEQAARWLTALAPPERISIVPGNHDALVPVPHAQGLGLWQGWT 120

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            ++         +P++  R+ +ALIG ++A+ T P  A G  G  Q     +LL      
Sbjct: 121 RAEDG-------WPFVHHRDGVALIGLNSALPTAPLLARGRLGDAQLARLEQLLEAEGAA 173

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G  RI+M+HHPP          +      + ++   GA+L+LHGH     +  +      
Sbjct: 174 GRTRIVMLHHPPAAGAIGWRKALADAPALRAVLRRAGAELVLHGHARDARMDVVAGPSLP 233

Query: 246 IPVVGIASAS 255
           IP + + S+S
Sbjct: 234 IPCLCVPSSS 243


>gi|329114706|ref|ZP_08243464.1| Metallophosphoesterase [Acetobacter pomorum DM001]
 gi|326695972|gb|EGE47655.1| Metallophosphoesterase [Acetobacter pomorum DM001]
          Length = 320

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 138/282 (48%), Gaps = 8/282 (2%)

Query: 12  LAHISDIHLSYS--PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           +AH+SD HL     PSF E+  KRI+ L++W   R+          ++ DI   + D V+
Sbjct: 22  IAHLSDPHLPLVGLPSFKEIRFKRILSLLSWQLRRRHLHKLPALQSIMRDIRHFHPDMVA 81

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ N    +E   +  WL     P  + ++PGNHDA I          W +++ S T
Sbjct: 82  LTGDLTNLGLLKEFQHARQWLLQQDLPPTL-LIPGNHDALIKENSATKQALWAEWLHSST 140

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                    P L ++++IALIG +TA+ T PF A+G  GQ Q    + LLR+    G  R
Sbjct: 141 QPEPAA---PSLLVKDHIALIGVNTAVPTLPFLASGKAGQTQLVLLADLLRRTRVMGLCR 197

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           I+++HHPP     S    +     FQ ++  EGA+L+L+GH+H   +  +     L   V
Sbjct: 198 IVLLHHPPAQGIVSRRKGLDDFLAFQNVLRAEGAELVLYGHSHRAQITTLPGTDIL--AV 255

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
              SAS      +  A +N   + K+ + W +  +  +L PD
Sbjct: 256 SSTSASHIADEPEKSAGWNAISVHKQPDIWQITIQHRSLMPD 297


>gi|218515220|ref|ZP_03512060.1| putative phosphoesterase protein [Rhizobium etli 8C-3]
          Length = 132

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 88/129 (68%)

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLN 234
           T  +LR A + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN
Sbjct: 2   TVNMLRAAGEAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLN 61

Query: 235 SLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLS 294
           +LHW++ + + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    +
Sbjct: 62  TLHWLRGQVQPVPVVGIASASQGPGSIKPAAAYNLFSIDGSPGAWELSGERFSLNRAGDA 121

Query: 295 IQKDYSDIF 303
           +  +  DIF
Sbjct: 122 VIPESVDIF 130


>gi|258542688|ref|YP_003188121.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633766|dbj|BAH99741.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636825|dbj|BAI02794.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639878|dbj|BAI05840.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642934|dbj|BAI08889.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645989|dbj|BAI11937.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649042|dbj|BAI14983.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652029|dbj|BAI17963.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655086|dbj|BAI21013.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-12]
          Length = 316

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 87/283 (30%), Positives = 137/283 (48%), Gaps = 8/283 (2%)

Query: 12  LAHISDIHLSYS--PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           +AH+SD HL     PS  E+  KRI+ L++W   R+          ++ DI   + D V+
Sbjct: 18  IAHLSDPHLPLVGLPSLKEIRFKRILSLLSWQLRRRHLHKLPALQAVMQDIRHFHPDMVA 77

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ N    +E   +  WL     P  + ++PGNHDA I          W +++ + T
Sbjct: 78  LTGDLTNLGLLKEFQNARQWLLQQDLPPAL-LIPGNHDALIKENSAVKQALWAEWLHNRT 136

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                    P L +++++ALIG +TAI T PF A+G  GQ Q    + LLR+    G  R
Sbjct: 137 QSEPAA---PSLLVKDHVALIGINTAIPTLPFLASGKAGQAQLVLLADLLRRTRAMGLCR 193

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           I+++HHPP     S    +   Q FQ ++  EGA+L+L+GH+H   +  I     L   V
Sbjct: 194 IVLLHHPPAPGIVSRRKGLDDFQAFQDVLRAEGAELVLYGHSHRAQITPIPGTDIL--AV 251

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
              SAS      +  A +N   + K+ + W +  +  +L  D 
Sbjct: 252 SSTSASHIADEPEKSAGWNAISVHKQPDIWQITIQHRSLMRDG 294


>gi|209545530|ref|YP_002277759.1| metallophosphoesterase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533207|gb|ACI53144.1| metallophosphoesterase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 307

 Score =  132 bits (332), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 129/260 (49%), Gaps = 10/260 (3%)

Query: 12  LAHISDIHLSYSP---SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           LAH+SD HL++         L  KRI+   +W   R+      +   +  D+     D V
Sbjct: 12  LAHLSDPHLAHDGLRLPVGALMNKRIMSQWSWRRRRRFLHVDAILERVAADVRDAAPDAV 71

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD+ N     E   +  WLR    P    +VPGNHD  +  +   S+  W  ++ + 
Sbjct: 72  ALTGDLTNLGLPVECRHAAAWLRK-NMPEPTFVVPGNHDMLVRESWPDSVGQWAAWMAA- 129

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                    FPY+R   ++ALIG ++A   P F+A G  G  QA   + +L +  + G F
Sbjct: 130 -----APDDFPYVRHVGSVALIGVNSARPMPWFTAAGRIGAAQADRLADILHETGRAGAF 184

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++M+HHPPV         +     F+ +I   GA+++LHGH HL+++  +      +PV
Sbjct: 185 RVVMIHHPPVDGMVPRRKALLDSGLFRSVIGRAGAEMVLHGHAHLSAVSTLPGPAISVPV 244

Query: 249 VGIASASQKVHSNKPQASYN 268
           +GIASAS + H  +  A+++
Sbjct: 245 LGIASASMRAHRQERMAAWH 264


>gi|162148703|ref|YP_001603164.1| metallophosphoesterase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787280|emb|CAP56874.1| putative metallophosphoesterase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 316

 Score =  132 bits (332), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 129/260 (49%), Gaps = 10/260 (3%)

Query: 12  LAHISDIHLSYSP---SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           LAH+SD HL++         L  KRI+   +W   R+      +   +  D+     D V
Sbjct: 21  LAHLSDPHLAHDGLRLPVGALMNKRIMSQWSWRRRRRFLHVDAILERVAADVRDAAPDAV 80

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD+ N     E   +  WLR    P    +VPGNHD  +  +   S+  W  ++ + 
Sbjct: 81  ALTGDLTNLGLPVECRHAAAWLRK-NMPEPTFVVPGNHDMLVRESWPDSVGQWAAWMAA- 138

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                    FPY+R   ++ALIG ++A   P F+A G  G  QA   + +L +  + G F
Sbjct: 139 -----APDDFPYVRHVGSVALIGVNSARPMPWFTAAGRIGAAQADRLADILHETGRAGAF 193

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++M+HHPPV         +     F+ +I   GA+++LHGH HL+++  +      +PV
Sbjct: 194 RVVMIHHPPVDGMVPRRKALLDSGLFRSVIGRAGAEMVLHGHAHLSAVSTLPGPAISVPV 253

Query: 249 VGIASASQKVHSNKPQASYN 268
           +GIASAS + H  +  A+++
Sbjct: 254 LGIASASMRAHRQERMAAWH 273


>gi|149917880|ref|ZP_01906375.1| metallophosphoesterase [Plesiocystis pacifica SIR-1]
 gi|149821400|gb|EDM80802.1| metallophosphoesterase [Plesiocystis pacifica SIR-1]
          Length = 292

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 135/282 (47%), Gaps = 20/282 (7%)

Query: 14  HISDIHLSYSPSFFELSP-----KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           H SDIHL    S   + P     KR+ G VN    R K+  + + + +        VD V
Sbjct: 7   HCSDIHLL---SLRGVGPHRFLNKRLTGGVNLMLKRGKHHDEALFDRMCEHARDRAVDRV 63

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGA-KEKSLHAWKDYITS 127
            ITGD+ N    +E       LR+IG P  ++++PGNHDAY  G+ + +      D   +
Sbjct: 64  VITGDLSNLALEQEFEHIRTKLRAIGVP--VTVIPGNHDAYTRGSVRNRRFEQMLDEFMA 121

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                 G   +P+++   ++AL+G STA A+ P  A G  G EQ      +L +   +G 
Sbjct: 122 GERSEGGD--YPFVQRYGDVALVGVSTAQASLPMYAVGTVGPEQLERLDGVLERLGAEGL 179

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH--LNSLHWIKNEKKL 245
            RI+++HHP V   S   + +  I  F ++I   GA+LILHGH H  L       + ++ 
Sbjct: 180 GRIVLIHHPVVPGVSKKRHDLLDIDAFGEVIARRGAELILHGHEHTLLEGTLAGPDSERP 239

Query: 246 IPVVGIASASQKVHSNKPQASYNLFY-----IEKKNEYWTLE 282
           +PV GI+S +        +A++ ++      IE++   W  E
Sbjct: 240 VPVHGISSGTNISQHEGRRAAFAIYQVSAASIERELHVWDGE 281


>gi|262198837|ref|YP_003270046.1| metallophosphoesterase [Haliangium ochraceum DSM 14365]
 gi|262082184|gb|ACY18153.1| metallophosphoesterase [Haliangium ochraceum DSM 14365]
          Length = 326

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 121/260 (46%), Gaps = 9/260 (3%)

Query: 26  FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFT 85
             E   KR IG +N    R ++    V   ++ DI    +DHV  +GD+ N     E   
Sbjct: 23  LLEFINKRWIGGLNLLAKRSRHHHTHVFEAMVEDINAQGIDHVVCSGDVTNLGLKSEFRF 82

Query: 86  STHWLRSIG-NPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT------TCSTGKKLF 138
           +      +   P +++++PGNHD Y+S A+    H + DY  +DT      + +     +
Sbjct: 83  ARSCFDGLALGPENVTVIPGNHDVYVSEARGHFDHFFADYHRTDTPWRVTGSEAPAGTAW 142

Query: 139 PYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPV 198
           P +R+R  +A++G S+ + TP F+A G     Q      +L         R++ +HHPP 
Sbjct: 143 PTVRVRGPVAVVGVSSCVPTPWFTAYGRVDHRQLERLRAVLSSPELADKLRVVAIHHPPA 202

Query: 199 LDTSSLYNR-MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL-IPVVGIASASQ 256
              +    R + G ++F K++   GA+L+LHGH H +  H +       IPV+GI S S 
Sbjct: 203 GRYARHQTRGLRGWRKFAKLLAETGAELVLHGHEHRDLRHELPGPGGAYIPVLGIQSGSY 262

Query: 257 KVHSNKPQASYNLFYIEKKN 276
                +  A Y +F + +  
Sbjct: 263 HGLRAERTARYRIFDVSRDG 282


>gi|162452080|ref|YP_001614447.1| putative metallo-phosphoesterase [Sorangium cellulosum 'So ce 56']
 gi|161162662|emb|CAN93967.1| putative Metallo-Phosphoesterase [Sorangium cellulosum 'So ce 56']
          Length = 314

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 82/286 (28%), Positives = 123/286 (43%), Gaps = 20/286 (6%)

Query: 27  FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTS 86
           F L  KR+ G +N  F R         +    +I    VDHV ITGD+ N    RE    
Sbjct: 20  FRLLNKRLTGYLNLRFRRHAIHKPHAVHAAAREIRRLGVDHVVITGDVSNLALEREFVLV 79

Query: 87  THWLRS-IG-NPHDISIVPGNHDAYISGA--KEKSLHAWKDYITSD-------------T 129
             +L+S +G  P  +SIVPGNHDAY  GA   ++    +  Y+ SD              
Sbjct: 80  RDFLQSGLGLPPERVSIVPGNHDAYTKGAHRSQRFSRYFAPYLRSDLVLDAPGKSDDGGA 139

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
           T   G   FP++ +R  +A+IG STA   PP  A+G  G  Q  A  + L     +    
Sbjct: 140 TRDGGDSAFPFVHLRGPVAIIGLSTAWPRPPLVASGRLGPVQLRALERALEHPEVRRRTP 199

Query: 190 IIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +++ HHP   P     +L   +       +++      L+LHGH H      +  E+  I
Sbjct: 200 VVLQHHPFHNPASRAKTLLEGLGDAAAEGRLLRQVRRGLLLHGHLHRRIHRKLHTERGHI 259

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
             VG  SAS    S++  A +N++ I+       +   R+    D+
Sbjct: 260 DAVGATSASLLHDSDERMAGFNVYEIDDAGTIGGITSHRFVPGQDA 305


>gi|86157416|ref|YP_464201.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773927|gb|ABC80764.1| Metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 307

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 138/301 (45%), Gaps = 16/301 (5%)

Query: 9   MFVLAHISDIHLSYSPSFFE----LSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           M  +AH+SD+H+  SP   E    L  KRI G VN    R + + +E    ++     H 
Sbjct: 1   MLRIAHLSDLHV-LSPRGTEWRRILFNKRITGYVNLVRQRGRVYRREYLAAVLAAAAAHA 59

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE--KSLHAWK 122
             HV +TGDI N    RE+  +   L  +    ++++VPGNHD Y+   ++  +  H + 
Sbjct: 60  D-HVVVTGDITNLALERELEEARALLDGVARAVEVTVVPGNHDVYLPSIQDGRRFPHHFG 118

Query: 123 DYITSDT---TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
            ++  D            FP +++R   A+IG S+A+  PPF A+G  G+ Q  A   +L
Sbjct: 119 PFLRGDLPDLARDLAAGPFPCVKLRGPAAIIGLSSAVPRPPFVASGRLGEAQLEALEAVL 178

Query: 180 RKANKKGFFRIIMMHHPPV---LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL 236
                     ++++HHPPV   +    L + +    R + ++   G  L+L GH H    
Sbjct: 179 AHPEVARRTPVVLVHHPPVDGRIRALQLRDGLVDADRLRAVLSRLGRGLVLFGHLHARVR 238

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
             +      + VVG + A+      + +A +N + +        +E   + L+PD  S++
Sbjct: 239 WRLPTATGALQVVGASGAALDHPHPRVRAGFNAYELRDDGSLAAVEA--HVLAPDGRSVE 296

Query: 297 K 297
           +
Sbjct: 297 R 297


>gi|220916163|ref|YP_002491467.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219954017|gb|ACL64401.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 309

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 137/298 (45%), Gaps = 16/298 (5%)

Query: 12  LAHISDIHLSYSPSFFE----LSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           +AH+SD+H+  SP   E    L  KRI G  N    R + + +E    ++         H
Sbjct: 6   IAHLSDLHVR-SPRGAEWRRILFNKRITGYANLIRQRGRVYRREYLAAVLAAAAARAD-H 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE--KSLHAWKDYI 125
           V +TGD+ N    RE+  +   L ++    ++++VPGNHD Y++  ++  +  H +  ++
Sbjct: 64  VVVTGDVTNLALERELEEARSLLDAMARRVEVTVVPGNHDVYLASIQDGRRFPHHFGAFL 123

Query: 126 TSDT---TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
             D            FP +++R   A+IG S+A+  PPF A+G  G+ Q  A   +L   
Sbjct: 124 RGDLPDLALDLAAGPFPCVKLRGPAAIIGLSSAVPRPPFVASGRLGEAQLEALEAVLAHP 183

Query: 183 NKKGFFRIIMMHHPPV---LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI 239
                  ++++HHPPV   +    L + +    R + ++   G  L+L GH H      +
Sbjct: 184 EVARRTPVVLLHHPPVDGRIRALQLRDGLVDADRLRAVLCRLGRGLVLFGHLHARVRWRL 243

Query: 240 KNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
                 + V+G + A+      + +A +N + +        +E   + ++PD  S+++
Sbjct: 244 PTAAGALQVIGASGAALDHPHPRVRAGFNSYDLRDDGSLAAVEA--HVVAPDGRSVER 299


>gi|197121459|ref|YP_002133410.1| metallophosphoesterase [Anaeromyxobacter sp. K]
 gi|196171308|gb|ACG72281.1| metallophosphoesterase [Anaeromyxobacter sp. K]
          Length = 307

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 136/298 (45%), Gaps = 16/298 (5%)

Query: 12  LAHISDIHLSYSPSFFE----LSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           +AH+SD+H+  SP   E    L  KRI G VN    R +   +E    ++         H
Sbjct: 6   IAHLSDLHVR-SPRGTEWRRILFNKRITGYVNLIRQRGRVHRREYLAAVLAAAAARAD-H 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE--KSLHAWKDYI 125
           V +TGD+ N    RE+  +   L ++    ++++VPGNHD Y++  ++  +  H +  ++
Sbjct: 64  VVVTGDVTNLALERELEEARSLLDAMARRVEVTVVPGNHDVYLASIQDGRRFPHHFGAFL 123

Query: 126 TSDT---TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
             D            FP +++R   A+IG S+A+  PPF A+G  G+ Q  A   +L   
Sbjct: 124 RGDLPDLARDLAAGPFPCVKLRGPAAIIGLSSAVPRPPFVASGRLGEAQLEALEAVLAHP 183

Query: 183 NKKGFFRIIMMHHPPV---LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI 239
                  ++++HHPPV   +    L + +    R + ++   G  L+L GH H      +
Sbjct: 184 EVARRTPVVLLHHPPVDGRIRALQLRDGLVDADRLRAVLCRLGRGLVLFGHLHARVRWRL 243

Query: 240 KNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
                 + V+G + A+      + +A +N + +        +E   + ++ D  S+++
Sbjct: 244 PTAAGALQVIGASGAALDHPHPRVRAGFNSYELRDDGSLAAVEA--HVIAADGRSVER 299


>gi|116328189|ref|YP_797909.1| phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116330913|ref|YP_800631.1| phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116120933|gb|ABJ78976.1| Phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116124602|gb|ABJ75873.1| Phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 292

 Score = 90.1 bits (222), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 134/282 (47%), Gaps = 18/282 (6%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           + H+SD+H   S  FF+L  K  +G +N++  R+K + K + N ++N I   N D + ++
Sbjct: 3   ILHLSDLHFPTSVPFFQLKGKMFVGYLNYNLRRRKKYPKNIWNSILNFIRETNPDAIVVS 62

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GDI N +   E   +   L  +     +  +PGNHD Y+  +  ++  A+ +   S  + 
Sbjct: 63  GDITNVSHEEEFKAALKMLSELPQ-EKVFYIPGNHDRYVKQSVGEN--AFYEKYFSKLSG 119

Query: 132 STGKKLFPYLRIR--NNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
            +      Y+RI+   ++  +G  + I     +A G    E    T K L +   + +  
Sbjct: 120 ESISHNAHYIRIKKIQDLHFVGWDSNIPLSILNAYGRIRPEVVVQTKKTLSERKIRNY-- 177

Query: 190 IIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +++ HHP   P     ++++++   +    ++  +   + LHGH H N   W+K     +
Sbjct: 178 VLVCHHPIWNPTNKQETIHHKLLNREEIASLLKEQPPLVYLHGHVHTN---WVKFPGDEL 234

Query: 247 PVVGIASASQ-KVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
           P   + SAS  ++     ++ ++L  I+K+N    +E +RYT
Sbjct: 235 PYYVVNSASSTRLSDTTHESGFHLLEIQKQN----VEIQRYT 272


>gi|45657478|ref|YP_001564.1| hypothetical protein LIC11606 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45600717|gb|AAS70201.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 292

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 136/283 (48%), Gaps = 20/283 (7%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           + H+SD+H   S  FF+L  K  +G +N++F RK  + K+V + ++  I   N D + ++
Sbjct: 3   ILHLSDLHFPTSLPFFQLKGKMFVGYLNYNFRRKNKYPKKVWDSILTFIQEINPDAIVVS 62

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI-SGAKEKSLHAWKDYITSDTT 130
           GDI N +   E F     + S      +  +PGNHD Y+   + E +L+       S   
Sbjct: 63  GDITNVSHEEE-FKKARKMLSELPLEKVFYIPGNHDRYVKQSSGENALYEKYFSEFSGEP 121

Query: 131 CSTGKKLFPYLRIR--NNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
            S  K    Y+RI+   N+  +G  + I     +A+G    E    T + L  + KK   
Sbjct: 122 ISHNKN---YIRIKKIQNLHFVGWDSNIPLSILNAHGRIHPEIVIQTKRFL--SEKKITN 176

Query: 189 RIIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
            I++ HHP   P+    ++++++   +    ++  +   + LHGH H N   W+K   + 
Sbjct: 177 YILVCHHPIWNPLDKQETVHHKLLNREEVASLLKEQPPLVYLHGHVHTN---WVKFPGEE 233

Query: 246 IPVVGIASASQ-KVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
           +P   I SAS  ++   K ++ ++L  I+K+     ++ +RYT
Sbjct: 234 LPYYVINSASSTRLPDAKHKSGFHLIEIQKQK----IKIQRYT 272


>gi|24215038|ref|NP_712519.1| putative phosphohydrolase [Leptospira interrogans serovar Lai str.
           56601]
 gi|24196088|gb|AAN49537.1| predicted phosphohydrolase [Leptospira interrogans serovar Lai str.
           56601]
          Length = 292

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 136/283 (48%), Gaps = 20/283 (7%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           + H+SD+H   S  FF+L  K  +G +N++F RK  + K+V + ++  I   N D + ++
Sbjct: 3   ILHLSDLHFPTSLPFFQLKGKMFVGYLNYNFRRKNKYPKKVWDSILTFIQEINPDAIVVS 62

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI-SGAKEKSLHAWKDYITSDTT 130
           GDI N +   E F     + S      +  +PGNHD Y+   + E +L+       S   
Sbjct: 63  GDITNVSHEEE-FKKARKILSELPLEKVFYIPGNHDRYVKQSSGENALYEKYFSEFSGEP 121

Query: 131 CSTGKKLFPYLRIR--NNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
            S  K    Y+RI+   N+  +G  + I     +A+G    E    T + L  + KK   
Sbjct: 122 ISHNKN---YIRIKKIQNLHFVGWDSNIPLSILNAHGRIHPEIVIQTKRFL--SEKKITN 176

Query: 189 RIIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
            I++ HHP   P+    ++++++   +    ++  +   + LHGH H N   W+K   + 
Sbjct: 177 YILVCHHPIWNPLDKQETVHHKLLNREEVASLLKEQPPLVYLHGHVHTN---WVKFPGEE 233

Query: 246 IPVVGIASASQ-KVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
           +P   I SAS  ++   K ++ ++L  I+K+     ++ +RYT
Sbjct: 234 LPYYVINSASSTRLPDAKHKSGFHLIEIQKQK----IKIQRYT 272


>gi|183221721|ref|YP_001839717.1| putative metallo-dependent phosphatase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189911796|ref|YP_001963351.1| phosphohydrolase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167776472|gb|ABZ94773.1| Phosphohydrolase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167780143|gb|ABZ98441.1| Putative metallo-dependent phosphatase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 287

 Score = 83.6 bits (205), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 120/281 (42%), Gaps = 35/281 (12%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           + HISD+H     S F L  K I+G +N+H  RK      +   +++ I     D + I+
Sbjct: 3   ILHISDLHFPKKLSLFSLRGKAIVGYLNYHVRRKSKHPVVLIAAMVDTIQNLEYDALVIS 62

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAK------EKSLHAW---- 121
           GD+ N +   E   +   L+ I       ++PGNHD Y   A       EK+   W    
Sbjct: 63  GDLTNVSHPSEFQNAKEILKPILTDKTF-LIPGNHDRYQKRAMGPNPLFEKAFEEWMGES 121

Query: 122 KDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
           KD      T     KLF           +G  + +A P  +ANGY  +E    T  L   
Sbjct: 122 KDPNFYLRTKRIAGKLF-----------VGWDSNLAIPRITANGYVAKEVVEKTVGL--- 167

Query: 182 ANKKGFFRIIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHW 238
           AN+     +++ HHP   P  +  S  +R+   +     +     +L LHGHTH N   W
Sbjct: 168 ANEP---YVLVGHHPLWNPNAEVESASHRLSNRKEVVNGLQTNPPELYLHGHTHTN---W 221

Query: 239 IKNEKKLIPVVGIASASQ-KVHSNKPQASYNLFYIEKKNEY 278
           +K   K  P   + SAS  ++  +K +  ++L  + K+  Y
Sbjct: 222 VKLPGKETPFTIVNSASSTRLSDSKHECGFHLIELGKQTHY 262


>gi|304314392|ref|YP_003849539.1| phosphohydrolase [Methanothermobacter marburgensis str. Marburg]
 gi|302587851|gb|ADL58226.1| predicted phosphohydrolase [Methanothermobacter marburgensis str.
           Marburg]
          Length = 245

 Score = 65.9 bits (159), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 121/301 (40%), Gaps = 74/301 (24%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--- 65
           M ++AHISD+H+  +P+F E                              DILL  +   
Sbjct: 1   MVLIAHISDLHVG-APNFKE------------------------------DILLEAIRQI 29

Query: 66  -----DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
                D   ITGD+ +     E   +  +L  +  PH    VPGNHDA   G +      
Sbjct: 30  NELKPDATVITGDLTDNGYYLEFLQAAEYLSDLKGPH--IFVPGNHDARHVGNE------ 81

Query: 121 WKDYITSDTTCSTGKKLFPYLR---IRNNIALIGCSTAIATPPFSANGYFGQEQAHATSK 177
                       T + +F Y +   + +++ +IG  +   + P    G  G+ Q     +
Sbjct: 82  ------------TFEDVFRYRKGTFVMDDLTIIGLDS---SEPDLDYGKIGRSQQIWMEE 126

Query: 178 LLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNS 235
            L +A+++G FR+I +HH   PV  T    N +         I  +GADL++ GH H+  
Sbjct: 127 ELERASERGHFRVIALHHHIIPVPKTGRERNVLADAGDILYSIIRKGADLVISGHKHVP- 185

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL---EGKRYTLSPDS 292
            H  + E       G  S+ +     K   SYN +YI + +    L   +G+R  L+  S
Sbjct: 186 -HVWRVEDTFFVTAGTVSSLKL--RGKDINSYNTYYITEDSIRIVLNQVQGERIELASHS 242

Query: 293 L 293
           L
Sbjct: 243 L 243


>gi|320104186|ref|YP_004179777.1| metallophosphoesterase [Isosphaera pallida ATCC 43644]
 gi|319751468|gb|ADV63228.1| metallophosphoesterase [Isosphaera pallida ATCC 43644]
          Length = 350

 Score = 61.6 bits (148), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 15/173 (8%)

Query: 12  LAHISDIH---LSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           + H+SDIH   +   P   +L  KRI+G V+    R + F  +    +I  +L    DHV
Sbjct: 21  IVHLSDIHFWRIEIGPR--DLFSKRIVGSVSLLLGRARAFKLDRLPAVIERVLSLQPDHV 78

Query: 69  SITGDIVNFTCNREIFTSTHWLRS-IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            I+GD+      RE   +   L   + +P   +IVPGNHD Y +G  ++S   +++Y   
Sbjct: 79  VISGDLTTTASEREFQDARAGLAPLLEDPRRATIVPGNHDRY-TGEAQRS-RRFEEYFGE 136

Query: 128 DTTCSTGKKLFPYLR-IRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
                TG   FP+L+ + +  A++G     A    +A G+  + Q  A   LL
Sbjct: 137 ----FTGGPEFPWLKHLDHQTAILGLDPTRAD--LTARGHLPESQIVAAHHLL 183


>gi|51244721|ref|YP_064605.1| hypothetical protein DP0869 [Desulfotalea psychrophila LSv54]
 gi|50875758|emb|CAG35598.1| hypothetical protein DP0869 [Desulfotalea psychrophila LSv54]
          Length = 1076

 Score = 60.1 bits (144), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 103/240 (42%), Gaps = 38/240 (15%)

Query: 66  DHVSITGDIVNFTCNREIFTST---HWLRSIGNPH--DISIVPGNHD-------AYISG- 112
           D + ITGD+V +    E   +    + L S  N H  ++ IVPGNHD       AY +  
Sbjct: 58  DLIVITGDLVEYGQQSEFDQAKVFFNELASFLNVHISNVLIVPGNHDINRKACEAYFAEC 117

Query: 113 -AKEKS--------LHAWKDYITS---------DTTCSTGKKLFPYLRIRNNIALIGCST 154
            A EK            +K++  S         D     G   +P L++   +A +  + 
Sbjct: 118 EADEKKPTLPYKPKWRHFKNFYNSFYSDISRKFDLETPFGCTEYPELKVA--VANLNSTV 175

Query: 155 AIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRF 214
             +       G  G+ QA   ++ L K   +G+F I  +HH  V       + +   +  
Sbjct: 176 QESHQEKDHYGLIGENQAQKIAEQLAKRKDEGWFNIAAVHHNVVRGAIEDDDNLRDSEML 235

Query: 215 QKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEK 274
           Q++I  +  DLILHGHTH   +HW   +   +PV+G  SAS +  S +P    N + + K
Sbjct: 236 QRVI-GDHIDLILHGHTHRGKMHWWSPQ---LPVIGTGSASVE-KSARPDEVPNQYQLLK 290


>gi|330443879|ref|YP_004376865.1| Calcineurin-like phosphoesterase [Chlamydophila pecorum E58]
 gi|328806989|gb|AEB41162.1| Calcineurin-like phosphoesterase [Chlamydophila pecorum E58]
          Length = 302

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 105/266 (39%), Gaps = 36/266 (13%)

Query: 10  FVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           F L HISD+H    P + F    KR    +   F    +    + N   + I   + + V
Sbjct: 9   FRLVHISDVHCRVFPKNLFYCFNKRFKSFLRQVFCSVDFQDVTICNRFPDLIRSLHTNSV 68

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+     + E   + H++  +     I +VPGNHD Y   + ++            
Sbjct: 69  CLTGDLTLTALHAEFSLARHFIDHLAQYAKIHLVPGNHDVYTKTSYQE------------ 116

Query: 129 TTCSTGKKLFPYLRIRNN------------IALIGCSTAIATPPFSANGYFGQEQAHATS 176
               T    FP +R++ N            I L+ CS       FSANG     Q  A  
Sbjct: 117 ---QTFYHYFPNVRLQKNKVAKYRLTPDWWIILLDCSCLNGW--FSANGKVFLSQIAALE 171

Query: 177 KLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH-EGADLILHGHTHLNS 235
            LLR   +     II+ +H P+L +   ++ +      Q+ +       L LHGH H  +
Sbjct: 172 SLLRSIPQSE--NIIIANHYPLLTSKKKFHTLLNNSLLQETLRDFPNIRLYLHGHDHQAT 229

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSN 261
           L+     K L P + + S S  + SN
Sbjct: 230 LY---ANKDLSPGLILNSGSISLPSN 252


>gi|108760865|ref|YP_629529.1| serine/threonine protein phosphatase family protein [Myxococcus
           xanthus DK 1622]
 gi|108464745|gb|ABF89930.1| Ser/Thr protein phosphatase family protein [Myxococcus xanthus DK
           1622]
          Length = 290

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 114/278 (41%), Gaps = 45/278 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHF-------NRKKYFSKEVANLLINDILLH- 63
           +AH SD+H++    +F L P   +G   W          R + +++    L         
Sbjct: 9   IAHCSDVHITED--YFAL-PLHRLGWRRWMALAELTVGGRARRYARAPQALAAIARDAQA 65

Query: 64  -NVDHVSITGDIVNFTCNREIFTSTHWLRSIG-NPHDISIVPGNHDAYISGAKEKSLHA- 120
             VDH  ++GD+  +  + E   +   L ++  +P   +++PGNHD +  G+      A 
Sbjct: 66  AQVDHFILSGDLTAYALDAEFSGARQSLGALAEDPRRCTVIPGNHDVFTPGSHRTGRFAK 125

Query: 121 -WKDYITSDTTCSTGKKLFPYLR-IRNNIALIGCSTA-IATPPFSANGYFGQEQAHATSK 177
            +   + SD      +  FP++R +    A++G  +A +   P  + G  G+ Q    + 
Sbjct: 126 YFGHLLESDLPEYRREGAFPFVRLLGTEAAVVGLLSARVPRTPGLSYGVIGEAQLGGLAA 185

Query: 178 LLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG---AD---------- 224
           LL+ A  +G   ++++HH P L+     +R           WH G   AD          
Sbjct: 186 LLKDARLEGRAILVVVHHAP-LNPHGRPDR-----------WHHGLRDADALLKLLPGPR 233

Query: 225 -LILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSN 261
             +LHGH H    H    ++    V G  S+++  H  
Sbjct: 234 YAVLHGHIHRRYHHPATADRPH--VFGAGSSTESGHEG 269


>gi|312136711|ref|YP_004004048.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
 gi|311224430|gb|ADP77286.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
          Length = 273

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 103/244 (42%), Gaps = 26/244 (10%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           K II L + HF  K  FS E+   L + I   N D + + GD+       E   ++ ++ 
Sbjct: 16  KTIIHLSDIHFGDKT-FSSELKRNLTSGIENINPDIIVVAGDVTTNGYKYEYELASEFIE 74

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            + +  D  +VPGNHDA   G     +H  K           G + F ++      A+IG
Sbjct: 75  ELNDIADTYVVPGNHDARNVGL----VHFEK---------LIGHRKFLHIDKSGEFAIIG 121

Query: 152 CSTAIATPPFSANGYFGQEQAH-ATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRM 208
                ++ P   +G  G +Q   A  KL R  N  GF +I+  HH   P+  T    N +
Sbjct: 122 LD---SSQPDIDDGQIGIDQMEWAHDKLKRIPN--GFIKIVTFHHHLLPIPQTGRERNIL 176

Query: 209 FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYN 268
                  K++   G D +L+GH H+ ++  I+     +  +   +A+ +    +   SYN
Sbjct: 177 LDCGDVLKLLIDCGVDFVLNGHKHVPNVWMIEK----MATINSGTATTRRLRGESFPSYN 232

Query: 269 LFYI 272
              I
Sbjct: 233 ELTI 236


>gi|152992897|ref|YP_001358618.1| metallophosphoesterase [Sulfurovum sp. NBC37-1]
 gi|151424758|dbj|BAF72261.1| metallophosphoesterase [Sulfurovum sp. NBC37-1]
          Length = 294

 Score = 58.9 bits (141), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 89/217 (41%), Gaps = 24/217 (11%)

Query: 12  LAHISDIHLSYSPSFFELSP---KRIIGLVNWHFNRKKYFSKEVANL--LINDILLHNVD 66
           + H SDIH++             KR IG +N    R  YF      L  L+     +++D
Sbjct: 7   ILHFSDIHVNIQIRHMHWKKWFSKRAIGAINLLRGRASYFDDTEKKLAALVRFKEENDID 66

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNP-HDISIVPGNHDAYISGAKEKSLHAWKDYI 125
            V  TGD        E+  +   L  +  P  +   VPGNHD Y+    E + H    Y 
Sbjct: 67  IVINTGDYTALGLRSELILARQLLDPLMTPPQNYITVPGNHDIYVH---EGNSH----YR 119

Query: 126 TSDTTCSTGKKLFP-YLR---------IRNNIALIGCSTAIATP-PFSANGYFGQEQAHA 174
            S+  CS  +   P Y R         + ++ A+I   +A   P P+ ++G    EQ  A
Sbjct: 120 FSEQFCSVLQNDLPEYCRGGHWPLIRLLGDDAAVIAIDSARPNPVPWKSSGEIPPEQLQA 179

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI 211
             ++L+    KG F  +M H+ P L       ++ G+
Sbjct: 180 LEEILKDERVKGRFLFVMTHYAPRLSNGEPDKKLHGL 216


>gi|209964654|ref|YP_002297569.1| 3',5'-cyclic-nucleotide phosphodiesterase, putative [Rhodospirillum
           centenum SW]
 gi|209958120|gb|ACI98756.1| 3',5'-cyclic-nucleotide phosphodiesterase, putative [Rhodospirillum
           centenum SW]
          Length = 286

 Score = 58.9 bits (141), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 115/266 (43%), Gaps = 27/266 (10%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +RI  + + HF R       V   L +D+     D + ++GD+       +   +  +L 
Sbjct: 2   RRIAHISDLHFGR---IDPAVVAALRDDLAAQAPDLIVVSGDLTQRARPSQFRAARAFLA 58

Query: 92  SIGNPHDISIVPGNHD--AYISGAK-EKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIA 148
            +  PH   +VPGNHD  A+   A+    L  ++ YI  D        L P+L +  N+A
Sbjct: 59  DLPAPH--MVVPGNHDLPAFNLLARLVDPLRNYRRYIAED--------LDPFLNL-GNLA 107

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRM 208
           ++G +T+ +     A G   Q Q       LR+   +  F+++  HHP +        R+
Sbjct: 108 VLGLNTSRSLILDFAEGRVNQRQMDRILGCLRELGPE-VFKVVFTHHPFLPPPDHPGRRL 166

Query: 209 FG-IQRFQKMIWHEGADLILHGHTHL----NSLHWIKNEKKLIPVVGIASASQKVHSNKP 263
            G   R  + +   G DL+L GH H     + +    + ++ I V   ++A+     N+P
Sbjct: 167 VGRATRALRALEAAGVDLLLAGHLHRAYSGDVMSHHAHVERSILVAQASTATSTRLRNEP 226

Query: 264 QASYNLFYIEKKN---EYWTLEGKRY 286
            A +NL  I   +      T EG+R+
Sbjct: 227 NA-WNLIEIAPPSLVLRLRTWEGERF 251


>gi|108802988|ref|YP_642925.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
 gi|108764231|gb|ABG03113.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
          Length = 311

 Score = 58.9 bits (141), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 114/267 (42%), Gaps = 35/267 (13%)

Query: 33  RIIGLVNWHFNRKKYFSK-EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           RI+ + + HF +   + + E    L++ +       V+++GD+     NRE   ++ +LR
Sbjct: 3   RIVHISDLHFGKPAVYERLEALRALLSGM---RPAAVAVSGDLTQRCANREFEQASSYLR 59

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSL----------HAWKDYITSDTTCSTGKKLFPYL 141
            +       +VPGNHD    GA  ++L          H +K        C   ++L P+L
Sbjct: 60  ELERTAPCIVVPGNHDIRWLGAVARNLGLAGLFRRKAHEFKYSRYRRHIC---EELNPFL 116

Query: 142 RIRNNIALIGCSTAIATPPFSAN------GYFGQEQAHATSKLLRKANKK--GFFRIIMM 193
            +   + + G +TA      S        G  G  +     ++ R+  +   G  RI+M+
Sbjct: 117 EVPGAV-IAGLNTAHGISRGSLTRRLRDLGVIGHVRRQDVERVRRRFEQAPPGAARIVMI 175

Query: 194 HHPPVLDTSS----LYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           HH P+    S    L N  + ++    +    G +LIL GH H  ++H  +     + + 
Sbjct: 176 HHNPIKGQLSGRHGLSNTGWALETLAAL----GTELILCGHDHQEAIHATERTSPGLVIS 231

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKN 276
              + S +V   +  +S+NL  I +++
Sbjct: 232 TAGTISNRVRPGR-SSSFNLVDIGEES 257


>gi|220917334|ref|YP_002492638.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955188|gb|ACL65572.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 304

 Score = 58.2 bits (139), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 110/280 (39%), Gaps = 25/280 (8%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           +  L HISD+H++    +    P+   G       R    S  +A  L++ +    VDH+
Sbjct: 26  ILRLGHISDLHVADRSRY----PRN--GFTARDCER---HSTRLAKGLLDALREIGVDHL 76

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+      RE   +   LR       +++VPGNHD +     E+S+   +      
Sbjct: 77  VVTGDLTFSGEPREFERAAELLRPFAEAGKLTVVPGNHDVWT----EESVETGRFLRALG 132

Query: 129 TTCSTGKKLFP----YLRIRNNIALIGCSTA-IATPPFSANGYFGQEQAHATSKLLRKAN 183
                 KK  P     + + +   L+   +A     P++  G  G EQ  A  +L R+  
Sbjct: 133 PDGKGMKKAAPSYPHVVPLGDEAVLVALDSARYGDDPWTTPGRLGGEQLRAARELAREHA 192

Query: 184 KKGFFRIIMMHH-----PPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSL 236
           + G   ++  HH     P  + + +   RM      +  +++       +LHGH H    
Sbjct: 193 RLGRAVLLAFHHHVVLPPERVPSDAHVCRMPLADADQVVRLVAEVPVAAVLHGHRHTAFR 252

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
             +       PV+   SAS+       +A   L+ +++  
Sbjct: 253 VDLPGAAGPTPVLCAGSASRTADEPVRRARAYLYEVDRTG 292


>gi|311104652|ref|YP_003977505.1| calcineurin-like phosphoesterase family protein 2 [Achromobacter
           xylosoxidans A8]
 gi|310759341|gb|ADP14790.1| calcineurin-like phosphoesterase family protein 2 [Achromobacter
           xylosoxidans A8]
          Length = 261

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 84/203 (41%), Gaps = 17/203 (8%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+   + HF  ++   K V    ++       D V ++GDI       +   +  ++  
Sbjct: 3   RILHFSDTHFGTER---KPVVEAALDLACTLAPDLVVLSGDITQRARRGQFAAARKFIER 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLR-IRNNIALIG 151
           +  P  +  VPGNHD  +     ++L+ + +Y          + L P L  +  N  L+ 
Sbjct: 60  LSLP--VLTVPGNHDIPLFNVFARALNPYGNY---------KRALGPVLEPVFENAGLLA 108

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSS-LYNRMFG 210
                  P    +G     Q    ++ LR+A K G  RI++ HHP      S L N + G
Sbjct: 109 IGVNTTRPRRRKDGEISGSQIARVAERLRQA-KPGQLRIVVAHHPVRAKVESDLSNLLIG 167

Query: 211 IQRFQKMIWHEGADLILHGHTHL 233
            +R  +     G DL+L GH HL
Sbjct: 168 RERALEAWAQAGVDLVLGGHIHL 190


>gi|294507999|ref|YP_003572057.1| phosphohydrolases [Salinibacter ruber M8]
 gi|294344327|emb|CBH25105.1| Putative phosphohydrolases [Salinibacter ruber M8]
          Length = 267

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/271 (22%), Positives = 112/271 (41%), Gaps = 31/271 (11%)

Query: 39  NWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHD 98
           + HF R       V   L+++I    +D V+++GD+       E   + + L ++G P  
Sbjct: 8   DLHFGR--IADSGVVEALLDEINAAGIDLVAVSGDLTQRARPAEYRAARNLLDALGPP-- 63

Query: 99  ISIVPGNHDAYISGAKEKSLHA----WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCST 154
             +V GNHD Y      K L      +K +IT D        L P       +A +G ++
Sbjct: 64  TLVVAGNHDVYPWWRPLKRLRTPLERYKQFITED--------LAPTFEA-GGVAALGLTS 114

Query: 155 AIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH---PPVLDTSSLYNRMFGI 211
           A    P    G  G     A  +          F+++++HH   P  +   S +      
Sbjct: 115 AYG--PSIKGGRIGPAD-RAAMRAFFSGTGDDRFKVLVVHHQLHPTAIGPISPHPVARQA 171

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIK----NEKKLIPVVGIASASQKVHSNKPQASY 267
           Q+   +    G DLIL GH H++++  ++      + ++   G A++++      P   Y
Sbjct: 172 QQTLAVAGEVGIDLILCGHLHISAIQPLEIIPGTPRIVVASAGTATSNRWREPTGPINFY 231

Query: 268 NLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD 298
           N+  +E   E +++E +RY   PD     +D
Sbjct: 232 NVVSVEP--EAFSVEERRYV--PDEGRFVRD 258


>gi|149197703|ref|ZP_01874753.1| hypothetical protein LNTAR_20758 [Lentisphaera araneosa HTCC2155]
 gi|149139273|gb|EDM27676.1| hypothetical protein LNTAR_20758 [Lentisphaera araneosa HTCC2155]
          Length = 264

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 96/227 (42%), Gaps = 13/227 (5%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           + H SDIH    P+      KR+ G  N+ F RKK  +    + L   +     D+  I+
Sbjct: 3   IIHFSDIHEGAFPAPSSFFSKRLFGGSNYVFRRKKTVNWSRLDKLTEYVEQEGFDYAIIS 62

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISI--VPGNHDAYISGAKEKSLHAWKDYITSDT 129
           GD  +    RE       L  +     + I  VPGNHD YI  +  KS  A +D+IT  T
Sbjct: 63  GDFTSTGSVREFEMVKKRLEKLHAIEGLKILAVPGNHDNYIDCS--KSYKALEDFITWLT 120

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 K FP LRI     +   S      P   +  F  E+ H   +L+  ++K     
Sbjct: 121 KGLV--KNFP-LRIEEGEVVFYLSNHAVPRPVQLSSGFVNEETH--ERLVEWSSKDEQKT 175

Query: 190 IIMMHHPPVL--DTSSL--YNRMFGIQRFQKMIWHEGADLILHGHTH 232
            I + H P+L  + +SL  +  +   ++  K++     D+ L GH H
Sbjct: 176 KIAIGHYPLLNGEGNSLPEHKLLVDGEKVHKLLQSGAIDINLCGHIH 222


>gi|15678206|ref|NP_275321.1| Icc related protein [Methanothermobacter thermautotrophicus str.
           Delta H]
 gi|2621221|gb|AAB84684.1| Icc related protein [Methanothermobacter thermautotrophicus str.
           Delta H]
          Length = 196

 Score = 57.0 bits (136), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 93/238 (39%), Gaps = 67/238 (28%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--- 65
           M ++AHISD+H+  +P+F E                              DILL  +   
Sbjct: 1   MVLIAHISDLHVG-APNFKE------------------------------DILLEAIRQI 29

Query: 66  -----DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
                D   ITGD+ +     E   +  +L  +  PH    VPGNHDA   G +      
Sbjct: 30  NKLKPDATVITGDLTDNGYYLEFLQAAEYLSDLKGPH--IFVPGNHDARHVGNE------ 81

Query: 121 WKDYITSDTTCSTGKKLFPYLR---IRNNIALIGCSTAIATPPFSANGYFGQEQAHATSK 177
                       T + +F Y R   + + + +IG  +   + P    G  G+ Q      
Sbjct: 82  ------------TFEDVFRYRRGTFVMDGLTIIGLDS---SEPDLDYGKIGRSQQIWMED 126

Query: 178 LLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
            L +A+ +G  R+I +HH   PV  T    N +       + I  +GADL++ GH H+
Sbjct: 127 ELDRASSRGHIRVIALHHHIIPVPKTGRERNVLADAGDILQSIISKGADLVISGHKHV 184


>gi|325959395|ref|YP_004290861.1| metallophosphoesterase [Methanobacterium sp. AL-21]
 gi|325330827|gb|ADZ09889.1| metallophosphoesterase [Methanobacterium sp. AL-21]
          Length = 265

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 107/248 (43%), Gaps = 22/248 (8%)

Query: 29  LSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTH 88
           +  K++I + + HF   K F +++ N L   I   N D + + GDI       +   +  
Sbjct: 1   MMDKKLIHISDLHFGEYK-FDEKLKNNLKFQIEYENPDLIVVAGDITALGYLEDYNLARE 59

Query: 89  WLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIA 148
           +L  + N  +  +VPGNHD+   G     +H  K           G++ F       +I 
Sbjct: 60  FLYELNNIAETYVVPGNHDSCNVGL----VHFRK---------LIGERRFVATDKNEDIV 106

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH-PPVLDTSSLYNR 207
           LIG     ++ P   +G  G +Q    + +L K  +  F  +   HH  P+  T    N 
Sbjct: 107 LIGLD---SSEPDIHDGKIGFDQIEWLNDVLNKIPRDRFTAVTFHHHLLPIPQTGRERNI 163

Query: 208 MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASY 267
           +       K++   G +L+L+GH H+++  W K +  +I   G A+ ++    N P  SY
Sbjct: 164 LLDSGDVLKLLVSHGVNLVLNGHKHVSNA-W-KIDDMVILNSGTATTNRLYGDNSP--SY 219

Query: 268 NLFYIEKK 275
           N   ++ +
Sbjct: 220 NKVLVDDE 227


>gi|293603913|ref|ZP_06686328.1| metallophosphoesterase [Achromobacter piechaudii ATCC 43553]
 gi|292817750|gb|EFF76816.1| metallophosphoesterase [Achromobacter piechaudii ATCC 43553]
          Length = 267

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 84/202 (41%), Gaps = 15/202 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + HF  ++    E A  L   +   N D V ++GDI       +   +  ++  
Sbjct: 3   RILQLSDTHFGTERKPVVEAALDLARSL---NPDLVVVSGDITQRARRAQFAAARKFIER 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     ++L+ + +Y       + G  L P      N  L+  
Sbjct: 60  LSLP--VLTVPGNHDIPLINLFARALNPYGNY-----KRALGAVLEPVF---ENPGLLAI 109

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSS-LYNRMFGI 211
                 P    +G     Q    ++ LR+A + G  R+++ HHP      S L N + G 
Sbjct: 110 GVNTTRPRRHKDGEISDAQIARVAQRLRQA-RPGQLRVVVAHHPVRAKVESDLSNLLNGR 168

Query: 212 QRFQKMIWHEGADLILHGHTHL 233
           +R        G DL+L GH HL
Sbjct: 169 ERALAAWAQAGIDLVLGGHIHL 190


>gi|83815871|ref|YP_446078.1| transcriptional regulator, Icc related protein [Salinibacter ruber
           DSM 13855]
 gi|83757265|gb|ABC45378.1| transcriptional regulator, Icc related protein [Salinibacter ruber
           DSM 13855]
          Length = 267

 Score = 56.2 bits (134), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 112/271 (41%), Gaps = 31/271 (11%)

Query: 39  NWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHD 98
           + HF R       V   L+++I    +D V+++GD+       E   + + L ++G P  
Sbjct: 8   DLHFGR--IADSGVVEALLDEINAAGIDLVAVSGDLTQRARPAEYRAARNLLDALGPP-- 63

Query: 99  ISIVPGNHDAYISGAKEKSLHA----WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCST 154
             +V GNHD Y      K L      ++ +IT D        L P       +A +G ++
Sbjct: 64  TLVVAGNHDVYPWWRPLKRLRTPLERYRQFITED--------LAPTFEA-GGVAALGLTS 114

Query: 155 AIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH---PPVLDTSSLYNRMFGI 211
           A    P    G  G     A  +          F+++++HH   P  +   S +      
Sbjct: 115 AYG--PSIKGGRIGPAD-RAAMRAFFSGTGDDRFKVLVVHHQLHPTAIGPISPHPVARQA 171

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIK----NEKKLIPVVGIASASQKVHSNKPQASY 267
           Q+   +    G DLIL GH H++++  ++      + ++   G A++++      P   Y
Sbjct: 172 QQTLAVAGEVGIDLILCGHLHISAIQPLEIIPGTPRIVVASAGTATSNRWREPTGPINFY 231

Query: 268 NLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD 298
           N+  +E   E +++E +RY   PD     +D
Sbjct: 232 NVVSVEP--EAFSVEERRYV--PDEGRFVRD 258


>gi|197122549|ref|YP_002134500.1| metallophosphoesterase [Anaeromyxobacter sp. K]
 gi|196172398|gb|ACG73371.1| metallophosphoesterase [Anaeromyxobacter sp. K]
          Length = 268

 Score = 56.2 bits (134), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 95/238 (39%), Gaps = 16/238 (6%)

Query: 49  SKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDA 108
           S  +A  L++ +    VDH+ +TGD+      RE   +   LR       +++VPGNHD 
Sbjct: 21  STRLAKGLLDALREIGVDHLVVTGDLTFSGEPREFERAAELLRPFAEAGKLTVVPGNHDV 80

Query: 109 YISGAKEKSLHAWKDYITSDTTCSTGKKLFP----YLRIRNNIALIGCSTA-IATPPFSA 163
           +     E+S+   +            KK  P     + + +   L+   +A     P++ 
Sbjct: 81  WT----EESVETGRFLRALGPDGKGMKKAAPSYPHVVPLGDEAVLVALDSARYGDDPWTT 136

Query: 164 NGYFGQEQAHATSKLLRKANKKGFFRIIMMHH-----PPVLDTSSLYNRM--FGIQRFQK 216
            G  G EQ  A  +L R+  + G   ++  HH     P  + + +   RM      +  +
Sbjct: 137 PGRLGGEQLRAARELAREHARLGRAVLLAFHHHVVLPPERVPSDAHVCRMPLADADQVVR 196

Query: 217 MIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEK 274
           ++       +LHGH H      +       PV+   SAS+       +A   L+ +++
Sbjct: 197 LVAEVPVAAVLHGHRHTAFRVDLPGAAGPTPVLCAGSASRTADEPVRRARAYLYEVDR 254


>gi|319956240|ref|YP_004167503.1| metallophosphoesterase [Nitratifractor salsuginis DSM 16511]
 gi|319418644|gb|ADV45754.1| metallophosphoesterase [Nitratifractor salsuginis DSM 16511]
          Length = 295

 Score = 55.8 bits (133), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 99/234 (42%), Gaps = 17/234 (7%)

Query: 14  HISDIHLSYSP---SFFELSPKRIIGLVNWHFNRKKYF--SKEVANLLINDILLHNVDHV 68
           H SD H   S     + +L  KR IG +N    R +YF  ++E    L      + VD V
Sbjct: 5   HCSDPHFDLSLRSIPWKKLFGKRAIGALNLLGGRGRYFDEAEEKIAALARFKERYGVDLV 64

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHD-ISIVPGNHDAYISGA-KEKSLHAW-KDYI 125
             TGD+       E+  +   L  +  P     I+PGNHD Y +   +    H +   Y+
Sbjct: 65  LCTGDVTALGLTAELENAAELLAPLAQPPKHFIIIPGNHDVYSADVIRGDHFHYYFGQYM 124

Query: 126 TSDTTCSTGKKLFPYLRI-RNNIALIGCSTAIATP-PFSANGYFGQEQAHATSKLLRKAN 183
            +D         +P +R+   +IA++  ++A   P P+ ++GY    Q  A  K+L+   
Sbjct: 125 HTDWPQYAVDGPWPIVRLFSEDIAVVAVNSAKPNPLPWRSDGYIPPAQLEALEKILQDHR 184

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKM-----IWHEGADLILHGHTH 232
            K  +  +M H+   L          G++   +      +  +GA  IL+GH H
Sbjct: 185 IKDRWIFVMTHYAARLANGRPDKPNHGLRNADEFLNVCRLIQKGA--ILNGHVH 236


>gi|168704282|ref|ZP_02736559.1| putative phosphohydrolase [Gemmata obscuriglobus UQM 2246]
          Length = 296

 Score = 55.8 bits (133), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 105/250 (42%), Gaps = 36/250 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSP---KRIIGLVNWHF---NRKKYFSKEVANLLINDILL 62
           M  LAH SDIHL+  P  + +     KR +G VN  F     +  ++ +VA +L  +   
Sbjct: 1   MVRLAHFSDIHLTAQPLGWRVRDTFNKRSVGWVNVRFLGRGARFRYASDVAAVLRREFAT 60

Query: 63  HNVDHVSITGDIVNFTCNREIFTSTHWLRSIGN---PHDISIVPGNHDAYISGAK----- 114
              D +  +GD        E+  +   +  +G+   P  ++ VPGNHD Y   A      
Sbjct: 61  RGFDQLVFSGDASTMGFAAELREAATRI-GVGDDSLPPGLA-VPGNHDLYTGRAIRDRYF 118

Query: 115 EKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPF---SANGYFGQEQ 171
           E +   W+           G +++P+ R   ++ LI  ++  A P F    A G  G  Q
Sbjct: 119 EDAFAPWQH------GQRVGNEVYPFARKVGHVWLIALNS--AKPNFLFWDATGRVGHAQ 170

Query: 172 AHATSKLLRKANKKGFFRIIMMHHPPVLDTSSL---YNRMFGIQRFQKMIWHEGADLILH 228
                +L +  +     RI++ H+P + +  ++   ++R+      +      G  L LH
Sbjct: 171 LDRFRRLCKSLDDGP--RIVVSHYPLLKEGHTVEPRWHRLHDWHAARDAAAECGVSLWLH 228

Query: 229 GHTHLNSLHW 238
           GH H    HW
Sbjct: 229 GHRH----HW 234


>gi|86158130|ref|YP_464915.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774641|gb|ABC81478.1| Metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 268

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 95/240 (39%), Gaps = 16/240 (6%)

Query: 49  SKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDA 108
           S  +A  L++ +    VDH+ +TGD+      RE   +   LR       +++VPGNHD 
Sbjct: 21  SARLAKGLLDALREIGVDHLVVTGDLTFSGEPREFERAAELLRPFAEAGKLTVVPGNHDV 80

Query: 109 YISGAKEKSLHAWKDYITSDTTCSTGKKLFP----YLRIRNNIALIGCSTA-IATPPFSA 163
           +     E+S+   +            KK  P     + + +   L+   +A     P++ 
Sbjct: 81  WT----EESVETGRFLRAIGPDGKGMKKAAPSYPQVVPLGDEAVLVALDSARYGDDPWTT 136

Query: 164 NGYFGQEQAHATSKLLRKANKKGFFRIIMMHH-----PPVLDTSSLYNRM--FGIQRFQK 216
            G  G EQ  A  +L R+  + G   ++  HH     P  + + +   RM      +  +
Sbjct: 137 PGRLGGEQLRAARELAREHARLGRAVLLAFHHHVVLPPERVPSDAHVCRMPLADADQVVR 196

Query: 217 MIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           ++       +LHGH H      +       PV+   SAS+       +A   L+ +++  
Sbjct: 197 LVAEVPIAAVLHGHRHTAFRVDLPGAAGPTPVLCAGSASRTADEPVRRARAYLYEVDRTG 256


>gi|89067405|ref|ZP_01154918.1| possible phospodiesterase [Oceanicola granulosus HTCC2516]
 gi|89046974|gb|EAR53028.1| possible phospodiesterase [Oceanicola granulosus HTCC2516]
          Length = 263

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 84/205 (40%), Gaps = 25/205 (12%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + HF R +    E+   L+  +     D V+I+GD        +   +  +L  
Sbjct: 3   RILHLSDLHFGRDR---AELEAPLLRSVDKLAPDLVAISGDFTQRARVGQFERARRFLEK 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           IG P     VPGNHD  +     ++   WK Y       +    L P      N+ + G 
Sbjct: 60  IGQP--WLAVPGNHDTPLDNLLVRAFAPWKRYRE-----AISDDLEPNFE-NENVVVAGV 111

Query: 153 STAIATPPFS-ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP----PVLDTSSLYNR 207
           +T     PFS   G+  +   +        AN +   RI+M+HHP    P +D   +   
Sbjct: 112 NT---VNPFSWQRGHISRRTVNRVCAAF--ANIERRVRIVMLHHPLQHGPEVDKRLMRGA 166

Query: 208 MFGIQRFQKMIWHEGADLILHGHTH 232
              + R ++     GAD++L GH H
Sbjct: 167 NEALARLEEC----GADIVLSGHLH 187


>gi|328543617|ref|YP_004303726.1| Ser/Thr protein phosphatase family protein [polymorphum gilvum
           SL003B-26A1]
 gi|326413361|gb|ADZ70424.1| Ser/Thr protein phosphatase family protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 284

 Score = 54.3 bits (129), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 94/231 (40%), Gaps = 41/231 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M +LA I+D+HL            R  GL  +  +     ++     L+   L    D V
Sbjct: 7   MTILAQITDLHL------------RPRGLTCYRVSDTNNLAERAIRALLA--LSPRPDAV 52

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI-TS 127
            +TGDI +    RE   + H L  +  P  + ++PGNHD     + +    A+ DY    
Sbjct: 53  VVTGDITDGADAREYALARHILGRL--PMPVYVLPGNHD-----SSDTLRAAFSDYPGIR 105

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D   ++GK    Y      + L+   +++A  PF   G  G EQ     ++L + ++   
Sbjct: 106 DAPTASGK--LHYTADVGGLRLVALDSSVAGKPF---GLLGAEQLAWLDRVLAEDDRPA- 159

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADL--ILHGHTHLNSL 236
             ++ +HHPP+           GIQ    +  H+      +L  H H+  L
Sbjct: 160 --VVAVHHPPM---------ATGIQHMDSIALHDTDAFAAVLSRHAHVERL 199


>gi|310819179|ref|YP_003951537.1| metallophosphoesterase [Stigmatella aurantiaca DW4/3-1]
 gi|309392251|gb|ADO69710.1| Metallophosphoesterase [Stigmatella aurantiaca DW4/3-1]
          Length = 296

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 86/199 (43%), Gaps = 17/199 (8%)

Query: 14  HISDIHLSYSPSFFELSPKRIIGLVNWHF-------NRKKYFSKEVANL--LINDILLHN 64
           H SD+H++    +F L P R +G   W          R + +    A L  +  +   H 
Sbjct: 5   HCSDVHVTGD--YFAL-PLRRLGWRRWLAMVELTVGRRARAYRHAPATLARIAQEAHAHA 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRS-IGNPHDISIVPGNHDAYISGA--KEKSLHAW 121
            DH+ ++GDI  +    E   +   L     +    +++PGNHD +  G     +    +
Sbjct: 62  ADHLILSGDITAYALESEFQGAREALGEWAQDRRRCTVIPGNHDVFTPGGHRSRRFERYF 121

Query: 122 KDYITSDTTCSTGKKLFPYLR-IRNNIALIGCSTA-IATPPFSANGYFGQEQAHATSKLL 179
              + SD      +  FP++R +    A++G  +A +   P  A+G+ G  Q    + ++
Sbjct: 122 GHLLESDLPEHCREGAFPFVRLVGEGAAVVGLLSARVPFMPGIAHGWVGPAQLEGLAAVV 181

Query: 180 RKANKKGFFRIIMMHHPPV 198
           +    +G   ++++HH P+
Sbjct: 182 KDPRLEGRALLVVVHHAPL 200


>gi|83647079|ref|YP_435514.1| phosphohydrolase [Hahella chejuensis KCTC 2396]
 gi|83635122|gb|ABC31089.1| predicted phosphohydrolase [Hahella chejuensis KCTC 2396]
          Length = 275

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 109/259 (42%), Gaps = 27/259 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           +II L + HF  + +  +E     +ND+     + +  +GDI       +   +  +L  
Sbjct: 2   QIIQLSDPHFGTEDWTVQEALVRTLNDM---RPELLLFSGDITQRATRLQFAAARAFLER 58

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCST-GKKLFPYLRIRNNIALI- 150
           I    ++  VPGNHD  +     +    +K Y      C   G  L P     NN+ALI 
Sbjct: 59  I-EADNVLAVPGNHDIPLFNLWSRLTAPYKKY------CEIFGTDLEP--EFENNLALIV 109

Query: 151 GCSTAIATPPFS-ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRM 208
           G +T   T  +   +G    ++A A ++ L  A  K   R+++ HHP  V+  S   N +
Sbjct: 110 GVNT---THKYRHVDGEISPQRADAVARRLASAPDK--LRVVVAHHPCQVVLPSDQKNLL 164

Query: 209 FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP----VVGIASA-SQKVHSNKP 263
            G +   K     G DL+L GH H   +  ++      P    V+   +A S +V S KP
Sbjct: 165 IGREYALKAWIEAGVDLVLGGHIHYPFILPLRESFPEAPSGVFVMQAGTATSPRVRSGKP 224

Query: 264 QASYNLFYIEKKNEYWTLE 282
             S+N   + +      LE
Sbjct: 225 N-SFNRILVRRDRRMTLLE 242


>gi|254500762|ref|ZP_05112913.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
 gi|222436833|gb|EEE43512.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
          Length = 278

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 77/191 (40%), Gaps = 30/191 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++AHI+D+HL            R  GL  +  +     + E A L +N  L    D V
Sbjct: 1   MALIAHITDLHL------------RPRGLACYRVSDTNMLA-ERAILALNG-LTPRPDAV 46

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ + +  RE   +   L  +  P  + ++PGNHD      +E S     D     
Sbjct: 47  VLTGDLTDKSDPREYALARQILSRLAMP--VFMIPGNHDGSADMRREMSGFPGMDGDVDG 104

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
             C T +          ++ LI   T I   P   NG  G  Q +  S  L   N+    
Sbjct: 105 KLCYTAEI--------GDVRLIALDTNI---PGKPNGELGTPQLNWLSDRLSDDNRP--- 150

Query: 189 RIIMMHHPPVL 199
            +I +HHPP L
Sbjct: 151 TLIALHHPPAL 161


>gi|317402018|gb|EFV82617.1| DNA repair exonuclease [Achromobacter xylosoxidans C54]
          Length = 255

 Score = 52.8 bits (125), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 107/258 (41%), Gaps = 19/258 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+   + HF  ++    E A  L   +   + + V I+GDI       +   +  ++  
Sbjct: 3   RILQFSDTHFGTERKPVVEAALDLARSL---SPELVVISGDITQRARRGQFAAARKFIER 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     ++L+ + +Y       + G  L P     + +  IG 
Sbjct: 60  LSLP--VLAVPGNHDIPLFNLFARALNPYGNY-----KRALGAVLEPVYE-SDGLLAIGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLY-NRMFGI 211
           +T    P    +G     Q    ++ LR+A + G  R+++ HHP      S + N + G 
Sbjct: 112 NTT--RPRRRKDGEISDAQIARVAQRLRQA-RPGQLRVVVAHHPMRAKVESDHSNLLIGR 168

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP--VVGIASA-SQKVHSNKPQASYN 268
           QR        G DLIL GH HL  +     +  +    VV   +A S++V  N P  S N
Sbjct: 169 QRALAAWAQAGIDLILGGHIHLPYVLPASVDPAVAAGWVVQAGTACSRRVRGNIPN-SVN 227

Query: 269 LFYIEKKNEYWTLEGKRY 286
           L   E   +      +R+
Sbjct: 228 LISCETTGDTRVCHVERW 245


>gi|325958717|ref|YP_004290183.1| metallophosphoesterase [Methanobacterium sp. AL-21]
 gi|325330149|gb|ADZ09211.1| metallophosphoesterase [Methanobacterium sp. AL-21]
          Length = 250

 Score = 52.4 bits (124), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 97/230 (42%), Gaps = 24/230 (10%)

Query: 48  FSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD 107
           F + + +  I++I   + D   +TGDI       E      +L  I +P  I +VPGNHD
Sbjct: 17  FQENLLDKAIDEINSVDPDVTIVTGDITENGYYLEYERVVPFLDRIKSP--ILVVPGNHD 74

Query: 108 AYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYF 167
           A   G +      ++D I +       KK        + + +IG  +   + P    G  
Sbjct: 75  ARHVGDE-----CFEDLIKNRYGTLEDKK--------HGLKVIGLDS---SEPDLDYGRI 118

Query: 168 GQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADL 225
           G+ Q       LR A+++  ++II +HH   PV  T    N +       + +    ADL
Sbjct: 119 GRSQQSWMENELRIADEENLYKIIALHHHIIPVPKTGRERNVLSDAGDILQSLMKGKADL 178

Query: 226 ILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKK 275
           +L GH H+  + W+  +   I    ++S   +    K  +SYN   IE +
Sbjct: 179 VLSGHKHMPHV-WMMEDTTFITAGTVSSLRLR---GKALSSYNTIDIEDE 224


>gi|315230213|ref|YP_004070649.1| lacZ expression regulatory protein [Thermococcus barophilus MP]
 gi|315183241|gb|ADT83426.1| lacZ expression regulatory protein [Thermococcus barophilus MP]
          Length = 507

 Score = 52.4 bits (124), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 110/264 (41%), Gaps = 49/264 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++  P+F                  K Y      +L++N++   + D V
Sbjct: 1   MIRIAHISDTHITQDPAF------------------KSY----AYDLIVNEVNRSDFDLV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ N     E   +++ +R I  P  + ++PGNHDA   G +      ++ YI   
Sbjct: 39  IHTGDVTNQGLKEEYEHASYLIRKIEKP--LIVLPGNHDARNVGYE-----LFEKYIGP- 90

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                   L+     R+++ +I   + I  P  S     G +      KL   ++KK  F
Sbjct: 91  --------LYGVYE-RDDLVIIWIDSTI--PDLSDGRVGGYKFRWLKEKLEEYSHKK--F 137

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +I+  HH   P+ DT    N ++       ++     +L L GH H+ +++ I++    +
Sbjct: 138 KIVAAHHHLVPLPDTGRERNVLYNAGDVLDLLLRHEVNLYLCGHKHVPNVYSIED----L 193

Query: 247 PVVGIASASQKVHSNKPQASYNLF 270
            VV     S +        SYN+ 
Sbjct: 194 VVVNAGCTSCRKTRKGDVNSYNII 217


>gi|156740243|ref|YP_001430372.1| metallophosphoesterase [Roseiflexus castenholzii DSM 13941]
 gi|156231571|gb|ABU56354.1| metallophosphoesterase [Roseiflexus castenholzii DSM 13941]
          Length = 278

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 119/296 (40%), Gaps = 64/296 (21%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           + +VL HISD+H                          + F   VA+ L  +      D 
Sbjct: 1   MRYVLMHISDLHAG------------------------RTFHPHVADQLTREARDLRPDL 36

Query: 68  VSITGDIVNFTCNREIFTS-----THWLRSIGNPHDISIVPGNHDAYISGAKEK---SLH 119
           + I+GD+V     R  F +     T +L+ +  P    IVPGNHD  +    E+    L 
Sbjct: 37  LIISGDLVQ----RADFVAQWKAITQYLQQLPEPR--LIVPGNHDVPLFHLVERFFRPLD 90

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
            ++ +I++D        L P    R  I ++G ++A         GY   EQ    ++L 
Sbjct: 91  RYRRFISTD--------LNPVFE-RPGIVVVGGNSAHGL--TIDGGYVSPEQQRTMAQLF 139

Query: 180 RKANKKGFFRIIMMHH----PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNS 235
            +       +I ++HH    PP  +  S+      + R   M+   G D++L GH H++ 
Sbjct: 140 VRYPDD-VCKIAVLHHGVVRPPGCEKRSIVRNATDVTR---MLEQSGVDVLLCGHHHVSY 195

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSN-KPQASYNLFYIE------KKNEYWTLEGK 284
           +    + K+ +      S S++V +  + + +Y++  IE       +  Y  + G+
Sbjct: 196 VGVAGSAKRFVVCQSGTSTSRRVRAGERGRNAYSVLTIEDATIHISQRRYVEMSGR 251


>gi|301336319|ref|ZP_07224521.1| hypothetical protein CmurM_00750 [Chlamydia muridarum MopnTet14]
          Length = 290

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 94/235 (40%), Gaps = 12/235 (5%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLIND 59
           M K+ +TI F L H SDIH    P + F+   KR  GL+        + +  +       
Sbjct: 1   MPKKPSTI-FRLIHCSDIHFCVFPKNPFQCFNKRFKGLLRQLIGGVSFRALAIFQRFPQL 59

Query: 60  ILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI-SGAKEKSL 118
           I     D V +TGD+     + E   +  +L  I     + IVPGNHD Y     K+++ 
Sbjct: 60  IEQLEADGVCVTGDVTITALDSEFRLAKEFLSRIETIAPVYIVPGNHDVYTYRSLKKQTF 119

Query: 119 HAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
           +++      +    T +  F  L     + L+ CS       ++ANG     Q     + 
Sbjct: 120 YSY----FPNKELQTHRIAFQRLTSTWWLVLLDCSCFNGW--YAANGEVTSSQLLDLERF 173

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH-EGADLILHGHTH 232
           L          +I+ +H P+  T+   + +      + ++ H     L LHGH H
Sbjct: 174 LSSLPPSD--HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMHFPSVRLYLHGHDH 226


>gi|94969892|ref|YP_591940.1| metallophosphoesterase [Candidatus Koribacter versatilis Ellin345]
 gi|94551942|gb|ABF41866.1| metallophosphoesterase [Candidatus Koribacter versatilis Ellin345]
          Length = 235

 Score = 50.8 bits (120), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 89/216 (41%), Gaps = 34/216 (15%)

Query: 33  RIIGLVNWHFNRKKYFS-KEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           RI  L + HF  + Y   +E  N +  +      D + + GD+ NF    EI +  + L 
Sbjct: 2   RIAALADIHFTPQSYDRIREQMNRVREE-----ADILVLAGDLTNFGKPEEIESMLNSLV 56

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS---------DTTCSTGKKLFPYLR 142
            I  P  I  V GNHD Y SG  E+ +                  D     G K FP   
Sbjct: 57  RIRIP--IVAVLGNHD-YESGKSEQLMKMLVQEGVKLLDGTGYERDGVGFAGTKGFPGGF 113

Query: 143 IRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK-KGFFRIIMMHHPPVLDT 201
            R      G  TA   P   A   F Q     + KL R  ++ +   RI+++H+ P+  T
Sbjct: 114 GR------GALTAFGEPEVKA---FVQAAIDESLKLERALSQLRTPKRIVVIHYAPIGGT 164

Query: 202 -----SSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
                + +Y  + G  R  ++I   GADL+LHGH H
Sbjct: 165 VQGEPTEIYPYL-GSSRLMEVIDRHGADLVLHGHAH 199


>gi|33592001|ref|NP_879645.1| DNA repair exonuclease [Bordetella pertussis Tohama I]
 gi|33571645|emb|CAE41137.1| probable DNA repair exonuclease [Bordetella pertussis Tohama I]
 gi|332381417|gb|AEE66264.1| DNA repair exonuclease [Bordetella pertussis CS]
          Length = 271

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 95/234 (40%), Gaps = 20/234 (8%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D V + GDI       +   +  +++++  P  +  VPGNHD  +     +    + +Y 
Sbjct: 33  DLVVLGGDITQRARRGQFAAARRFIQALQRP--VLAVPGNHDIPLFNLAARLFDPYGNY- 89

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 + G  L P       +A+   ST  A      NG   + QA   ++ LR A + 
Sbjct: 90  ----RRALGAVLEPVYEDDRLLAIGVNSTRAAR---RKNGEVSRTQAQRVAQRLRDA-RP 141

Query: 186 GFFRIIMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHL---NSLHWIK 240
           G  R++ +HHP   +  S   N + G + F    W + G DLIL GH HL     LH   
Sbjct: 142 GQLRVVALHHPVHAMVESDQRNLLIG-REFAVPAWVDAGVDLILGGHIHLPYVAPLHGKA 200

Query: 241 NE--KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
            E  ++   V    + S++V    P  S NL     + +      +R+    DS
Sbjct: 201 GEAGRRAWTVQAGTAVSRRVRGRVPN-SVNLIDYAAQADSPACTVQRWDFQTDS 253


>gi|148654842|ref|YP_001275047.1| metallophosphoesterase [Roseiflexus sp. RS-1]
 gi|148566952|gb|ABQ89097.1| metallophosphoesterase [Roseiflexus sp. RS-1]
          Length = 274

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 103/251 (41%), Gaps = 34/251 (13%)

Query: 46  KYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTS-----THWLRSIGNPHDIS 100
           + F  +VA  L  +      D V ++GD+V     R  FTS       +L+ +  P    
Sbjct: 10  RTFHPQVAEQLAREAHDLRPDLVIVSGDLVQ----RADFTSQWEQIVQYLQRLPEPR--L 63

Query: 101 IVPGNHDAYISGAKEK---SLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIA 157
           I+PGNHD  +    E+    L  ++ YI+SD        L P    R  + ++G ++A  
Sbjct: 64  IIPGNHDVPLFHLFERFFRPLDRYRRYISSD--------LNPVFE-RPGLVVVGGNSAYG 114

Query: 158 TPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH----PPVLDTSSLYNRMFGIQR 213
                  GY   +Q  A  +   +       +I ++HH    PP  +  S+         
Sbjct: 115 W--TIDGGYVDPDQQQAMERRFARYPDD-VCKIAVLHHGVVRPPGCEQRSIVR---NADE 168

Query: 214 FQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSN-KPQASYNLFYI 272
             +M+   G D++L GH H+  +      +K I      SAS+++    + + +YN+  I
Sbjct: 169 VTQMLERSGVDVLLCGHHHVAYVDVAGTARKFIVCQSGTSASRRIREGTRGKNAYNVLII 228

Query: 273 EKKNEYWTLEG 283
           E    + +  G
Sbjct: 229 EDSTIHISQRG 239


>gi|33597917|ref|NP_885560.1| DNA repair exonuclease [Bordetella parapertussis 12822]
 gi|33574346|emb|CAE38682.1| probable DNA repair exonuclease [Bordetella parapertussis]
          Length = 271

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 95/234 (40%), Gaps = 20/234 (8%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D V + GDI       +   +  +++++  P  +  VPGNHD  +     +    + +Y 
Sbjct: 33  DLVVLGGDITQRARRGQFAAARRFIQALQRP--VLAVPGNHDIPLFNLAARLFDPYGNY- 89

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 + G  L P       +A+   ST  A      NG   + QA   ++ LR A + 
Sbjct: 90  ----RRALGAVLEPVYEDDRLLAIGVNSTRAAR---RKNGEVSRTQAQRVAQRLRDA-RP 141

Query: 186 GFFRIIMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHL---NSLHWIK 240
           G  R++ +HHP   +  S   N + G + F    W + G DLIL GH HL     LH   
Sbjct: 142 GQLRVVALHHPVHAMVESDQRNLLIG-REFAVPAWVDAGVDLILGGHIHLPYVAPLHGKA 200

Query: 241 NE--KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
            E  ++   V    + S++V    P  S NL     + +      +R+    DS
Sbjct: 201 GEAGRRAWAVQAGTAVSRRVPGRVPN-SVNLIDYAAQADSPACTVQRWDFQTDS 253


>gi|15834755|ref|NP_296514.1| icc-related protein [Chlamydia muridarum Nigg]
 gi|270284922|ref|ZP_06194316.1| icc-related protein [Chlamydia muridarum Nigg]
 gi|270288949|ref|ZP_06195251.1| icc-related protein [Chlamydia muridarum Weiss]
 gi|7190171|gb|AAF39013.1| icc-related protein [Chlamydia muridarum Nigg]
          Length = 290

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 124/303 (40%), Gaps = 24/303 (7%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLIND 59
           M ++ +T+ F L H SDIH    P + F+   KR  GL+        + +  ++      
Sbjct: 1   MQEKPSTV-FRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLVGGVSFRAPAISQRFPQL 59

Query: 60  ILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
           +     + V +TGD+     + E   +  +L  I +   + IVPGNHD Y   A +K   
Sbjct: 60  VAQLEANGVCVTGDVTITALDSEFRLAKEFLSRIESIAPVYIVPGNHDVYTYRALKK--Q 117

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
            +  Y   +    T +  F  L     + L+ CS        +ANG     Q  A  + L
Sbjct: 118 TFYSYF-PNKELQTHRIAFQKLTPNWWLVLLDCSCFNGW--CAANGEVTDSQIVALEQFL 174

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHW 238
             A+      +I+ +H P+  T+   + +      + ++ +     + LHGH H      
Sbjct: 175 --ASLPSLEHVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRMYLHGHDH------ 226

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY----WTLEGKRYTLSPDSLS 294
              E   +P + + S S  + SN   A +++  +  + EY     +L     T SP  +S
Sbjct: 227 -HVEIDHLPPLVVNSGSLTLPSN---ARFHIIDLYPEGEYRISTASLTNLTETDSPLKIS 282

Query: 295 IQK 297
           I++
Sbjct: 283 IEE 285


>gi|187477535|ref|YP_785559.1| metallo-phosphoesterase [Bordetella avium 197N]
 gi|115422121|emb|CAJ48645.1| putative metallo-phosphoesterase [Bordetella avium 197N]
          Length = 260

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 90/206 (43%), Gaps = 23/206 (11%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ + + HF R+     +   +LI  +   + D V ++GDI       +   +  +++ 
Sbjct: 3   RVLHISDTHFGRQVVPVVQALEVLIQRL---DPDLVLLSGDITQRARRGQFAAARQFVQG 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     +  + + +Y  +      G  L P      ++ ++G 
Sbjct: 60  LRRP--VLTVPGNHDMPLFNLAARLFNPYGNYRRA-----MGVNLEPVFD-GEHLLVVGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH----PPVLDTSSLYNRM 208
           +++   P    +G    EQ    +  LR A + G  RI+M+HH    P   D+++L  R 
Sbjct: 112 NSS--RPSRRKHGEVSPEQIERVASRLRAA-RPGQLRIVMLHHPVRGPKAGDSANLLIR- 167

Query: 209 FGIQRFQKMIWHE-GADLILHGHTHL 233
              +      W + GAD I  GH HL
Sbjct: 168 ---RELAVPAWVDAGADFIAAGHAHL 190


>gi|268316953|ref|YP_003290672.1| metallophosphoesterase [Rhodothermus marinus DSM 4252]
 gi|262334487|gb|ACY48284.1| metallophosphoesterase [Rhodothermus marinus DSM 4252]
          Length = 273

 Score = 50.1 bits (118), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 99/248 (39%), Gaps = 23/248 (9%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ L + HF R    S  V   L+ ++     D V ++GD+      R+   +  +L ++
Sbjct: 3   IVHLSDLHFGR--LASGAVVEDLLVEVRRQRPDLVVVSGDLTQRARPRQFRAARAFLEAL 60

Query: 94  GNPHDISIVPGNHDAYI----SGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIAL 149
             P    +VPGNHD Y          + L  ++ Y+T D        L P   + + +A+
Sbjct: 61  PAP--TLVVPGNHDVYPWWRPLSRLVRPLARYRRYLTDD--------LRPAF-VHDAVAV 109

Query: 150 IGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
           +G +TA         G    E                   +++ HH   L     ++   
Sbjct: 110 LGLNTAHGA--TVKGGRLSAEDLAYLQTFFATVPPSAVRVLVIHHHLVQLQAVGPHDVAR 167

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWI----KNEKKLIPVVGIASASQKVHSNKPQA 265
           G +R  ++I   G + IL GH H+  +  +       + +I   G A++S+    ++ + 
Sbjct: 168 GARRALEVIARAGIEFILCGHLHVAHVEPVVVQPDGHRVVIVSAGTATSSRGRGPHRNRN 227

Query: 266 SYNLFYIE 273
            YN+  IE
Sbjct: 228 FYNVLRIE 235


>gi|296532717|ref|ZP_06895403.1| metallophosphoesterase [Roseomonas cervicalis ATCC 49957]
 gi|296266955|gb|EFH12894.1| metallophosphoesterase [Roseomonas cervicalis ATCC 49957]
          Length = 282

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 87/210 (41%), Gaps = 27/210 (12%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +RI  + + HF R     + VA  LI+ +     D V I+GD+     +RE   +  ++ 
Sbjct: 4   RRIDHISDLHFGR---VDERVAAALIDTLNAEPADLVVISGDLTMRARSREYRAACAFMS 60

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHA---WKDYITSDTTCSTGKKLFPYLRIRNNIA 148
           ++  P    +VPGNHD       E+ L     W  ++  +T         P+ R  +++A
Sbjct: 61  ALKAPQ--IVVPGNHDITNYWPWERFLDPFGRWHRFVGGETE--------PFWR-DDHLA 109

Query: 149 LIGCSTAI-ATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-----PVLDTS 202
           +IG +T + A P  +      +           +    G FRI++ HHP        DT 
Sbjct: 110 VIGLNTVVRAAPHLAWEEGRVKRHRLQRLLRRLEELPPGLFRIVVAHHPFLAPEDAPDTP 169

Query: 203 SLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
             +     ++  Q+     G  LIL GH H
Sbjct: 170 LAHRAAPALEVLQRA----GVRLILSGHLH 195


>gi|259417953|ref|ZP_05741872.1| metallophosphoesterase [Silicibacter sp. TrichCH4B]
 gi|259346859|gb|EEW58673.1| metallophosphoesterase [Silicibacter sp. TrichCH4B]
          Length = 267

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 86/216 (39%), Gaps = 18/216 (8%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           KR++ L + HF R +    E+ + LI  I     D V+I+GD+     + +   +   + 
Sbjct: 2   KRLLHLSDLHFGRDR---PELLDPLIEQINGLAPDLVAISGDLTQRARDWQFMRAREMID 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            I  P    +VPGNHD  +    E++L  W+ Y     +C    ++        + +++G
Sbjct: 59  RIKAP--CLVVPGNHDTPLDNLFERALMPWRRYRKW-ISCDLEPQIHDV-----DWSVVG 110

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI 211
            ++    P     G F             +  +   +RI++ HHP             G 
Sbjct: 111 VNS--VNPLGWQRGRFSLGDIRRVQTCFAQTPEDA-YRIVVAHHPLEHQPGETKRLTRGA 167

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           Q  +  +   G D+IL GH H     W  +   ++P
Sbjct: 168 QHARAELSRIGTDIILSGHLH----SWYADTFAMVP 199


>gi|329943207|ref|ZP_08291981.1| calcineurin-like phosphoesterase family protein [Chlamydophila
           psittaci Cal10]
 gi|332287787|ref|YP_004422688.1| putative phosphohydrolase [Chlamydophila psittaci 6BC]
 gi|313848359|emb|CBY17363.1| conserved hypothetical protein [Chlamydophila psittaci RD1]
 gi|325506738|gb|ADZ18376.1| putative phosphohydrolase [Chlamydophila psittaci 6BC]
 gi|328814754|gb|EGF84744.1| calcineurin-like phosphoesterase family protein [Chlamydophila
           psittaci Cal10]
 gi|328915045|gb|AEB55878.1| Ser/Thr protein phosphatase family protein family [Chlamydophila
           psittaci 6BC]
          Length = 293

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 102/264 (38%), Gaps = 36/264 (13%)

Query: 12  LAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           + HISD+H    P +      KR  G++   F    + S  +A    +  +    D + I
Sbjct: 11  IIHISDVHFCVFPRNPLTCFNKRFKGVLRQVFGGVTFQSSTIAKRFPDLAVKLQADSICI 70

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD      ++E   +  ++ ++     + ++PGNHD Y   A ++              
Sbjct: 71  TGDFSLTALDKEFLLAQDFVHTLAQNASVYVLPGNHDVYTQQALDQ-------------- 116

Query: 131 CSTGKKLFPYLRIRNN------------IALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
             T    FP ++++N             + L+ CS       FSANG     Q       
Sbjct: 117 -KTFYNYFPNIQLQNEQISFNKLMDHWWLVLLDCSCLNGW--FSANGMIKSSQISILENF 173

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMI-WHEGADLILHGHTHLNSLH 237
           +     +    II+ +H P+L T    + +      Q ++  +    L LHGH H  +++
Sbjct: 174 ILSLPPQE--NIIIANHYPLLPTKDPSHDLINHLLLQHVLKKYPNVRLYLHGHNHQAAVY 231

Query: 238 WIKNEKKLIPVVGIASASQKVHSN 261
              N K   P + + S S  + SN
Sbjct: 232 ---NFKDHAPNMILNSGSVSLPSN 252


>gi|288958245|ref|YP_003448586.1| 3',5'-cyclic-nucleotide phosphodiesterase [Azospirillum sp. B510]
 gi|288910553|dbj|BAI72042.1| 3',5'-cyclic-nucleotide phosphodiesterase [Azospirillum sp. B510]
          Length = 291

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 86/208 (41%), Gaps = 25/208 (12%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           KR+  + + HF R       V + L++D+     D + I+GD V     R    +  +LR
Sbjct: 2   KRLAHISDLHFGR---IDPRVVDGLLSDLTAQAPDLIVISGDFVQRAKPRHFEEARAFLR 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEK---SLHAWKDYITSDTTCSTGKKLFPYLRIRNNIA 148
            +  P+    VPGNHD  +     +       ++ YIT+D +          L I + +A
Sbjct: 59  KLPFPY--MAVPGNHDIPVYNVFRRFTDPFGHYRTYITNDLSP---------LHIDDELA 107

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP----PVLDTSSL 204
           ++G +TA       + G   + Q     ++      +  F+++  HHP    P L  + L
Sbjct: 108 VLGINTARPVIMDFSEGRMNRRQITRVREVF-CGMPETVFKVLFTHHPFLPPPDLPRTQL 166

Query: 205 YNRMFGIQRFQKMIWHEGADLILHGHTH 232
             R    +     +   G DL+L GH H
Sbjct: 167 VGRH---KLVLPALESCGVDLLLAGHLH 191


>gi|307942373|ref|ZP_07657724.1| phosphohydrolase [Roseibium sp. TrichSKD4]
 gi|307774659|gb|EFO33869.1| phosphohydrolase [Roseibium sp. TrichSKD4]
          Length = 306

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 95/239 (39%), Gaps = 44/239 (18%)

Query: 3   KRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL 62
           KR    M ++A ISD+HL            R  G   +  +    F++     L N  L 
Sbjct: 26  KRDCPFMTLIAQISDLHL------------RPRGATCFRVSDTNMFAERAVLALKN--LP 71

Query: 63  HNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWK 122
              D V +TGD+ +    RE   +   L  +  P  + +VPGNHD  ++ A+     A+K
Sbjct: 72  QMPDAVVVTGDLTDGNDPREYDLAREILSRL--PMPVYVVPGNHDGTLAMAQ-----AFK 124

Query: 123 DYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
           DY       +  K    Y      + L+   ++I   P+   G  G++Q       L  A
Sbjct: 125 DY--PGIRAADQKPKLSYTAQIGELQLVALDSSIPGKPY---GQIGEDQLLWLEAAL-SA 178

Query: 183 NKKGFFRIIMMHHPPV------LDTSSLYNR-MFG--IQRFQKMIWHEGADLILHGHTH 232
           N      +I +HHPP+      +DT  L +    G  +QR      H     I+ GH H
Sbjct: 179 NTAP--TLIAVHHPPIQTGMHFMDTIGLKDADALGNVVQR------HSHVKRIMCGHAH 229


>gi|288932603|ref|YP_003436663.1| metallophosphoesterase [Ferroglobus placidus DSM 10642]
 gi|288894851|gb|ADC66388.1| metallophosphoesterase [Ferroglobus placidus DSM 10642]
          Length = 373

 Score = 49.3 bits (116), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 89/204 (43%), Gaps = 30/204 (14%)

Query: 33  RIIGLVNWHFNRKKYFSK-EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +I+ + + HF  +   SK E A   IN+I     D V +TGD+  +  + E+  +   L 
Sbjct: 2   KIVHISDLHFGEELVRSKVEKAIKQINEI---EPDLVVVTGDLSCWGIHSELREAYEALE 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            + +  D  +VPGNHDA  +G +   L+               KK++      + + +IG
Sbjct: 59  KLKS--DYFVVPGNHDARNNGIEFFELY-----------FGERKKIYK----DSEVVIIG 101

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMF 209
             +   T P   +GY G EQ     +  RK        ++ +HH   P+ DT    N + 
Sbjct: 102 VDS---TQPDIDDGYIGFEQRRWIEENFRKDR----INVLALHHHIVPIPDTGRERNVLI 154

Query: 210 GIQRFQKMIWHEGADLILHGHTHL 233
                 +M+ + G  L+L GH H+
Sbjct: 155 DAGEVVEMLINLGFALVLAGHRHM 178


>gi|33602822|ref|NP_890382.1| DNA repair exonuclease [Bordetella bronchiseptica RB50]
 gi|33577264|emb|CAE35821.1| probable DNA repair exonuclease [Bordetella bronchiseptica RB50]
          Length = 271

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 73/170 (42%), Gaps = 14/170 (8%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D V + GDI       +   +  +++++  P  +  VPGNHD  +     +    + +Y 
Sbjct: 33  DLVVLGGDITQRARRGQFAAARRFIQALQRP--VLAVPGNHDIPLFNLAARLFDPYGNY- 89

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 + G  L P       +A+   ST  A      NG   + QA   ++ LR A + 
Sbjct: 90  ----RRALGAVLEPVYEDDRLLAIGVNSTRAAR---RKNGEVSRAQAQRVAQRLRDA-RP 141

Query: 186 GFFRIIMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHL 233
           G  R++ +HHP   +  S   N + G + F    W + G DLIL GH HL
Sbjct: 142 GQLRVVALHHPVHAMVESDQRNLLIG-REFAVPAWVDAGVDLILGGHIHL 190


>gi|269302686|gb|ACZ32786.1| Ser/Thr protein phosphatase family protein [Chlamydophila
           pneumoniae LPCoLN]
          Length = 295

 Score = 48.9 bits (115), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 91/223 (40%), Gaps = 9/223 (4%)

Query: 12  LAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           + HISD+H    P +      KR+ GL+   F    + +  +       +     D V I
Sbjct: 11  IIHISDVHFHVLPVNPVHCFNKRLKGLLRKVFGLVHFQATTIGQRFPKVVRSLGADSVCI 70

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD      + E   + H++ ++     + ++PGNHD Y      KSL A + + T    
Sbjct: 71  TGDFSLTAMDGEFLLAKHFVETLAKHSSVYLLPGNHDVY----TPKSL-AQQTFYTHFPN 125

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               +    + +I ++  LI    +     FSANG     Q  A    L   + +    +
Sbjct: 126 DQLQQNKVSFHKITDHWWLILLDCSCLNGWFSANGVVHLAQISAIETFLLSLSPEE--NV 183

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMI-WHEGADLILHGHTH 232
           I+ +H P+L + +  + +      Q ++  +    L LHGH H
Sbjct: 184 IIANHYPLLSSQNPSHDLINNTHLQNVLKKYPKVRLYLHGHEH 226


>gi|255349151|ref|ZP_05381158.1| hypothetical protein Ctra70_04070 [Chlamydia trachomatis 70]
 gi|255503688|ref|ZP_05382078.1| hypothetical protein Ctra7_04065 [Chlamydia trachomatis 70s]
 gi|255507368|ref|ZP_05383007.1| hypothetical protein CtraD_04050 [Chlamydia trachomatis D(s)2923]
 gi|296439093|gb|ADH21246.1| hypothetical protein E11023_03990 [Chlamydia trachomatis E/11023]
          Length = 290

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 120/295 (40%), Gaps = 25/295 (8%)

Query: 10  FVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           F L H SDIH    P + F+   KR  GL+        + +  ++      +     D V
Sbjct: 9   FRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLIGGVSFQAFAISQRFPQLVKQLEADSV 68

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGA-KEKSLHAWKDYITS 127
            +TGD+     + E   +  +L  + +   + IVPGNHD Y   A K+++ +++      
Sbjct: 69  CVTGDMTITALDTEFRFAKEFLSRVESVAPVYIVPGNHDVYTHRALKKQTFYSYFPNKEL 128

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
            T     KKL P       + L+ CS       ++ANG     Q  A  + L        
Sbjct: 129 QTHRIAFKKLTPTWW----LVLLDCSCFNGW--YTANGEVTDSQLLALEQFLSSLPASE- 181

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLI 246
             +I+ +H P+  T+   + +      + ++ +     L LHGH H   L         +
Sbjct: 182 -HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRLYLHGHDHYVELDH-------L 233

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYW----TLEGKRYTLSPDSLSIQK 297
           P + + S S  + SN   A +++  +  +  Y      L   + T +P ++SI++
Sbjct: 234 PPLVVNSGSLTLPSN---ARFHIIDLHPEGGYQITTAALTNLKETSTPLTISIEE 285


>gi|254417705|ref|ZP_05031429.1| Ser/Thr protein phosphatase family protein [Brevundimonas sp. BAL3]
 gi|196183882|gb|EDX78858.1| Ser/Thr protein phosphatase family protein [Brevundimonas sp. BAL3]
          Length = 283

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 102/247 (41%), Gaps = 31/247 (12%)

Query: 51  EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI 110
           E A+   ND++L       ITGDI       E   +  W+R++  P  + +  GNHD   
Sbjct: 25  EYAHATPNDLVL-------ITGDITQKGYPVEFRAAGEWMRAMPEPRFVIV--GNHDVPY 75

Query: 111 SGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTA---IATPPFSANGYF 167
                +  H W+ + T     +TG          + + + G  TA    A P +S  G  
Sbjct: 76  WSPVARLFHPWRAFET-----ATGFPAHDGQFCNDTVMVRGVVTARGWQARPNWS-KGVI 129

Query: 168 GQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG-IQRFQK--MIWHE-GA 223
             +Q    ++ LR+A   G  RI+  HHP V     +   M G ++R  +  +I+ E G 
Sbjct: 130 DLDQTRRAAEALRQA-PIGALRILACHHPLV---EMIGTPMTGDVKRGDEAALIFAEAGV 185

Query: 224 DLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKP---QASYNLFYIEKKNEYWT 280
           DLI+ GH H+     I    +    VG  + S +   + P   Q  ++   I      W 
Sbjct: 186 DLIMTGHVHVPFALPIDLADRCSYAVGCGTLSHRERGSPPGFNQVDWDARTITVTALAW- 244

Query: 281 LEGKRYT 287
            +G+ Y+
Sbjct: 245 -DGRGYS 250


>gi|15605487|ref|NP_220273.1| phosphohydrolase [Chlamydia trachomatis D/UW-3/CX]
 gi|76789496|ref|YP_328582.1| Icc family phosphohydrolase [Chlamydia trachomatis A/HAR-13]
 gi|166154096|ref|YP_001654214.1| hypothetical protein CTL0123 [Chlamydia trachomatis 434/Bu]
 gi|166154971|ref|YP_001653226.1| hypothetical protein CTLon_0123 [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|237803184|ref|YP_002888378.1| hypothetical protein JALI_7591 [Chlamydia trachomatis B/Jali20/OT]
 gi|237805105|ref|YP_002889259.1| hypothetical protein CTB_7591 [Chlamydia trachomatis B/TZ1A828/OT]
 gi|255311588|ref|ZP_05354158.1| hypothetical protein Ctra62_04000 [Chlamydia trachomatis 6276]
 gi|255317889|ref|ZP_05359135.1| hypothetical protein Ctra6_03995 [Chlamydia trachomatis 6276s]
 gi|301335334|ref|ZP_07223578.1| hypothetical protein CtraL_00820 [Chlamydia trachomatis L2tet1]
 gi|3329215|gb|AAC68349.1| phosphohydrolase [Chlamydia trachomatis D/UW-3/CX]
 gi|76168026|gb|AAX51034.1| phosphohydrolase, Icc family [Chlamydia trachomatis A/HAR-13]
 gi|165930084|emb|CAP03567.1| conserved hypothetical protein [Chlamydia trachomatis 434/Bu]
 gi|165930959|emb|CAP06521.1| conserved hypothetical protein [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|231273405|emb|CAX10320.1| conserved hypothetical protein [Chlamydia trachomatis B/TZ1A828/OT]
 gi|231274418|emb|CAX11213.1| conserved hypothetical protein [Chlamydia trachomatis B/Jali20/OT]
 gi|296436303|gb|ADH18477.1| hypothetical protein G9768_04000 [Chlamydia trachomatis G/9768]
 gi|296437232|gb|ADH19402.1| hypothetical protein G11222_04020 [Chlamydia trachomatis G/11222]
 gi|296438162|gb|ADH20323.1| hypothetical protein G11074_03995 [Chlamydia trachomatis G/11074]
 gi|297140663|gb|ADH97421.1| hypothetical protein CTG9301_04010 [Chlamydia trachomatis G/9301]
 gi|297748884|gb|ADI51430.1| Phosphohydrolase, Icc family [Chlamydia trachomatis D-EC]
 gi|297749764|gb|ADI52442.1| Phosphohydrolase, Icc family [Chlamydia trachomatis D-LC]
          Length = 290

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 120/295 (40%), Gaps = 25/295 (8%)

Query: 10  FVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           F L H SDIH    P + F+   KR  GL+        + +  ++      +     D V
Sbjct: 9   FRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLIGGVSFQAFAISQRFPQLVKQLEADSV 68

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGA-KEKSLHAWKDYITS 127
            +TGD+     + E   +  +L  + +   + IVPGNHD Y   A K+++ +++      
Sbjct: 69  CVTGDMTITALDTEFRFAKEFLSRVESVAPVYIVPGNHDVYTHRALKKQTFYSYFPNKEL 128

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
            T     KKL P       + L+ CS       ++ANG     Q  A  + L        
Sbjct: 129 QTHRIAFKKLTPTWW----LVLLDCSCFNGW--YTANGEVTDSQLLALEQFLSSLPASE- 181

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLI 246
             +I+ +H P+  T+   + +      + ++ +     L LHGH H   L         +
Sbjct: 182 -HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRLYLHGHDHYVELDH-------L 233

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYW----TLEGKRYTLSPDSLSIQK 297
           P + + S S  + SN   A +++  +  +  Y      L   + T +P ++SI++
Sbjct: 234 PPLVVNSGSLTLPSN---ARFHIIDLHPEGGYQIATAALTNLKETSTPLTISIEE 285


>gi|289525798|emb|CBJ15279.1| conserved hypothetical protein [Chlamydia trachomatis Sweden2]
 gi|296435376|gb|ADH17554.1| hypothetical protein E150_04025 [Chlamydia trachomatis E/150]
          Length = 290

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 120/295 (40%), Gaps = 25/295 (8%)

Query: 10  FVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           F L H SDIH    P + F+   KR  GL+        + +  ++      +     D V
Sbjct: 9   FRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLIGGISFQAFAISQRFPQLVKQLEADSV 68

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGA-KEKSLHAWKDYITS 127
            +TGD+     + E   +  +L  + +   + IVPGNHD Y   A K+++ +++      
Sbjct: 69  CVTGDMTITALDTEFRFAKEFLSRVESVAPVYIVPGNHDVYTHRALKKQTFYSYFPNKEL 128

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
            T     KKL P       + L+ CS       ++ANG     Q  A  + L        
Sbjct: 129 QTHRIAFKKLTPTWW----LVLLDCSCFNGW--YTANGEVTDSQLLALEQFLSSLPASE- 181

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLI 246
             +I+ +H P+  T+   + +      + ++ +     L LHGH H   L         +
Sbjct: 182 -HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRLYLHGHDHYVELDH-------L 233

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYW----TLEGKRYTLSPDSLSIQK 297
           P + + S S  + SN   A +++  +  +  Y      L   + T +P ++SI++
Sbjct: 234 PPLVVNSGSLTLPSN---ARFHIIDLHPEGGYQITTAALTNLKETSTPLTISIEE 285


>gi|197119224|ref|YP_002139651.1| metallophosphoesterase [Geobacter bemidjiensis Bem]
 gi|197088584|gb|ACH39855.1| metallophosphoesterase [Geobacter bemidjiensis Bem]
          Length = 266

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 91/218 (41%), Gaps = 18/218 (8%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D + ++GD+       +   +  +L  +  PH + ++PGNHD  +     +    + ++ 
Sbjct: 33  DLLVLSGDVTQRARGWQFKAAVDFLERMPVPH-LLVIPGNHDLPLFNILGRVFSPYGNF- 90

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 S G+ L P       + ++G +T    P    +G     Q    S+ L+  + +
Sbjct: 91  ----QRSFGRNLEPVFE-SQELLVVGANTT--RPSRHKHGEVSPRQIETVSRRLQAGSPR 143

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKK 244
              R+++ H P      S    +    +     W E GADLIL GH HL  +  +K E  
Sbjct: 144 QL-RVVVAHQPVRATRQSDVKNLLRNHQSAIHAWAEAGADLILGGHVHLPHVRLLK-EVH 201

Query: 245 LIP-----VVGIASASQKVHSNKPQASYNLFYIEKKNE 277
            IP     V+   + S++V  + P  S NL    K++E
Sbjct: 202 GIPRAVWSVLAGTAVSRRVRGDIPN-SVNLIRYRKEDE 238


>gi|193213911|ref|YP_001995110.1| metallophosphoesterase [Chloroherpeton thalassium ATCC 35110]
 gi|193087388|gb|ACF12663.1| metallophosphoesterase [Chloroherpeton thalassium ATCC 35110]
          Length = 288

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 105/265 (39%), Gaps = 72/265 (27%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +AHISDIH+ +        P R               S++  NL+IN I     DH+ IT
Sbjct: 3   IAHISDIHIDHVAL-----PNR---------------SEQFENLIIN-IFEEGFDHLIIT 41

Query: 72  GDIVNFTCNREIFTSTHWLRSIG--NPHDISIVPGNHDAY--------------ISGAKE 115
           GD+ +     ++          G  +   I+++PGNHD +              I  +  
Sbjct: 42  GDVTDVAREEDMLLVKDIFERNGLLDWKKITLIPGNHDLFGKYEFNAERVLSNAIRASGT 101

Query: 116 KSL-------HAWKDYITSDTTCSTGKKLFPYLRIRN----NIALIGCST----AIATPP 160
            SL         ++D +T +   +T +  FP+++I N     +A++  ++    ++A  P
Sbjct: 102 NSLKKLQIFCEIFRDVMTPN---NTARYYFPFVKIFNGPGEGVAIVAFNSVFEFSLANNP 158

Query: 161 FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLD------------TSSLYNR 207
             + GY   E+  A          KG F I + HH   +L+            T  L NR
Sbjct: 159 IGSRGYIRTEELRAMLDPEVLDVLKGKFVIALCHHAYKILESAIAPYEQAFVWTMELINR 218

Query: 208 MFGIQRFQKMIWHEGADLILHGHTH 232
              +   +K+     A + LHGH H
Sbjct: 219 SEYVDTLRKI----HAKVALHGHLH 239


>gi|253699990|ref|YP_003021179.1| metallophosphoesterase [Geobacter sp. M21]
 gi|251774840|gb|ACT17421.1| metallophosphoesterase [Geobacter sp. M21]
          Length = 266

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 91/219 (41%), Gaps = 20/219 (9%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D + ++GD+       +   +  +L  +  PH + ++PGNHD  +     +    + ++ 
Sbjct: 33  DLLVLSGDVTQRARAAQFKAAVEFLERMPVPH-LLVLPGNHDLPLFNILGRVFSPYGNF- 90

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFS-ANGYFGQEQAHATSKLLRKANK 184
                 S G+ + P       + ++G +T   T P+   +G     Q    S+ LR    
Sbjct: 91  ----QRSFGRDMEPVFE-SQELLVVGVNT---TRPWRHKHGEVSPRQIETVSRRLRSGRA 142

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEK 243
           +   R+++ H P      S    +    R     W E GADL+L GH HL  +  +K E 
Sbjct: 143 EQL-RVVVAHQPVRATRESDVRNLLRNHRSAIHAWAEAGADLVLGGHVHLPHVRPLK-EV 200

Query: 244 KLIP-----VVGIASASQKVHSNKPQASYNLFYIEKKNE 277
             IP     V+   + S++V    P  S NL    K++E
Sbjct: 201 HEIPRAVWSVLAGTAVSRRVRGEIPN-SVNLIRYRKEDE 238


>gi|163855981|ref|YP_001630279.1| DNA repair exonuclease [Bordetella petrii DSM 12804]
 gi|163259709|emb|CAP42010.1| probable DNA repair exonuclease [Bordetella petrii]
          Length = 270

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 85/202 (42%), Gaps = 15/202 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + HF  ++    + A L ++D L    D V + GDI       +   +  ++++
Sbjct: 3   RILHLSDTHFGTEREPVVQ-ALLALSDAL--QPDLVLLGGDITQRARRSQFAAARRFVQA 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     +    +  Y       + G  L P +     +A+   
Sbjct: 60  LQRP--VLAVPGNHDIPLFNLAARLFDPYGGY-----RRALGAVLEPVVETDGLLAIGVN 112

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ST    P    NG     Q    ++ LR+A   G  R++++HHP      S +  +   +
Sbjct: 113 ST---RPGRHKNGQVSAAQVVRVAQRLREAGP-GRLRVVLLHHPVRAAVESDHANLLIGR 168

Query: 213 RFQKMIWHE-GADLILHGHTHL 233
                 W + G D+IL GH HL
Sbjct: 169 DLAVPAWVDAGVDIILGGHIHL 190


>gi|15618806|ref|NP_225092.1| phosphohydrolase [Chlamydophila pneumoniae CWL029]
 gi|15836430|ref|NP_300954.1| phosphohydrolase [Chlamydophila pneumoniae J138]
 gi|16752139|ref|NP_445506.1| hypothetical protein CP0969 [Chlamydophila pneumoniae AR39]
 gi|33242259|ref|NP_877200.1| 3,5'-cyclic-nucleotide phosphodiesterase [Chlamydophila pneumoniae
           TW-183]
 gi|4377217|gb|AAD19035.1| predicted phosphohydrolase [Chlamydophila pneumoniae CWL029]
 gi|7189882|gb|AAF38749.1| conserved hypothetical protein [Chlamydophila pneumoniae AR39]
 gi|8979271|dbj|BAA99105.1| phosphohydrolase [Chlamydophila pneumoniae J138]
 gi|33236770|gb|AAP98857.1| 3,5'-cyclic-nucleotide phosphodiesterase [Chlamydophila pneumoniae
           TW-183]
          Length = 295

 Score = 48.1 bits (113), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 91/223 (40%), Gaps = 9/223 (4%)

Query: 12  LAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           + HISD+H    P +      KR+ GL+   F    + +  +       +     D V I
Sbjct: 11  IIHISDVHFHVLPVNPVHCFNKRLKGLLRKVFGLVHFQATTIGQRFPKVVRSLGADSVCI 70

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD      + E   + H++ ++     + ++PGNHD Y      KSL A + + T    
Sbjct: 71  TGDFSLTAMDGEFLLAKHFVETLAKHSSVYLLPGNHDVY----TLKSL-AQQTFYTHFPN 125

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               +    + +I ++  LI    +     FSANG     Q  A    L   + +    +
Sbjct: 126 DQLQQNKVSFHKITDHWWLILLDCSCLNGWFSANGVVHLAQISAIETFLLSLSPEE--NV 183

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMI-WHEGADLILHGHTH 232
           I+ +H P+L + +  + +      Q ++  +    L LHGH H
Sbjct: 184 IIANHYPLLSSQNPSHDLINNTHLQNVLKKYPKVRLYLHGHEH 226


>gi|62185440|ref|YP_220225.1| hypothetical protein CAB837 [Chlamydophila abortus S26/3]
 gi|62148507|emb|CAH64278.1| conserved hypothetical protein [Chlamydophila abortus S26/3]
          Length = 293

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 99/264 (37%), Gaps = 36/264 (13%)

Query: 12  LAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           + HISD+H    P +      KR  G +   F    + S  +A    +  +    D + I
Sbjct: 11  IIHISDVHFCVFPKNPLTCFNKRFKGALRQVFGGVTFQSSTIAKRFPDLAVQLQADSICI 70

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD      + E   +  ++ ++     + ++PGNHD Y   A  +              
Sbjct: 71  TGDFSLTALDAEFLLAQDFVNTLAQNASVYVLPGNHDVYTQQALNQ-------------- 116

Query: 131 CSTGKKLFPYLRIRNN------------IALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
             T    FP ++++N             + L+ CS       FSANG     Q       
Sbjct: 117 -QTFYHYFPNVQLQNEQISFNKLIDHWWLVLLDCSCLNGW--FSANGMIKSSQISVLENF 173

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMI-WHEGADLILHGHTHLNSLH 237
           +     K    II+ +H P+L T    + +      Q ++  +    L LHGH H  +++
Sbjct: 174 ILSLPPKE--NIIIANHYPLLPTKDPSHDLINHLLLQHVLKKYPNVRLYLHGHNHQAAVY 231

Query: 238 WIKNEKKLIPVVGIASASQKVHSN 261
              N K   P + + S S  + SN
Sbjct: 232 ---NFKDHAPNMILNSGSVSLPSN 252


>gi|325958231|ref|YP_004289697.1| metallophosphoesterase [Methanobacterium sp. AL-21]
 gi|325329663|gb|ADZ08725.1| metallophosphoesterase [Methanobacterium sp. AL-21]
          Length = 249

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 94/225 (41%), Gaps = 23/225 (10%)

Query: 51  EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI 110
           E+ N L+  +   N D + ++GD+     + E   +  ++  + +  ++ +VPGNHDA  
Sbjct: 2   ELKNNLLRQVTDENPDLIIVSGDLTTEGYSHEYDDAAEFVDELNSISEVHVVPGNHDARN 61

Query: 111 SGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQE 170
            G     +H  K           G++ F ++       + G     ++ P   +G  G +
Sbjct: 62  VGL----IHFEK---------QIGERKFIHIDKSGGFVIAGLD---SSEPDINDGQIGYD 105

Query: 171 QAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILH 228
           Q       L K   K   +I+  HH   P+  T    N +       ++    G D +L+
Sbjct: 106 QLAWLKSELEKV-PKDMCKIVTFHHHLLPIPQTGRERNILLDSGDLLRLFIDSGVDFVLN 164

Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIE 273
           GH H+ ++  I   +K++ +    + ++K+  N    SYN   I+
Sbjct: 165 GHKHVPNVWMI---EKMVTLNSGTATTRKLRGNT-YPSYNELLID 205


>gi|326802869|ref|YP_004320687.1| Ser/Thr phosphatase family protein [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651200|gb|AEA01383.1| Ser/Thr phosphatase family protein [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 630

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 63/145 (43%), Gaps = 12/145 (8%)

Query: 96  PHDISIVPGNHDAYISGAKEKSLHAWKDY----ITSDTTCSTGKKLFPYLRIRNNIALIG 151
           PH  +  PGNHD Y     EK L A+ ++    +T+D    TG   + Y     +  ++ 
Sbjct: 336 PH--AYTPGNHDEYTVLGDEKDLTAFNEHTNVPVTNDVV--TGGSYYSYDYNGAHFVVLN 391

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTS--SLYNRMF 209
            +    +      G  G+EQ     + +++A   G   II+ +H P+   S  +L +   
Sbjct: 392 TNDNKESEDNPEQGAIGKEQMEWAKQDIQEARDNGANWIILAYHKPIYSASYHALQDEDV 451

Query: 210 GIQR--FQKMIWHEGADLILHGHTH 232
            + R  F K+      D++L GH H
Sbjct: 452 QVTREEFAKLADELDVDVVLQGHDH 476


>gi|57640972|ref|YP_183450.1| calcineurin superfamily metallophosphoesterase [Thermococcus
           kodakarensis KOD1]
 gi|57159296|dbj|BAD85226.1| metallophosphoesterase, calcineurin superfamily [Thermococcus
           kodakarensis KOD1]
          Length = 502

 Score = 47.8 bits (112), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 95/235 (40%), Gaps = 45/235 (19%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   +F                  K Y      +L++ +I   N D V
Sbjct: 3   MIRIAHISDTHITNEGAF------------------KGY----AFDLIVEEINRGNFDFV 40

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGDI N     E   + + L+ I  P  + ++PGNHD    G K      ++D+I   
Sbjct: 41  IHTGDITNQGLREEYEQAAYQLKKIQKP--LVVLPGNHDVRNVGYK-----LFEDFIGP- 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                   L      R+ + +   ST     P  ++G  G  +     + L + + +  F
Sbjct: 93  --------LNGVYEFRDGVVIWVDSTI----PDLSDGRIGGHKFRWLKERLEEYSDR-RF 139

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
           +I+  HH   P+ DT    N +F       ++   G  L   GH H+ +++ +++
Sbjct: 140 KIVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLRHGVTLYTCGHKHVPNVYRVED 194



 Score = 40.4 bits (93), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 110/271 (40%), Gaps = 46/271 (16%)

Query: 14  HISDIHLSYSPSFFELSPKRIIGLVNW---------HFNRK--KYFSKEVANLLINDILL 62
            I+  H    P  F  S +R+  +V           +F RK  +   + +   L  D+++
Sbjct: 238 EITKEHKPVKPKIFVPSGRRLFRIVQMSESNVSDRVYFRRKTLENVVRMINERLRPDLVV 297

Query: 63  HNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWK 122
           HN       GD+V+    R    +  + + +  P  I +VPG++D    G +      ++
Sbjct: 298 HN-------GDMVDAGIERYYERAYEYYKLV-KPQKI-LVPGHNDITYLGHE-----LFQ 343

Query: 123 DYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
           +Y         G           +I +I   +A    P    G  GQ++   T   LR+ 
Sbjct: 344 EYFGEPEVLELG-----------DIVIIPVLSAQYETPIGVVGRMGQKKLRNT---LREY 389

Query: 183 NKKGFFRIIMMHHPPV-LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
             +G FRI++MHH  + +  S     +       K++  EG +L+L GH    +   +K 
Sbjct: 390 --EGKFRIVVMHHNVIPVPKSREIGFLEDAGDVLKVLTDEGTELVLTGHG--GNAFGVKI 445

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYI 272
           E    P+V   S S ++H N    S+NL  I
Sbjct: 446 ENT--PIVNAGSVSWELHRNPFGNSFNLVDI 474


>gi|115379952|ref|ZP_01467007.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115363032|gb|EAU62212.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
          Length = 266

 Score = 47.0 bits (110), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 73/163 (44%), Gaps = 7/163 (4%)

Query: 43  NRKKYFSKEVANL--LINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS-IGNPHDI 99
            R + +    A L  +  +   H  DH+ ++GDI  +    E   +   L     +    
Sbjct: 8   RRARAYRHAPATLARIAQEAHAHAADHLILSGDITAYALESEFQGAREALGEWAQDRRRC 67

Query: 100 SIVPGNHDAYISGA-KEKSLHAWKDYI-TSDTTCSTGKKLFPYLR-IRNNIALIGCSTA- 155
           +++PGNHD +  G  + +    +  ++  SD      +  FP++R +    A++G  +A 
Sbjct: 68  TVIPGNHDVFTPGGHRSRRFERYFGHLLESDLPEHCREGAFPFVRLVGEGAAVVGLLSAR 127

Query: 156 IATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPV 198
           +   P  A+G+ G  Q    + +++    +G   ++++HH P+
Sbjct: 128 VPFMPGIAHGWVGPAQLEGLAAVVKDPRLEGRALLVVVHHAPL 170


>gi|332708692|ref|ZP_08428664.1| heat domain-containing protein [Lyngbya majuscula 3L]
 gi|332352546|gb|EGJ32114.1| heat domain-containing protein [Lyngbya majuscula 3L]
          Length = 1405

 Score = 46.6 bits (109), Expect = 0.004,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 52/101 (51%), Gaps = 8/101 (7%)

Query: 23   SPSFFELSPKRIIGLVNWH---FNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTC 79
            SP F       I+ L + H    ++ K +S ++A  L  D+ + ++D + ++GDI N++ 
Sbjct: 1055 SPKFIATQTIYILHLSDLHITTLDQAKNWSNQLAQDLKQDLQIPHLDALILSGDIANYST 1114

Query: 80   NREIFTSTHWLRSIG-----NPHDISIVPGNHDAYISGAKE 115
             +E   +  +L ++      +P  I +VPGNHD     AKE
Sbjct: 1115 QQEYQAAQQFLHNLRQDFPLDPKQIVLVPGNHDLNWDLAKE 1155


>gi|20093732|ref|NP_613579.1| phosphohydrolase [Methanopyrus kandleri AV19]
 gi|19886629|gb|AAM01509.1| Predicted phosphohydrolase [Methanopyrus kandleri AV19]
          Length = 290

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 106/271 (39%), Gaps = 41/271 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +AH+SD+HL  S                          K V    I  +   + D V ++
Sbjct: 5   IAHVSDLHLDES------------------------RDKSVLEAAIERVKELHPDVVVVS 40

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAW--KDYITSDT 129
           GDIV     R    +    R++     +++VP NHD    G      H +  + Y     
Sbjct: 41  GDIVKGWRPRHYGETERIFRALDVGKLLAVVPDNHDEMRGGEVVFRKHPYFRRKYREFTV 100

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAI-ATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              +  +L  Y  I     L  C  A+ +T    ++G  G +Q     +L+R+   +  F
Sbjct: 101 KSPSFGELLMYPIILEGDGL--CVIALDSTEADRSDGEVGLDQLLRAEELIREIEPE--F 156

Query: 189 RIIMMHH-----PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            ++ MHH     P ++D S++ +        ++     G DL+L GH H+  + +  +++
Sbjct: 157 IVLTMHHHVTPFPGLIDVSTVLD----AGNLREFCVANGVDLVLVGHKHIPRVDYFASKE 212

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEK 274
               V    +   +V    P A +N+  +E+
Sbjct: 213 GGCAVSHAGTLCPEVARYVPPA-FNVVDVER 242


>gi|324111258|gb|EGC05240.1| calcineurin phosphoesterase [Escherichia fergusonii B253]
          Length = 537

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 103/277 (37%), Gaps = 69/277 (24%)

Query: 24  PSFF-----ELSPKRIIGLVNWHFNRKKYF----SKEVANL--LINDILLHNVDHVSITG 72
           PS F     EL+  R++ L + HF+  K +     ++  NL  +I D     V+ V I+G
Sbjct: 192 PSVFPKRPIELTEGRLLWLSDLHFDENKKYHQFDQRDQKNLSAIIKD-WAQEVEGVLISG 250

Query: 73  DIVNFTCNREIFTSTHWLRSIG-----NPHDISIVPGNHDAYIS---------------- 111
           DI       E   +  ++ ++      N   I + PGNHD   S                
Sbjct: 251 DITWRATENEFKQAEEFIENLCSSKRVNIDGIGMCPGNHDVSFSEGYSADVKKALVKYHE 310

Query: 112 ---GAKEKSLHAWKDYITSDTT----------------------CSTGKK-LFPYLRIRN 145
              G    S   W+  I  D                         S GK+ L    +I +
Sbjct: 311 MQHGNGNLSSDEWELLIAVDVLPEFKRNYEQFFRNIVSTDANQYLSMGKRFLIMNQKIVD 370

Query: 146 NIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR-KANKK--GFFRIIMMHHP--PVLD 200
              L   S       F   GY G +Q    +K +  K NKK  G +R++++HH   PV  
Sbjct: 371 VCFLNSNSLQQHKLAFQGQGYVGVKQRDDAAKEMGWKRNKKITGGYRVVVLHHNLYPVNY 430

Query: 201 TSSLY-----NRMFGIQRFQKMIWHEGADLILHGHTH 232
             + Y       ++  +   K  +  G DLILHGHTH
Sbjct: 431 AETPYIGVASGLVYDTEAILKWCFENGVDLILHGHTH 467


>gi|300781758|ref|ZP_07091612.1| conserved hypothetical protein [Corynebacterium genitalium ATCC
           33030]
 gi|300533465|gb|EFK54526.1| conserved hypothetical protein [Corynebacterium genitalium ATCC
           33030]
          Length = 610

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 68/176 (38%), Gaps = 20/176 (11%)

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISI------VPGNHDAY----ISGAKEKSLHA 120
           TGD V             W+ ++   HD +I       PGNHD Y      G  E + + 
Sbjct: 288 TGDFVETAA-----VEDEWVDNLNASHDANIKLPHAYTPGNHDEYNLRWEEGVHETAFNE 342

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
             +   S+     G   + +     +  ++  +    +      G  G+EQ     + +R
Sbjct: 343 HTNVPVSNDKID-GGSYYSFDYSGAHFVVMNTNDNKESDDNPDEGAVGREQMEWAKEDIR 401

Query: 181 KANKKGFFRIIMMHHPPVLDTS--SLYNRMFGIQR--FQKMIWHEGADLILHGHTH 232
           KA + G   II+ +H PV   S  SL +    + R  F +M      DL+L GH H
Sbjct: 402 KARENGANWIILAYHKPVYSASYHSLQDEDVQVTREEFVQMADELDVDLVLQGHDH 457


>gi|312137489|ref|YP_004004826.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
 gi|311225208|gb|ADP78064.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
          Length = 247

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 90/229 (39%), Gaps = 27/229 (11%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D V ++GDI N    +E   +  +L  I        VPGNHDA   G        +++ I
Sbjct: 34  DVVIVSGDITNNGYYQEFIEAKKYLDEISEIIPTITVPGNHDARHVG-----YEVFEEVI 88

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
              +     K             +IG  +   + P    G  G+EQ     K L+KA  K
Sbjct: 89  GPRSGVLKNK--------NKKFVVIGLDS---SEPDLDCGKIGREQQKWLEKELKKAKNK 137

Query: 186 GFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
             F+I+ +HH   PV  T    N +       + +     DL++ GH H+    W  N +
Sbjct: 138 --FKIVALHHHIIPVPKTGRERNVLLDAGDILESLVKYDVDLVVCGHRHV-PYSW--NLE 192

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKN---EYWTLEGKRYTLS 289
             +       +S  + +  P  SYN++ + +K    +   +EGK   L 
Sbjct: 193 GCVFATAGTVSSPSLRAKNPN-SYNVYLVNEKEIKVKLCEVEGKMKILG 240


>gi|16127786|ref|NP_422350.1| hypothetical protein CC_3556 [Caulobacter crescentus CB15]
 gi|221236607|ref|YP_002519044.1| phosphohydrolase [Caulobacter crescentus NA1000]
 gi|13425294|gb|AAK25518.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220965780|gb|ACL97136.1| predicted phosphohydrolase, Icc family [Caulobacter crescentus
           NA1000]
          Length = 262

 Score = 46.6 bits (109), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 81/214 (37%), Gaps = 19/214 (8%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE---KSLHAWK 122
           D V + GD+       E   +  WL ++  P  + + PGNHD    G  E   +    W+
Sbjct: 32  DLVVVAGDLTLDGRACEFDAAAAWLETL--PRPMIVTPGNHDTPFVGPGELWERFTRPWR 89

Query: 123 DYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSAN---GYFGQEQAHATSKLL 179
            +          +   P       + L   +TA A      N   G  GQ+Q       L
Sbjct: 90  RFCDRFGAEDGARWRGP------GVTLTTLNTARAAQ-LRLNWSKGAVGQDQIRRVVGEL 142

Query: 180 RKANKKGFFRIIMMHHPPV-LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHW 238
            +A   G  RI++ HHP + +    +  R+ G     K     GAD+IL GH HL  +  
Sbjct: 143 -EAAPAGDLRIVVCHHPLMEILGGPMTARVHGGVGAAKQFVKAGADVILSGHIHLPFVTP 201

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYI 272
           +         +G  + SQ+     P   +N+  I
Sbjct: 202 LPFGDGRTQAIGSGTLSQRERGAAP--GFNVIEI 233


>gi|89897952|ref|YP_515062.1| phosphohydrolase [Chlamydophila felis Fe/C-56]
 gi|89331324|dbj|BAE80917.1| phosphohydrolase [Chlamydophila felis Fe/C-56]
          Length = 293

 Score = 46.2 bits (108), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 97/264 (36%), Gaps = 36/264 (13%)

Query: 12  LAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           + HISD+H    P +      KR  G +   F    + S  +A            D + I
Sbjct: 11  IIHISDVHFCVFPRNPLTCLNKRFKGALRQIFGGVTFQSSTIAERFPELATRLQADSICI 70

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD      + E   +  ++ ++     +  +PGNHD Y   A  +              
Sbjct: 71  TGDFSLTALDAEFLLAQDFVNNLSQNASVYALPGNHDVYTQKALNQ-------------- 116

Query: 131 CSTGKKLFPYLRIRNN------------IALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
             T  + FP ++++N             + L+ CS       FSANG     Q       
Sbjct: 117 -QTFYQYFPNVQLQNERISFNKLMDHWWLVLLDCSCLNGW--FSANGMIQSSQTSVLENF 173

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMI-WHEGADLILHGHTHLNSLH 237
           +     K    II+ +H P+L T    + +      Q ++  +    L LHGH H  +++
Sbjct: 174 ILSLPPKE--NIIIANHYPLLPTKDPSHDLINHLLLQHVLKKYPNVRLYLHGHNHQAAVY 231

Query: 238 WIKNEKKLIPVVGIASASQKVHSN 261
              N K   P + + S S  + SN
Sbjct: 232 ---NCKDHAPNMILNSGSVSLPSN 252


>gi|317492043|ref|ZP_07950474.1| calcineurin phosphoesterase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316919926|gb|EFV41254.1| calcineurin phosphoesterase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 549

 Score = 46.2 bits (108), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 80/221 (36%), Gaps = 58/221 (26%)

Query: 96  PHDISIVPGNHDA---------------------------YISGAKEKSLHAWKDYITS- 127
           P DI I PGNHD                            Y  G+KE  +  +KD     
Sbjct: 283 PDDIIICPGNHDVGLVSKEEYFKIMGKPTTDTPWVTLAENYHKGSKENYIKFYKDVFQRK 342

Query: 128 -DTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            +   S G+K L    +I    AL  C        F   G+ G++Q    ++ +   NK 
Sbjct: 343 PEEDLSQGRKFLLGGHKIVEVAALNSCVLQQVKDSFLGMGFIGEKQLSNVAESMGWMNKS 402

Query: 186 GFF--------RIIMMHH---------PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILH 228
           G +        RI M+HH            LD  S Y+     +R  + +     D ILH
Sbjct: 403 GEYISKKGGVTRIAMLHHHLTSINEAEDAYLD--SKYSVTLDAERLLRWVVKHKVDYILH 460

Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
           GH H +S          I +  I S  ++V  + P+ ++ +
Sbjct: 461 GHMHRSS---------CITIKKILSPLERVSDSNPEHTFQI 492


>gi|212223890|ref|YP_002307126.1| metallophosphoesterase [Thermococcus onnurineus NA1]
 gi|212008847|gb|ACJ16229.1| metallophosphoesterase [Thermococcus onnurineus NA1]
          Length = 503

 Score = 45.8 bits (107), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 96/235 (40%), Gaps = 45/235 (19%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   ++                  K Y      +L++N+I   N D V
Sbjct: 1   MIRIAHISDTHITSESAY------------------KGY----AYDLIVNEINRGNFDFV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ N     E   +++ L+ I  P  + ++PGNHD      +      ++ +I   
Sbjct: 39  IHTGDVTNQGLREEYERASYELKKIQKP--LIVIPGNHD-----VRNVGYELFEKFIGP- 90

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                   L      R+ + +   ST     P  ++G  G  +     K L + + +  F
Sbjct: 91  --------LNGVFEFRDGVIVWVDSTI----PDLSDGRIGGYKFKWLKKRLEEYSDRK-F 137

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
           +I+  HH   P+ DT    N +F       ++   G +L   GH H+ +++ +++
Sbjct: 138 KIVASHHHIVPLPDTGRERNVLFNAGDVLDLLLRHGVNLYTCGHKHVPNVYRVED 192


>gi|302525303|ref|ZP_07277645.1| predicted protein [Streptomyces sp. AA4]
 gi|302434198|gb|EFL06014.1| predicted protein [Streptomyces sp. AA4]
          Length = 253

 Score = 45.8 bits (107), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 81/230 (35%), Gaps = 45/230 (19%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M V AH+SDIHL  S    E +  R   +  +  N +K                  VD V
Sbjct: 1   MRVFAHLSDIHLDGS----ERADARAAAVTRYLRNLEK-----------------PVDAV 39

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ +     E   +   L     P  + + PGNHD      +     A      SD
Sbjct: 40  FATGDLADHGLPGEYRRAAELLDL---PVPVVVCPGNHD-----VRAPFREALLGEPASD 91

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              +T  K+         + L+ C + I   P    GY   E      + L   +   F 
Sbjct: 92  APVNTATKV-------AEVLLVSCDSTI---PGKGAGYLADETLAWLDETLAAHDGPSF- 140

Query: 189 RIIMMHHPPVLDTSSLYN--RMFGIQRFQKMI-WHEGADLILHGHTHLNS 235
             +  HHPP+     L +  R  G  R   ++  H G   +L GH H  +
Sbjct: 141 --VAFHHPPLDVGVPLVDAIRQTGEDRLAAVLKRHPGVAALLCGHVHTGA 188


>gi|161615630|ref|YP_001589595.1| hypothetical protein SPAB_03414 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|161364994|gb|ABX68762.1| hypothetical protein SPAB_03414 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 537

 Score = 45.8 bits (107), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 100/277 (36%), Gaps = 69/277 (24%)

Query: 24  PSFF-----ELSPKRIIGLVNWHFNRKKYF------SKEVANLLINDILLHNVDHVSITG 72
           PS F     EL+  R++ L + HF+  + +       ++  + +I D     V+ V I+G
Sbjct: 192 PSVFPKRPIELTEGRLLWLSDLHFDENQKYHQFDQRDQKKLSAIIKD-WAQEVEGVLISG 250

Query: 73  DIVNFTCNREIFTSTHWLRSIG-----NPHDISIVPGNHDAYIS---------------- 111
           DI       E   +  ++ ++      N   I + PGNHD   S                
Sbjct: 251 DITWRATENEFKQAEEFIENLCSSKRVNIDGIGMCPGNHDVSFSEDYSADVKKALVKYHE 310

Query: 112 ---GAKEKSLHAWKDYITSDTTCSTGKKLFPYLR------------------IRNNIALI 150
              G    S   W+  I  D      +    + R                  I N   + 
Sbjct: 311 MQHGNGNLSSDEWESLIAVDVLPEFKRNYEQFFRNIVSTDANQYLSMGKRFLIMNQKVVD 370

Query: 151 GC-----STAIATPPFSANGYFGQEQAHATSKLLR-KANKK--GFFRIIMMHHP--PVLD 200
            C     S       F   GY G +Q    +K +  K NKK  G +R++++HH   PV  
Sbjct: 371 VCFLNSNSLQQHKLAFQGQGYVGVKQRDDAAKEMGWKRNKKITGGYRVVVLHHNLYPVNY 430

Query: 201 TSSLY-----NRMFGIQRFQKMIWHEGADLILHGHTH 232
             + Y       ++  +   K  +  G DLILHGHTH
Sbjct: 431 AETPYIGVASGLVYDTEAILKWCFENGVDLILHGHTH 467


>gi|302538094|ref|ZP_07290436.1| metallophosphoesterase [Streptomyces sp. C]
 gi|302446989|gb|EFL18805.1| metallophosphoesterase [Streptomyces sp. C]
          Length = 257

 Score = 45.8 bits (107), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 10/94 (10%)

Query: 169 QEQAHATSKLLRKANKKG-FFRIIMMHHPPVLDTSSLYNR----MFGIQRFQKMIWHEGA 223
           ++ A A  + LR+  + G   RI + H+ PV DT +   R      G     + +  EGA
Sbjct: 139 RDSAEALGRALRELREAGSALRIALTHYSPVPDTLAGEPREIYPFLGSYLLAEAMDEEGA 198

Query: 224 DLILHGHTHLNSLH-----WIKNEKKLIPVVGIA 252
           DL +HGH HL + H      ++     +PV+G A
Sbjct: 199 DLAVHGHAHLGTEHGMTAGGVQVRNVAMPVIGQA 232


>gi|322623048|gb|EFY19890.1| hypothetical protein SEEM973_04916 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322628338|gb|EFY25126.1| hypothetical protein SEEM974_15365 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634744|gb|EFY31475.1| hypothetical protein SEEM201_17655 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322638690|gb|EFY35385.1| hypothetical protein SEEM202_15770 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322645495|gb|EFY42023.1| hypothetical protein SEEM054_04094 [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322651619|gb|EFY47991.1| hypothetical protein SEEM675_02272 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322654478|gb|EFY50800.1| hypothetical protein SEEM965_11294 [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322665095|gb|EFY61283.1| hypothetical protein SEEM801_01541 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667839|gb|EFY63999.1| hypothetical protein SEEM507_07949 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671749|gb|EFY67870.1| hypothetical protein SEEM877_03126 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322677205|gb|EFY73269.1| hypothetical protein SEEM867_18374 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322680132|gb|EFY76171.1| hypothetical protein SEEM180_04955 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322685440|gb|EFY81436.1| hypothetical protein SEEM600_09969 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323196025|gb|EFZ81189.1| hypothetical protein SEEM581_01879 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199955|gb|EFZ85043.1| hypothetical protein SEEM501_05636 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323205748|gb|EFZ90711.1| hypothetical protein SEEM020_05109 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323209813|gb|EFZ94734.1| hypothetical protein SEEM6152_15505 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216747|gb|EGA01471.1| hypothetical protein SEEM0077_00125 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323223426|gb|EGA07756.1| hypothetical protein SEEM0047_18464 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323231937|gb|EGA16044.1| hypothetical protein SEEM0052_16344 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234464|gb|EGA18551.1| hypothetical protein SEEM3312_15035 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237915|gb|EGA21974.1| hypothetical protein SEEM5258_02798 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323243484|gb|EGA27503.1| hypothetical protein SEEM1156_04089 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323253790|gb|EGA37617.1| hypothetical protein SEEM8282_12300 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323261239|gb|EGA44827.1| hypothetical protein SEEM8284_00493 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266604|gb|EGA50091.1| hypothetical protein SEEM8285_01490 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323271329|gb|EGA54755.1| hypothetical protein SEEM8287_05792 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 549

 Score = 45.4 bits (106), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 78/212 (36%), Gaps = 52/212 (24%)

Query: 96  PHDISIVPGNHDA---------------------------YISGAKEKSLHAWKDYITS- 127
           P DI I PGNHD                            Y  G+KE  +  +KD     
Sbjct: 283 PDDIIICPGNHDVGLVSKEQYFEIMGKPTTDTPWATLAENYHKGSKENYIKFYKDVFQRK 342

Query: 128 -DTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            +   S G+K L    ++    AL  C        F   G+ G++Q    ++ +   NK 
Sbjct: 343 PEEDLSQGRKFLLGGHKVVEVAALNSCVLQQVKDSFLGMGFIGEKQLSNVAESMGWMNKS 402

Query: 186 GFF--------RIIMMHH---------PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILH 228
           G +        RI M+HH            LD  S Y+     +R  + +     D ILH
Sbjct: 403 GEYISKKRGVTRIAMLHHHLTSINEAEDAYLD--SKYSVTLDAERLLRWVVKHKVDYILH 460

Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHS 260
           GH H +S   I   KK++  +   SAS   H+
Sbjct: 461 GHMHRSSCITI---KKILSPLEPVSASNPEHT 489


>gi|315497135|ref|YP_004085939.1| metallophosphoesterase [Asticcacaulis excentricus CB 48]
 gi|315415147|gb|ADU11788.1| metallophosphoesterase [Asticcacaulis excentricus CB 48]
          Length = 257

 Score = 45.4 bits (106), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 108/262 (41%), Gaps = 25/262 (9%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI  + + HF       + V   LI+ ++    D V  +GDI       E   ++ + + 
Sbjct: 2   RIAHISDLHFG---AHDRRVTETLISTLIELEPDLVVASGDITQDATVAEFVEASEFFKL 58

Query: 93  IGNPHDISIVPGNHDAYISGAK-EKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           +  P    ++PGNHD  + G    + +  WK Y          ++L P L+  + + + G
Sbjct: 59  LPMP--AFVIPGNHD--LPGLDLRRFIQPWKRY-----RDHIARELEPELQA-DLVDIKG 108

Query: 152 CSTA-IATPPFS-ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTS-SLYNRM 208
            ++A +  P  + A G     Q H  +     +     +R++ +HHPP+      L   +
Sbjct: 109 INSARMILPSLNWAYGSISARQRHDIADFFAASTTP--WRVLTVHHPPLNPPEFPLDVTL 166

Query: 209 FGIQRFQKMIWHEGADLILHGHTHLNSLH-WIKNEKKLIPVVGIASASQKVHSNKPQASY 267
           F   +F + +  +  D++L GH H   +   I N    + V   AS +  V   K    +
Sbjct: 167 FNKGKFLETLGEQKVDIVLSGHQHHAYVETRIMNGHTTLFVC--ASTAMSVRIRKQPQGF 224

Query: 268 NLFYIEKKN---EYWTLEGKRY 286
           NL   + K+   E   L G R+
Sbjct: 225 NLLDFKDKSVRIELRQLSGDRF 246


>gi|20093348|ref|NP_619423.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina acetivorans
           C2A]
 gi|19918712|gb|AAM07903.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina acetivorans
           C2A]
          Length = 246

 Score = 45.4 bits (106), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 102/243 (41%), Gaps = 30/243 (12%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ L + HF+ + ++  E+A+ ++  I  +N D V ITGD+       E   + +++  
Sbjct: 2   RLVHLSDIHFS-EAFYMPEIADTMLEKINQNNPDIVVITGDLTENGLAAEYNGAKNFIDR 60

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           I   + + IVPGNHD+  +G     L     +    ++ S G+           + ++G 
Sbjct: 61  IECKNKV-IVPGNHDSRNAGY----LFFEDIFKARSSSGSFGE-----------VTVVGL 104

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFG 210
            +   + P    G+ G+E      +    A     F++  +HH   P+  T    N +  
Sbjct: 105 DS---SQPELEEGHIGRENYGWIEEAFSTAG----FKVFALHHHLIPIPRTGRGNNVLVD 157

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                +++   G +L+L GH H+    W+     ++ V      S KV     Q  YN  
Sbjct: 158 AGDVLELLDRSGVNLVLCGHWHIP---WVWRLNDMLVVSAGTVCSSKVRGKATQC-YNYI 213

Query: 271 YIE 273
            +E
Sbjct: 214 ELE 216


>gi|13476688|ref|NP_108257.1| 3',5'-cyclic-nucleotide phosphodiesterase [Mesorhizobium loti
           MAFF303099]
 gi|14027449|dbj|BAB53718.1| 3',5'-cyclic-nucleotide phosphodiesterase [Mesorhizobium loti
           MAFF303099]
          Length = 269

 Score = 45.4 bits (106), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 104/252 (41%), Gaps = 30/252 (11%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           K ++ L + HF + +     + + +  ++   + D + ++GD+       E   +  +L 
Sbjct: 2   KTLVHLSDLHFGKTE---SHLVDAIAAEVRAVDSDLLVVSGDLTQRARKDEFLQARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKS---LHAWKDYITSDTTCSTGKKLFPYLRIRNNIA 148
           S+  P    +VPGNHD  +     ++   L  ++ YI +DT         P+    + +A
Sbjct: 59  SLPGPR--IVVPGNHDVPLWNVFARAMTPLSRYRRYIEADTD--------PFY-ADSEVA 107

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNR 207
           ++G +TA +      NG     Q  A ++     +     RI++ HHP   LD  S    
Sbjct: 108 VVGINTARSLTI--KNGRINVRQLKAATEKFAYMSDD-ITRIVVTHHPFEGLDLESDDGI 164

Query: 208 MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIAS----ASQKVHSNKP 263
           +             G D+IL GH H   LH   +  +   + G A+    A   V S   
Sbjct: 165 VARADLAMDAFSRSGVDIILSGHQH---LHRAGSSARRYLIDGYAALLVQAGTAVSSRVR 221

Query: 264 QA--SYNLFYIE 273
           QA  S+N+  IE
Sbjct: 222 QAANSFNIIRIE 233


>gi|83594620|ref|YP_428372.1| metallophosphoesterase [Rhodospirillum rubrum ATCC 11170]
 gi|83577534|gb|ABC24085.1| Metallophosphoesterase [Rhodospirillum rubrum ATCC 11170]
          Length = 289

 Score = 45.1 bits (105), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 85/212 (40%), Gaps = 21/212 (9%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +RI  + + HF R      +    L  +++    D V ++GD+     +R+   +  +L 
Sbjct: 2   RRIAHISDLHFGR---VDPDAVIALGQELIAQAPDLVVVSGDLTQRARSRQFLDARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           S+  P  I +VPGNHD       ++ L     +         GK L P LR    + + G
Sbjct: 59  SLKLP--ILVVPGNHDVPWHNPVQRFLGPHGRF-----RKMIGKDLSPVLR-DPEMTVAG 110

Query: 152 CSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNR-- 207
            +T+ A  P    ANG    ++A   + LL  A      R+++ HHP     S       
Sbjct: 111 ITTSRALVPHWNWANGRISTKRARRVATLL-AAEPAEKLRVVVTHHPLAFAPSPTGGASP 169

Query: 208 -----MFGIQRFQKMIWHEGADLILHGHTHLN 234
                 F      + +     DL+L GH H++
Sbjct: 170 DGTLPTFNAAGALRALGAARVDLMLSGHMHVS 201


>gi|77463909|ref|YP_353413.1| phospodiesterase [Rhodobacter sphaeroides 2.4.1]
 gi|221639765|ref|YP_002526027.1| Metallophosphoesterase [Rhodobacter sphaeroides KD131]
 gi|332558781|ref|ZP_08413103.1| Metallophosphoesterase [Rhodobacter sphaeroides WS8N]
 gi|77388327|gb|ABA79512.1| possible phospodiesterase [Rhodobacter sphaeroides 2.4.1]
 gi|221160546|gb|ACM01526.1| Metallophosphoesterase [Rhodobacter sphaeroides KD131]
 gi|332276493|gb|EGJ21808.1| Metallophosphoesterase [Rhodobacter sphaeroides WS8N]
          Length = 273

 Score = 45.1 bits (105), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 91/202 (45%), Gaps = 17/202 (8%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           KR++ L + HF R +    E+   L+  +     D V+I+GD+       +   +  ++ 
Sbjct: 2   KRLLHLSDLHFGRDR---PELLRPLVETVNRLEPDLVAISGDLTQRATESQFRAAAAFVA 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           ++  P  + +VPGNHD  +     + +  WK Y         G+ L P     + + ++G
Sbjct: 59  ALKPP--VLVVPGNHDVPLHNLYVRLVKPWKRY-----RRWFGRDLEPCWE-NDEMIVVG 110

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRK-ANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
            +T    P     G+F   ++ + +++ R  A ++   R++++HHP           M G
Sbjct: 111 ANTV--NPLAWQQGWF---RSRSLARIRRSFAAEERRVRVVVVHHPMEHTPEDTKELMRG 165

Query: 211 IQRFQKMIWHEGADLILHGHTH 232
            +R    +   GAD+IL GH H
Sbjct: 166 AERAIDELADCGADVILSGHLH 187


>gi|330817062|ref|YP_004360767.1| Metallophosphoesterase [Burkholderia gladioli BSR3]
 gi|327369455|gb|AEA60811.1| Metallophosphoesterase [Burkholderia gladioli BSR3]
          Length = 283

 Score = 45.1 bits (105), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 87/201 (43%), Gaps = 14/201 (6%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ + + HF  ++   +E  + L+  I     + V I+GD+       +   +  ++  
Sbjct: 3   RLLQISDPHFGAER---QEAVDALVRLIEQTRPELVVISGDLTQRARRHQFEAARAFVAR 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +G    +  +PGNHD  +     +    + +Y       + G++L P     +  AL+  
Sbjct: 60  LGA-QPVLAIPGNHDLPLFDLIARWRQPYVNY-----RRAFGEELEPVF---DAPALLAI 110

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPV-LDTSSLYNRMFGI 211
                 P     G    EQ    ++ L  A+     R++++H P V +  ++ ++R+ G 
Sbjct: 111 GVNTTRPARHTAGEISAEQVARVARRLALASP-AQLRVVVVHQPIVAIGPANRHDRLHGG 169

Query: 212 QRFQKMIWHEGADLILHGHTH 232
           +   +     GADL+L GHTH
Sbjct: 170 EIALRRWAAAGADLVLGGHTH 190


>gi|29840628|ref|NP_829734.1| hypothetical protein CCA00871 [Chlamydophila caviae GPIC]
 gi|29834978|gb|AAP05612.1| conserved hypothetical protein [Chlamydophila caviae GPIC]
          Length = 293

 Score = 45.1 bits (105), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 98/264 (37%), Gaps = 36/264 (13%)

Query: 12  LAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           + HISD+H    P +      KR  G +   F    + S  +A    +  +    D + I
Sbjct: 11  IIHISDVHFCVFPKNPLTCLNKRFKGALRQVFGGVTFQSSTIAERFPDLAVKLQADSICI 70

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD      + E   +  ++ ++     + ++PGNHD Y   A                 
Sbjct: 71  TGDFSLTALDAEFLLAQDFVNNLARNASVYVLPGNHDVYTQKALNH-------------- 116

Query: 131 CSTGKKLFPYLRIRNN------------IALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
             T  + FP  +++N             + L+ CS       FSANG     Q       
Sbjct: 117 -QTFYQYFPNTQLQNEQISFNKLVDHWWLVLLDCSCLNGW--FSANGMIKSSQISILENF 173

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMI-WHEGADLILHGHTHLNSLH 237
           +     +    II+ +H P+L T    + +      Q ++  +    L LHGH H  +++
Sbjct: 174 ILSLPPQE--NIIIANHYPLLPTKDPSHDLINYLLLQHVLKKYSNVRLYLHGHHHQAAVY 231

Query: 238 WIKNEKKLIPVVGIASASQKVHSN 261
              N K   P + + S S  + SN
Sbjct: 232 ---NCKDHAPNMILNSGSISLPSN 252


>gi|323228036|gb|EGA12178.1| hypothetical protein SEEM0055_12036 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
          Length = 300

 Score = 45.1 bits (105), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 78/212 (36%), Gaps = 52/212 (24%)

Query: 96  PHDISIVPGNHDA---------------------------YISGAKEKSLHAWKDYITS- 127
           P DI I PGNHD                            Y  G+KE  +  +KD     
Sbjct: 34  PDDIIICPGNHDVGLVSKEQYFEIMGKPTTDTPWATLAENYHKGSKENYIKFYKDVFQRK 93

Query: 128 -DTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            +   S G+K L    ++    AL  C        F   G+ G++Q    ++ +   NK 
Sbjct: 94  PEEDLSQGRKFLLGGHKVVEVAALNSCVLQQVKDSFLGMGFIGEKQLSNVAESMGWMNKS 153

Query: 186 GFF--------RIIMMHH---------PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILH 228
           G +        RI M+HH            LD  S Y+     +R  + +     D ILH
Sbjct: 154 GEYISKKRGVTRIAMLHHHLTSINEAEDAYLD--SKYSVTLDAERLLRWVVKHKVDYILH 211

Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHS 260
           GH H +S   I   KK++  +   SAS   H+
Sbjct: 212 GHMHRSSCITI---KKILSPLEPVSASNPEHT 240


>gi|11500006|ref|NP_071252.1| lacZ expression regulatory protein (icc) [Archaeoglobus fulgidus
           DSM 4304]
 gi|2650659|gb|AAB91233.1| lacZ expression regulatory protein (icc) [Archaeoglobus fulgidus
           DSM 4304]
          Length = 372

 Score = 45.1 bits (105), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 111/274 (40%), Gaps = 48/274 (17%)

Query: 33  RIIGLVNWHFNRKKYFSK-EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           RI+ + + HF  +    K E A   IN+I     D + ITGD+  +  + E+  +   L 
Sbjct: 2   RIVHISDLHFGEELIREKVEKAVRQINEI---EPDLLVITGDLSCWGIHSEMRDAYETLL 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLH--AWKDYITSDTTCSTGKKLFPYLRIRNNIAL 149
            +  P  I+ VPGNHDA   G +   L+    K Y  +D                  ++L
Sbjct: 59  DL-KPDYIA-VPGNHDARNIGYEFFQLYFGETKKYWKNDV-----------------VSL 99

Query: 150 IGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNR 207
           I   +   T P   +GY G+EQ       +RK      F I+ +HH   P+  T    N 
Sbjct: 100 IAADS---TQPDLDDGYIGKEQRDWIVSKIRKDR----FNILALHHHIAPIPKTGRERNV 152

Query: 208 MFGIQRFQKMIWHEGADLILHGHTHLN-SLHWIKNEKKLIPVVGIASASQKVHSNKPQAS 266
           +       +++   G   +L GH H+  SL  ++       V+   +         P  +
Sbjct: 153 LIDAGEMVELLIANGISAVLAGHRHMPYSLRLMRTH-----VIHAGTLGSFKVLGMPDHN 207

Query: 267 YNLFYIEKKN--------EYWTLEGKRYTLSPDS 292
           YN+  I+           +Y  +E  RYT++P++
Sbjct: 208 YNVIEIKDNTLTLKLRFVDYGEVEIGRYTINPET 241


>gi|300311856|ref|YP_003775948.1| 3',5'-cyclic-nucleotide phosphodiesterase [Herbaspirillum
           seropedicae SmR1]
 gi|300074641|gb|ADJ64040.1| 3',5'-cyclic-nucleotide phosphodiesterase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 279

 Score = 44.7 bits (104), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 86/203 (42%), Gaps = 23/203 (11%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +R+I L + HF R       +   LI  I     D V ++GD+     + +   +  +L 
Sbjct: 2   RRVIHLSDLHFGRT---DPAIIEPLIAQIHELQPDLVVVSGDLTQRARSSQFRQARQFLD 58

Query: 92  SIGNPHDISIVPGNHDAY---ISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIA 148
           ++  P    +VPGNHD     ++    + L  +K +IT D        L P L + + IA
Sbjct: 59  ALPTPQ--LVVPGNHDVPLFNVAARLLQPLRKYKRHITPD--------LQP-LYVDDEIA 107

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRM 208
           ++G +TA +      +G     Q     + L  A      +II+ HHP  L     ++ +
Sbjct: 108 VVGINTARSL--TIQDGRVNDRQIELARREL-AAVGDHLVKIIVTHHPFDLPPGPQHHGL 164

Query: 209 FGIQRFQKMIWHE--GADLILHG 229
            G Q    M      GADL+L G
Sbjct: 165 VG-QALPAMRAFALCGADLLLAG 186


>gi|322660803|gb|EFY57036.1| hypothetical protein SEEM19N_00637 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
          Length = 339

 Score = 44.7 bits (104), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 78/212 (36%), Gaps = 52/212 (24%)

Query: 96  PHDISIVPGNHDA---------------------------YISGAKEKSLHAWKDYITS- 127
           P DI I PGNHD                            Y  G+KE  +  +KD     
Sbjct: 73  PDDIIICPGNHDVGLVSKEQYFEIMGKPTTDTPWATLAENYHKGSKENYIKFYKDVFQRK 132

Query: 128 -DTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            +   S G+K L    ++    AL  C        F   G+ G++Q    ++ +   NK 
Sbjct: 133 PEEDLSQGRKFLLGGHKVVEVAALNSCVLQQVKDSFLGMGFIGEKQLSNVAESMGWMNKS 192

Query: 186 GFF--------RIIMMHH---------PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILH 228
           G +        RI M+HH            LD  S Y+     +R  + +     D ILH
Sbjct: 193 GEYISKKRGVTRIAMLHHHLTSINEAEDAYLD--SKYSVTLDAERLLRWVVKHKVDYILH 250

Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHS 260
           GH H +S   I   KK++  +   SAS   H+
Sbjct: 251 GHMHRSSCITI---KKILSPLEPVSASNPEHT 279


>gi|302381414|ref|YP_003817237.1| metallophosphoesterase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192042|gb|ADK99613.1| metallophosphoesterase [Brevundimonas subvibrioides ATCC 15264]
          Length = 285

 Score = 44.7 bits (104), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 81/206 (39%), Gaps = 13/206 (6%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D + ITGDI       E   +  W+R++  P  + +  GNHD        +    WK + 
Sbjct: 35  DLILITGDITQKGLPDEFAAAGEWIRAMPTPRFVIV--GNHDVPYYSLGARLFRPWKAFE 92

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFS--ANGYFGQEQAHATSKLLRKAN 183
                 +TG        + +N+ + G  TA      +  + G    +Q    ++ LR+A 
Sbjct: 93  D-----ATGHPAHDGEFVSDNVMVRGVVTARGWQARANWSKGVIDLDQTRRAAEALRQA- 146

Query: 184 KKGFFRIIMMHHPPV-LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             G  RI+  HHP + +  + +   +       ++    G DLI  GH H+     I   
Sbjct: 147 PVGALRILACHHPLIEMIGTPMTGDVKRGDAAAEIFAEAGVDLITTGHVHVPFAIPIDLS 206

Query: 243 KKLIPVVGIASASQKVHSNKPQASYN 268
            +    VG  + S++     P  S+N
Sbjct: 207 DRCSYAVGCGTLSKRERGTPP--SFN 230


>gi|126462743|ref|YP_001043857.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17029]
 gi|126104407|gb|ABN77085.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17029]
          Length = 273

 Score = 44.7 bits (104), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 91/202 (45%), Gaps = 17/202 (8%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           KR++ L + HF R +    E+   L+  +     D V+I+GD+       +   +  ++ 
Sbjct: 2   KRLLHLSDLHFGRDR---PELLRPLVETVNRLEPDLVAISGDLTQRATESQFRAAAAFVA 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           ++  P  + +VPGNHD  +     + +  WK Y         G+ L P     + + ++G
Sbjct: 59  ALKPP--VLVVPGNHDVPLHNLFVRLVKPWKRY-----RRWFGRDLEPCWE-NDEMIVVG 110

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRK-ANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
            +T    P     G+F   ++ + +++ R  A ++   R++++HHP           M G
Sbjct: 111 ANTV--NPLAWQQGWF---RSRSLARIRRSFAAEERRVRVVVVHHPMEHTPDDTKELMRG 165

Query: 211 IQRFQKMIWHEGADLILHGHTH 232
            +R    +   GAD+IL GH H
Sbjct: 166 AERAIDELADCGADVILSGHLH 187


>gi|78187448|ref|YP_375491.1| hypothetical protein Plut_1594 [Chlorobium luteolum DSM 273]
 gi|78167350|gb|ABB24448.1| conserved hypothetical protein [Chlorobium luteolum DSM 273]
          Length = 287

 Score = 44.7 bits (104), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 103/269 (38%), Gaps = 80/269 (29%)

Query: 12  LAHISDIHLSYSPSFFELSP-KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           + HISD+H++      +L    R++G    HF+R                    +DH+ I
Sbjct: 7   IVHISDLHIAGRGDRRQLQDLDRMLG----HFSRS------------------GIDHLVI 44

Query: 71  TGDI------VNFTCNREIFTS---THWLRSIGNPHDISIVPGNHDAY------------ 109
           +GD+       ++   RE+       HW R+       +++PGNHD              
Sbjct: 45  SGDLSDRAKEADWEIVRELLLRHGWYHWART-------TVIPGNHDIINLEEEMRFYNAL 97

Query: 110 --ISGAKEKSLHA--------WKDYITSDTTCSTGKKLFPYLRI------RNNIALIGCS 153
             + G ++++  A        +++ +T D     G   FP++++      +  IA     
Sbjct: 98  NPLPGMRDRACTAKAARFCRFFQELVTGD---ELGDAAFPFIKVLRFPTLKLAIAAFNSV 154

Query: 154 TAIATP--PFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMF- 209
            A +    P  + GY    +  A S         G F + + HH   V  T SL ++ F 
Sbjct: 155 NAWSATDNPLGSRGYIEPSELRAVSSPAVMKALDGCFILGLCHHALKVYGTDSLLDQAFD 214

Query: 210 ------GIQRFQKMIWHEGADLILHGHTH 232
                   Q F  ++   GA ++LHGH H
Sbjct: 215 WTMELKNRQEFLGVMREIGAQVVLHGHFH 243


>gi|322616197|gb|EFY13113.1| hypothetical protein SEEM315_02608 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
          Length = 477

 Score = 44.3 bits (103), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 69/192 (35%), Gaps = 49/192 (25%)

Query: 96  PHDISIVPGNHDA---------------------------YISGAKEKSLHAWKDYITS- 127
           P DI I PGNHD                            Y  G+KE  +  +KD     
Sbjct: 283 PDDIIICPGNHDVGLVSKEQYFEIMGKPTTDTPWATLAENYHKGSKENYIKFYKDVFQRK 342

Query: 128 -DTTCSTGKK-LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            +   S G+K L    ++    AL  C        F   G+ G++Q    ++ +   NK 
Sbjct: 343 PEEDLSQGRKFLLGGHKVVEVAALNSCVLQQVKDSFLGMGFIGEKQLSNVAESMGWMNKS 402

Query: 186 GFF--------RIIMMHH---------PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILH 228
           G +        RI M+HH            LD  S Y+     +R  + +     D ILH
Sbjct: 403 GEYISKKRGVTRIAMLHHHLTSINEAEDAYLD--SKYSVTLDAERLLRWVVKHKVDYILH 460

Query: 229 GHTHLNSLHWIK 240
           GH H +S   IK
Sbjct: 461 GHMHRSSCITIK 472


>gi|84503427|ref|ZP_01001487.1| possible phospodiesterase [Oceanicola batsensis HTCC2597]
 gi|84388214|gb|EAQ01166.1| possible phospodiesterase [Oceanicola batsensis HTCC2597]
          Length = 278

 Score = 44.3 bits (103), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 87/203 (42%), Gaps = 20/203 (9%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R+I L + HF R +    E+   L+  +     D V+I+GD+     + +   +  ++  
Sbjct: 3   RLIHLSDLHFGRDR---PELMRPLLTAVNDLGPDIVAISGDLTQRARSSQFRAARTFIDH 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDY---ITSDTTCSTGKKLFPYLRIRNNIAL 149
           I  P  +  VPGNHD        + L+++ +Y   I+ D        L P L +  ++A+
Sbjct: 60  IEAP--VLCVPGNHDLPAHRPIRRFLNSFANYKRHISPD--------LAPSL-LCPDLAV 108

Query: 150 IGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
           IG +T     PF     +   +    +  L ++  +    +++ HHP  +   S    MF
Sbjct: 109 IGINT---NSPFRWQSGWASRRGIRKAAELCRSGPEHRLNVVVAHHPFEMPEESHKRPMF 165

Query: 210 GIQRFQKMIWHEGADLILHGHTH 232
             +     +   GA ++L GH H
Sbjct: 166 NAEWGLACLAEAGAHVVLSGHLH 188


>gi|304314070|ref|YP_003849217.1| phosphohydrolase [Methanothermobacter marburgensis str. Marburg]
 gi|302587529|gb|ADL57904.1| predicted phosphohydrolase [Methanothermobacter marburgensis str.
           Marburg]
          Length = 265

 Score = 44.3 bits (103), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 88/207 (42%), Gaps = 28/207 (13%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHW-- 89
           K+I  + + HF  K + SK   NLL   +   N D + ++GD+       E   +  +  
Sbjct: 3   KKIAQISDIHFGEKNFSSKLRENLL-GQLQDENPDLIVVSGDLTTEGYAHEYELAAEFAD 61

Query: 90  -LRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIA 148
            LRSI   +   I+PGNHDA   G     +H  K           GK+ F  +   +  A
Sbjct: 62  ELRSITATY---IIPGNHDARNVGL----VHFEK---------MIGKRKF--VHHDSEFA 103

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--PVLDTSSLYN 206
           +IG  +   + P   +G  G +Q    ++ L +       +I+  HH   P+ +T    N
Sbjct: 104 VIGLDS---SEPDINDGQIGMDQLEWLARELERVPDH-LCKIVTFHHHLLPIPNTGRERN 159

Query: 207 RMFGIQRFQKMIWHEGADLILHGHTHL 233
            +       +++   G D +L+GH H+
Sbjct: 160 ILLDSGDLLRLLNSYGVDFVLNGHKHV 186


>gi|148642443|ref|YP_001272956.1| phosphohydrolase calcineurin-like superfamily [Methanobrevibacter
           smithii ATCC 35061]
 gi|222446058|ref|ZP_03608573.1| hypothetical protein METSMIALI_01707 [Methanobrevibacter smithii
           DSM 2375]
 gi|261349403|ref|ZP_05974820.1| LacZ expression regulatory protein [Methanobrevibacter smithii DSM
           2374]
 gi|148551460|gb|ABQ86588.1| predicted phosphohydrolase, calcineurin-like superfamily
           [Methanobrevibacter smithii ATCC 35061]
 gi|222435623|gb|EEE42788.1| hypothetical protein METSMIALI_01707 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861766|gb|EFC94064.1| LacZ expression regulatory protein [Methanobrevibacter smithii DSM
           2374]
          Length = 247

 Score = 44.3 bits (103), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 104/266 (39%), Gaps = 48/266 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++ HISD+H+S             +G        +  F K VA   IN I   N D +
Sbjct: 1   MPLIVHISDLHISE------------LGF------EEDVFIKAVAE--INAI---NPDMI 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ N     E   +T +L     P  +  VPGNHDA   G +      +++ I   
Sbjct: 38  ILTGDLTNNGYYSEFIQATKYLEMFDAP--LFAVPGNHDARNLGYE-----TFEELIGE- 89

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
             CS        L   +   +IG  +   + P  ++G  G+ Q       L +   +  F
Sbjct: 90  --CSW------KLTKDDEFVVIGLDS---SSPDISSGNVGRPQHLWMEHQLDQCVIEELF 138

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            I+ +HH   P+  T    N +       K +     DL+L GH H+ ++ W  N     
Sbjct: 139 SIVALHHHVIPIPKTGRERNVLTDAGDVLKTLTDHEVDLVLAGHKHVPNI-WKMNNTLF- 196

Query: 247 PVVGIASASQKVHSNKPQASYNLFYI 272
             V   S S        + SYN++ I
Sbjct: 197 --VNAGSLSSNKLRGDDKNSYNVYEI 220


>gi|126732955|ref|ZP_01748716.1| possible phospodiesterase [Sagittula stellata E-37]
 gi|126706572|gb|EBA05648.1| possible phospodiesterase [Sagittula stellata E-37]
          Length = 279

 Score = 43.9 bits (102), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 107/268 (39%), Gaps = 48/268 (17%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH-----VSITGDIVNFTCNREIFTS 86
           +R++ L + H+       K+ ANL     LL  VD      V+I+GD        +   +
Sbjct: 2   RRVLHLSDLHYG------KDRANL--EAPLLETVDRLAPDLVAISGDFTQRARVSQFDRA 53

Query: 87  THWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNN 146
             +L  +  P     VPGNHD  +     + L  WK Y       +    L P  +  + 
Sbjct: 54  QAFLDKLTVP--WIAVPGNHDTPLDEFWIRLLTPWKRY-----RSAVSGDLEPVYQ-DDA 105

Query: 147 IALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK-----GFFRIIMMHHP----P 197
           + L+G +T            F  ++   + K +++A ++        RI+M+HHP    P
Sbjct: 106 MTLVGVNTV---------NRFSWQRGRLSEKRIKRACQQFSDAPDRARIVMLHHPLQHGP 156

Query: 198 VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQK 257
            +D       M G  R  K     GA ++L GH H   +   +   +L+ V    S S +
Sbjct: 157 EVDK----RLMRGAGRALKAFAESGAQVVLSGHLHNTVIAPFRAWPQLLFVQAGTSLSSR 212

Query: 258 VHSNKPQASYNLFYIEKKN---EYWTLE 282
           +       ++NL  ++ ++   E W  E
Sbjct: 213 MRGEV--NTFNLLEVDARSVTVESWGAE 238


>gi|257091555|ref|YP_003165198.1| hypothetical protein CAP2UW1_4619 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257048564|gb|ACV37751.1| hypothetical protein CAP2UW1_4619 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 436

 Score = 43.9 bits (102), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 65/158 (41%), Gaps = 31/158 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            +L HISDIH        E  P R             Y ++ + +       L  VD + 
Sbjct: 1   MLLLHISDIHFRAPECTQENDPSR------------AYRTRMIQDAKGRARALGGVDAIL 48

Query: 70  ITGDIVNFTCNREIFTSTHWL----RSIGNPHD-ISIVPGNHD---AYISGAKE-KSLHA 120
           ++GDI       E   ++ WL    R  G P + I +VPGNHD   + I G+++ +++H 
Sbjct: 49  VSGDIAFRGVQSEYAAASMWLEQLARESGCPLERIFVVPGNHDIDRSRIDGSRQIRNIHK 108

Query: 121 ----------WKDYITSDTTCSTGKKLFPYLRIRNNIA 148
                     +++     T  +TG+ LF  L   N  A
Sbjct: 109 AIKDAAPAYRYRELQAQLTDAATGRALFEPLAAYNEFA 146


>gi|226946463|ref|YP_002801536.1| metallophosphoesterase protein [Azotobacter vinelandii DJ]
 gi|226721390|gb|ACO80561.1| Metallophosphoesterase protein [Azotobacter vinelandii DJ]
          Length = 291

 Score = 43.9 bits (102), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 86/206 (41%), Gaps = 19/206 (9%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTST----H 88
           RI+ + + HF  ++   + V   L + +     D + ++GDI      RE F +      
Sbjct: 22  RILHISDTHFGTEQ---QPVIEALESHVREQGADLLVLSGDITQ-RARREQFDAAVAFVR 77

Query: 89  WLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIA 148
            L   G P  + ++PGNHD  +     + L  + +Y      C  G +L P     + + 
Sbjct: 78  RLEDCGIPRSL-VIPGNHDLPLHNLLARFLLPYGNY----RRC-FGWQLEPTFE-NDELL 130

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNR 207
           +IG +T    P    +G     Q  A  + LR+++     RI++ H P   +  S L N 
Sbjct: 131 VIGLNTT--HPRRRKDGRVTDAQVQAVCERLRRSDPDKL-RIVVAHQPFGAMLPSDLSNL 187

Query: 208 MFGIQRFQKMIWHEGADLILHGHTHL 233
             G +         G D+++ GH HL
Sbjct: 188 QHGAETALTRWAEAGLDIVMGGHIHL 213


>gi|317126730|ref|YP_004100842.1| metallophosphoesterase [Intrasporangium calvum DSM 43043]
 gi|315590818|gb|ADU50115.1| metallophosphoesterase [Intrasporangium calvum DSM 43043]
          Length = 296

 Score = 43.9 bits (102), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 97/235 (41%), Gaps = 48/235 (20%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           V+AH+SD+HL               GL++ H +    F K +A +  +      +D + +
Sbjct: 13  VIAHLSDLHLIAGE-----------GLLHGHIDTAAQFRKALARVEESG---EGIDALVL 58

Query: 71  TGDIVN------FTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
           +GD+ +      +   REI         +  P  + +  GNHD      + ++L A    
Sbjct: 59  SGDLTDVGQPEAYALLREIVAPVS--ERLAAP--VVVTGGNHD------ERRALAAGLHA 108

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
           + +D    T  K+       N + ++   +A+  P F   G+   + A    +L   A  
Sbjct: 109 VDTDEPQDTVTKV-------NGLRILTLDSAL--PGFHHGGFSDAQYAWLADQLTEPAPH 159

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADL--ILHGHTHLNS 235
                I++MHHPP+   S L   +    + R +  +  EG D+  IL GH H+ S
Sbjct: 160 G---TILVMHHPPITYRSPLMQLLDFEDVPRLRTAL--EGTDVRAILSGHLHVTS 209


>gi|327479919|gb|AEA83229.1| DNA repair exonuclease [Pseudomonas stutzeri DSM 4166]
          Length = 267

 Score = 43.5 bits (101), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 105/270 (38%), Gaps = 27/270 (10%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ + + HF  ++     V   L + +  H  D +  +GDI       +  ++  ++R +
Sbjct: 4   IVQISDTHFGTEQ---PAVVQALEDHVREHRADLLVFSGDITQRARRGQFASAAAFVRRL 60

Query: 94  --GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
                 D  ++PGNHD  +     +    + +Y         G  L P       + +IG
Sbjct: 61  EADGVGDTLVIPGNHDIPLYNVFARLFTPYGNY-----RQHFGDDLEPVFE-NEQMLVIG 114

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMFG 210
            +T    P    +G     Q    ++ L +++  G  RI++ H P   +  S L N   G
Sbjct: 115 LNTT--HPRRHKDGVVTARQVERVARRLEESDP-GKIRIVVAHQPFGAMVPSDLSNLQHG 171

Query: 211 IQRFQKMIWHEGADLILHGHTHLN-----SLHWIKNEKKLIPVVGIASASQKVHSNKPQA 265
            +   +     G DL++ GH HL      S  +    +++  V    + S ++    P  
Sbjct: 172 AEPALQRWAEHGLDLVMGGHIHLPYVLPLSRQYPGLAREIWMVQAGTTLSTRLRGTSPN- 230

Query: 266 SYNLFYI----EKK--NEYWTLEGKRYTLS 289
           S+N   +    EKK   E W L   R+ L 
Sbjct: 231 SFNRLKLHPGDEKKVCVERWDLSAGRFVLG 260


>gi|325957916|ref|YP_004289382.1| metallophosphoesterase [Methanobacterium sp. AL-21]
 gi|325329348|gb|ADZ08410.1| metallophosphoesterase [Methanobacterium sp. AL-21]
          Length = 294

 Score = 43.5 bits (101), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 95/242 (39%), Gaps = 69/242 (28%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           + +AHISDIHL        +S KRI G+VN   N++K                   D V+
Sbjct: 57  YKIAHISDIHLGQW-----ISAKRIEGVVNL-VNKQKP------------------DIVA 92

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISI-VPGNHDAYISGAKEKSLHAWKDYITSD 128
           ITGD V++  N  I     +L+++  P D ++ V GNHD +I   + + +      I  +
Sbjct: 93  ITGDSVSYVVNEPILDMLRYLKNL-KPKDATLAVLGNHDHWIGADEIRKVMKETGIIELE 151

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               T K+    L    NIA I   T                  H  + +L K  + G  
Sbjct: 152 NDVYTIKRGDAQL----NIAGIDSVTL---------------DKHDLNAVLNKLPESG-P 191

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
            I++ H P   D S+   R F +Q              L GH+H   +        +IP 
Sbjct: 192 AILLAHEPDFADVSAATGR-FSLQ--------------LSGHSHGGQM--------IIPG 228

Query: 249 VG 250
           VG
Sbjct: 229 VG 230


>gi|167644056|ref|YP_001681719.1| metallophosphoesterase [Caulobacter sp. K31]
 gi|167346486|gb|ABZ69221.1| metallophosphoesterase [Caulobacter sp. K31]
          Length = 286

 Score = 43.5 bits (101), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 51/250 (20%), Positives = 95/250 (38%), Gaps = 16/250 (6%)

Query: 31  PKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWL 90
           P +++ + + HF  +   + E A   IN       D +   GD+     + E   +  WL
Sbjct: 8   PLKLVQVSDIHFGGEHKAAVEAAVERIN---AEAPDLLIAAGDLTKDGKSTEFDAAQAWL 64

Query: 91  RSIGNPHDISIVPGNHDAYISGAKE---KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNI 147
             +  P  ++  PGNHD    G  E   + +  W+ Y +       G+    +   R  +
Sbjct: 65  DRLPRPRLVT--PGNHDTPFVGPSEILTRLVAPWRRYESR----FGGRHNSDWDDPRATV 118

Query: 148 ALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPV-LDTSSLYN 206
           A +  + A       + G   + Q       L +A   G  +I++ HHP + +    +  
Sbjct: 119 ATLNSARAFQLRLNWSKGAVSRGQVREVCADL-EAAAPGAVKIVVCHHPLIEMLGGPMTA 177

Query: 207 RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQAS 266
           ++ G     +     G DL+L GH H   +H           VG  + S +     P  S
Sbjct: 178 KVRGGTAAAQAFSQAGVDLVLTGHIHAPFVHPYPFSDGCTQAVGSGTLSVRERGVPP--S 235

Query: 267 YNLFYIEKKN 276
           +N+  ++  +
Sbjct: 236 FNVIEVDDAD 245


>gi|281357041|ref|ZP_06243531.1| metallophosphoesterase [Victivallis vadensis ATCC BAA-548]
 gi|281316599|gb|EFB00623.1| metallophosphoesterase [Victivallis vadensis ATCC BAA-548]
          Length = 267

 Score = 43.5 bits (101), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 100/234 (42%), Gaps = 26/234 (11%)

Query: 12  LAHISDIHLS-YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANL--LINDILLHNVDHV 68
           + H SD H    +  +     KR +G+ N+ F R+  F  +++ L   ++ IL    D  
Sbjct: 3   IIHFSDPHAGGPAEDWLAYVDKRWVGVFNYRFRRQ--FRHDMSKLKKAVDYILDVKPDVA 60

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNP-HDISI----VPGNHDAYISGAKEKSLHAWKD 123
             TGD+ +     E       +R I  P  D SI    +PGNHD Y+   + K + A  +
Sbjct: 61  VCTGDLTSTGQPGEF----EQVRPILQPLRDSSIPLLYLPGNHDCYVK--RPKCVRAVNE 114

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            +   +         P +R    +  +  + +  +    + G+     +    ++   A 
Sbjct: 115 MVEYLSRGDYRFAELPLVREYAGVEFLLLNCSRPSNLLCSWGFVDPRDSEYLDRVC-SAP 173

Query: 184 KKGFFRIIMMHHP-----PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
           K+G  R+++ H+P     P+L    + +R+FG +R  +++     DL L GH H
Sbjct: 174 KRGP-RVLLSHYPMFEEHPIL---RMRHRLFGQKRILELMKEGKIDLSLCGHVH 223


>gi|56475738|ref|YP_157327.1| DNA repair exonuclease [Aromatoleum aromaticum EbN1]
 gi|56311781|emb|CAI06426.1| DNA repair exonuclease [Aromatoleum aromaticum EbN1]
          Length = 285

 Score = 43.1 bits (100), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 98/239 (41%), Gaps = 17/239 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R+  + + HF  ++     V + L  D+L    D V +TGDI       +   +  +L S
Sbjct: 2   RLAHISDPHFGTEE---APVRDALREDLLREAPDLVVLTGDITQRARQAQFRAARAFLDS 58

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  +PGNHD  +     +    ++ Y      C++   L P  R R  +A++G 
Sbjct: 59  LA-PLPVLTLPGNHDLPLFDLFTRFTAPYRHY--RRHICAS---LSPLWRGRR-VAVVGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKG-FFRIIMMHHP-PVLDTSSLYNRMFG 210
           ++             G+  A    ++ R+    G  F+++ +HHP  +++ S   NR+ G
Sbjct: 112 NSTRML-----RHKHGELPAPLVEQVARQLAALGESFKVVALHHPLEIIEPSDRRNRVRG 166

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
                      GADL L GH HL       +  +   V+   ++      N    SYNL
Sbjct: 167 ADAALAAWIAAGADLFLGGHIHLPYCVATGDGSRDALVLQAGTSMSTRRRNGRPNSYNL 225


>gi|15606092|ref|NP_213469.1| hypothetical protein aq_684 [Aquifex aeolicus VF5]
 gi|2983283|gb|AAC06876.1| putative protein [Aquifex aeolicus VF5]
          Length = 249

 Score = 42.7 bits (99), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 55/266 (20%), Positives = 106/266 (39%), Gaps = 50/266 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +AHISD+H+                   W+ +R       + N L+  +     D + IT
Sbjct: 3   IAHISDLHVK----------------CEWYEDR-------LGNNLVKYLNAQKPDLLIIT 39

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+ ++    E   +  +L  I     + +VPGNHDA     + +    ++++  +    
Sbjct: 40  GDLTDYGYYAEYKRAYSFLELIEVEKRV-VVPGNHDA-----RNEGYELFEEFFGTR--- 90

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
                  PY      + +IG  +++   P    G+ G++      + L+    K   +I+
Sbjct: 91  ------MPYYE-DEYMVIIGMDSSL---PDREEGHIGRKGYKFLRETLKDKGDK--LKIV 138

Query: 192 MMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            +HH   P+  T S    +       K++   G +L+L GH H  +  W  NE   +   
Sbjct: 139 ALHHHVVPIPATGSDLAILTDAGNLMKVVDELGVELVLTGHKH-KAWVWKLNETYYVTA- 196

Query: 250 GIASASQKVHSNKPQASYNLFYIEKK 275
              +A+ +    K   S+ + Y+E +
Sbjct: 197 --GTATTRRLKAKDYPSFYMLYLEDE 220


>gi|119385110|ref|YP_916166.1| metallophosphoesterase [Paracoccus denitrificans PD1222]
 gi|119374877|gb|ABL70470.1| metallophosphoesterase [Paracoccus denitrificans PD1222]
          Length = 262

 Score = 42.7 bits (99), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 90/217 (41%), Gaps = 29/217 (13%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + HF  ++   + + + L++ I     D V +TGD+ +   + +   +  +LR 
Sbjct: 3   RILHLSDLHFGLER---QPLVDPLLDRINGARADLVVVTGDLTHRGRSAQFAQAAAFLRR 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIR--NNIALI 150
           I  P  +  VPGNHD  +    ++ +  ++ +  +             LR++  N++  +
Sbjct: 60  IEAP--LLAVPGNHDIPLYKLADRMMRPYRRWRRAIAANLEPVGHVGNLRVQGVNSVDPM 117

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP----PVLDTSSLYN 206
                I TP   A    G + A                 I+ +HHP    P +D + +  
Sbjct: 118 AWQRGIITPAQVARVIAGIDPA--------------CINIVALHHPMQQRPQVDKALMQG 163

Query: 207 RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
               + RF+     EG  L+L GH HL S+     E+
Sbjct: 164 AGPALARFEA----EGVQLVLSGHLHLWSIGAFLGEQ 196


>gi|18976460|ref|NP_577817.1| icc related protein [Pyrococcus furiosus DSM 3638]
 gi|18891999|gb|AAL80212.1| icc related protein [Pyrococcus furiosus DSM 3638]
          Length = 501

 Score = 42.7 bits (99), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 105/268 (39%), Gaps = 49/268 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            ++AHISD H++   +F                  K Y      +L++N+I     D V 
Sbjct: 1   MLIAHISDTHITNEVAF------------------KAY----AFDLIVNEINTRPFDLVI 38

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+ N     E   +++ L+ I  P  + + PGNHDA   G +      ++ YI    
Sbjct: 39  HTGDVTNNGLREEYEHASYLLKKIEKP--LIVAPGNHDARNVGYE-----LFERYIGP-- 89

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                  LF     ++ + +   ST    P  S     G +      KL   +NKK   +
Sbjct: 90  -------LFGVYEFKDGVIIWVDST---IPDLSDGRIGGYKFRWLKEKLEEYSNKK--IK 137

Query: 190 IIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           I + HH   P+ DT    N ++       ++      L + GH H+ +++ +++    + 
Sbjct: 138 IAVAHHHLVPLPDTGRERNVLYNAGDVLDLLLSHDVTLYMCGHKHVPNVYRVED----LV 193

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKK 275
           V      S +        SYN+  I +K
Sbjct: 194 VANAGCTSCRKTRKGDVNSYNIVKISEK 221


>gi|20094867|ref|NP_614714.1| calcineurin superfamily phosphohydrolase [Methanopyrus kandleri
           AV19]
 gi|19888094|gb|AAM02644.1| Predicted calcineurin superfamily phosphohydrolase [Methanopyrus
           kandleri AV19]
          Length = 270

 Score = 42.7 bits (99), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 86/231 (37%), Gaps = 57/231 (24%)

Query: 12  LAHISDIHLS-----YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           + HISD+H+S     +SP  F                   Y   E  N L  D+++    
Sbjct: 5   IVHISDLHISPYRKSWSPEVF-------------------YRGIEQINDLRPDVVI---- 41

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY-- 124
              +TGD+ +    RE    +  L  I  P  +  VPGNHDA   G        W  +  
Sbjct: 42  ---VTGDLTDNGLVREYEEVSSLLEKIEAP--VVPVPGNHDARNLG--------WMTFED 88

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
           +  D         +   R+  ++ ++G  +   + P    G  G+E+     + LR+   
Sbjct: 89  VFGDR--------YRVERVSADLYVVGLDS---SEPDVDYGQLGRERQEWLEETLRRI-P 136

Query: 185 KGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
            G  + I MHH   PV       N +        +    G DL+L GH H+
Sbjct: 137 GGACKCIAMHHHLLPVPGAGRERNVLVDAGEMINLCIKYGVDLVLCGHRHV 187


>gi|14590054|ref|NP_142118.1| hypothetical protein PH0104 [Pyrococcus horikoshii OT3]
 gi|3256490|dbj|BAA29173.1| 505aa long hypothetical protein [Pyrococcus horikoshii OT3]
          Length = 505

 Score = 42.4 bits (98), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 106/269 (39%), Gaps = 49/269 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            ++AHISD H++   +F                  K Y      +L++N+I     D V 
Sbjct: 4   MLIAHISDTHITNEVAF------------------KSY----AYDLIVNEINTKPFDLVV 41

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+ N     E   +++ ++ I  P  + +VPGNHDA   G +      ++ YI    
Sbjct: 42  HTGDVTNNGLREEYEHASYLIKKIEKP--LVVVPGNHDARNVGYE-----LFEKYIGP-- 92

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                  L+      N + +   ST    P  S     G +      KL   ++KK   +
Sbjct: 93  -------LYGVYEFDNGVIIWLDST---IPDLSDGRVGGYKFKWLKEKLEAYSHKK--IK 140

Query: 190 IIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           I+  HH   P+ DT    N +F       ++      L + GH H+ +++ +  E  ++ 
Sbjct: 141 IVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLTHEVTLYMCGHKHVPNVYRV--EDLVVD 198

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKN 276
             G AS  +    +    SYN+  I  K 
Sbjct: 199 NAGCASCRKTRKGD--VNSYNIVKITDKG 225


>gi|313158523|gb|EFR57917.1| Ser/Thr phosphatase family protein [Alistipes sp. HGB5]
          Length = 397

 Score = 42.4 bits (98), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 86/213 (40%), Gaps = 42/213 (19%)

Query: 52  VANLLINDILLHNVDHVSITGDIVN-FTCNREIF-----TSTHWLRSIGNPHDISIVPGN 105
           V  LLI D      D V + GD++N     + +F     +++  L   G P  + ++ GN
Sbjct: 161 VFRLLIGDAPKQKPDFVCLNGDLLNSIESEKALFEGFLASASELLTPAGIP--LVVMRGN 218

Query: 106 HDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNN----IALIGCSTAIATPPF 161
           HD      + K    W DY  + T  S       Y   R      + L GC       P 
Sbjct: 219 HD-----GRGKFARHWLDYFPTPTGES-------YYTFRRGPVFFVVLDGCEDK----PD 262

Query: 162 SANGYFGQEQAHA----TSKLLR-----KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           S   Y+G   A A     ++ LR     +  +   +RI+++H PP  +    ++    I+
Sbjct: 263 SDIRYYGLSTADAYREQQAQWLRGVVAGEEFRSAPYRIVLIHMPP--NKGRGWHGELEIE 320

Query: 213 R-FQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           R F  ++   G DL+L GH H     WI +  +
Sbjct: 321 RLFLPILDGSGIDLMLCGHYH--RYQWIDDRSR 351


>gi|268324463|emb|CBH38051.1| conserved hypothetical protein, calcineurin-like phosphoesterase
           family [uncultured archaeon]
 gi|268324870|emb|CBH38458.1| conserved hypothetical protein, calcineurin-like phosphoesterase
           family [uncultured archaeon]
          Length = 247

 Score = 42.4 bits (98), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 60/288 (20%), Positives = 114/288 (39%), Gaps = 52/288 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           + HISDIH++                       +++F  E+   +I  I     + V +T
Sbjct: 3   VVHISDIHVA-----------------------EQHFLPELLERVIRSINEIEPEIVVVT 39

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+       E   +  ++  I     + ++PGNHDA   G        +++     +  
Sbjct: 40  GDLTENGHQSEFKRAKSYIEKIECEKKV-VIPGNHDARNVG-----YLGFEEIFGHRSII 93

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
             G+           I ++G  +   T P    G+ G+E+     K L   +    F+++
Sbjct: 94  EKGE----------GITIVGIDS---TQPDLDVGHVGREKYGWIEKSLNSND----FKVV 136

Query: 192 MMHHPPVLDTSSLYNRMFGIQRFQ--KMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            +HH  +    +   R   +      +++   G DL+L GH H+    WI N   +I   
Sbjct: 137 ALHHHLISIPKTGRERQIPMDAGDVLELLVRCGVDLVLCGHKHVP---WIWNLNGMIIAN 193

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
              + + +V  N PQ S+NL  I+++ +  T   + Y+     L ++K
Sbjct: 194 AGTACTSRVKWNIPQ-SFNLIEIDEEEKGTTKIYRMYSSGGQELVLEK 240


>gi|13488517|ref|NP_109524.1| 3',5'-cyclic-nucleotide phosphodiesterase CpdA-like protein
           [Mesorhizobium loti MAFF303099]
 gi|14028271|dbj|BAB54863.1| 3',5'-cyclic-nucleotide phosphodiesterase CpdA homolog
           [Mesorhizobium loti MAFF303099]
          Length = 269

 Score = 42.4 bits (98), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 108/255 (42%), Gaps = 36/255 (14%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           K ++ L + HF + +    ++ + +  ++   + D + ++GD+       E   +  +L 
Sbjct: 2   KTLVHLSDLHFGKTE---SQLVDAIAAEVRAVDSDLLVVSGDLTQRARKDEFLQARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKS---LHAWKDYITSDTTCSTGKKLFPYLRIRNNIA 148
           S+  P    +VPGNHD  +     ++   L  ++ YI +DT         P+    + +A
Sbjct: 59  SLPGPR--IVVPGNHDVPLWNVFARAMTPLSRYRRYIEADTD--------PFY-ADSEVA 107

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRM 208
           ++G +TA +           Q +A AT K    ++     RI++ HHP   +   L +  
Sbjct: 108 VVGINTARSLTIKDGRINVRQLKA-ATEKFAHMSDD--ITRIVVTHHP--FEGRDLESDD 162

Query: 209 FGIQRFQKMIWH----EGADLILHGHTHLNSL------HWIKNEKKLIPVVGIASASQKV 258
            GI     +  H     G D+IL GH HL+        + I     L+   G A +S+  
Sbjct: 163 -GIVGRADLAMHAFSRSGVDIILSGHQHLHRAGSSARRYLIDGYAALLIQAGTAVSSRL- 220

Query: 259 HSNKPQASYNLFYIE 273
              +   S+N+  IE
Sbjct: 221 --RRAANSFNIIRIE 233


>gi|254294395|ref|YP_003060418.1| metallophosphoesterase [Hirschia baltica ATCC 49814]
 gi|254042926|gb|ACT59721.1| metallophosphoesterase [Hirschia baltica ATCC 49814]
          Length = 258

 Score = 42.4 bits (98), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 86/211 (40%), Gaps = 25/211 (11%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           ++ + + H   +   + E+A+  I  +   N D + + GD+       E   ++ WL   
Sbjct: 4   LVHMADLHLGTEDVRAMEIASREIKQL---NPDAIIVAGDLTQSGKKSEFILASEWLSQF 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPY---LRIRNNIALI 150
             P   +IVPGNHD  +     + +  +  +           +LF     L+I ++  + 
Sbjct: 61  LIPK--TIVPGNHDTPLINMFSRVVRPFGRF----------DRLFARHSNLQI-DDTHIA 107

Query: 151 GCSTAIATPPFS--ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--PVLDTSSLYN 206
           G +TA      S  A G    E  +    L + A++K    II  HHP  P+        
Sbjct: 108 GLNTARGWQVRSNWAEGSVNSEDLNEILDLQKVADQK--LNIIACHHPFLPIPHVPMRTR 165

Query: 207 RMFGIQRFQKMIWHEGADLILHGHTHLNSLH 237
            + G +  +K+    G  L+L+GH H  + H
Sbjct: 166 TIRGRKSSEKIAARNGRSLMLYGHVHTPAAH 196


>gi|254172134|ref|ZP_04878810.1| metallophosphoesterase, calcineurin superfamily [Thermococcus sp.
           AM4]
 gi|214034030|gb|EEB74856.1| metallophosphoesterase, calcineurin superfamily [Thermococcus sp.
           AM4]
          Length = 500

 Score = 42.4 bits (98), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 90/237 (37%), Gaps = 49/237 (20%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   +F                  K Y      +L++ +I   + D V
Sbjct: 1   MIKIAHISDTHITNEGAF------------------KGY----AFDLIVEEINRGDFDFV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAK--EKSLHAWKDYIT 126
             TGDI N     E   + + L  I  P  + ++PGNHD    G K  EK +        
Sbjct: 39  VHTGDITNQGLREEYEQAAYQLGKIKKP--LVVIPGNHDVRNVGYKLFEKFIGPLNGVYE 96

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D                 N  LI   + I  P  S     G +     +KL   ++KK 
Sbjct: 97  FD-----------------NGVLIWVDSTI--PDLSDGRIGGHKFRWLKAKLEEYSSKK- 136

Query: 187 FFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            F+I+  HH   P+ DT    N +F       ++      L   GH H+ +++ +++
Sbjct: 137 -FKIVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLRHEVTLYTCGHKHVPNVYRVED 192



 Score = 36.2 bits (82), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 109/266 (40%), Gaps = 46/266 (17%)

Query: 19  HLSYSPSFFELSPKRIIGLVNW---HFNRKKYFSKEVANLLIN--------DILLHNVDH 67
           H    P  F  S KR++ +V     + + + YF ++V   +I         D+++HN   
Sbjct: 241 HRPIRPKIFVPSGKRVLRIVQISESNVSDRVYFRRKVFENVIRMINERLKPDLVIHN--- 297

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
               GD+V+    R    +  + R+I    +  +VPG++D    G +      +++Y   
Sbjct: 298 ----GDVVDAGIERYYERAYEYYRAIST--EKLVVPGHNDITYLGHE-----LFEEYFGE 346

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                      P L   +   +I   +A    P    G  GQ +   T   L + N +  
Sbjct: 347 -----------PQLIEFDGYVIIPVLSAQYETPIGVVGRMGQRKLERT---LEEYNDR-- 390

Query: 188 FRIIMMHHPPV-LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           FRI++MHH  + +  S     +       K++  E  +L+L GH    + + +K E    
Sbjct: 391 FRIVVMHHNVIPIPRSREIGFLEDGGDVLKLLTRERTELVLTGHG--GNAYGVKVEGT-- 446

Query: 247 PVVGIASASQKVHSNKPQASYNLFYI 272
           P+V   S S ++H N    S+NL  I
Sbjct: 447 PIVNAGSVSWELHRNPFGNSFNLIDI 472


>gi|21226673|ref|NP_632595.1| transcriptional regulator, Icc-like protein [Methanosarcina mazei
           Go1]
 gi|20904957|gb|AAM30267.1| transcriptional regulator, Icc related protein [Methanosarcina
           mazei Go1]
          Length = 262

 Score = 42.4 bits (98), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 102/243 (41%), Gaps = 30/243 (12%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           +I+ L + HF+ + Y+  E+A+ ++  I   + D V ITGD+       E   + +++  
Sbjct: 18  KIVHLSDIHFS-EAYYMPEIADSMLQIINESSPDIVIITGDLTENGFAAEYNGAKNFIDK 76

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           I   + + IVPGNHD     +K      ++D   + ++         Y     ++ +IG 
Sbjct: 77  IECKNKV-IVPGNHD-----SKNAGYLFFEDIFKARSSSG-------YF---GDVTVIGL 120

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFG 210
            +   + P   +G+ G+E        +      G F++  +HH   P+  T    N +  
Sbjct: 121 DS---SQPELDDGHIGRENY----GWIESTFSTGSFKVFALHHHLIPIPKTGRGNNVLVD 173

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                +++   G +L+L GH H   + W+     +  +      S K+     Q  YNL 
Sbjct: 174 AGDVLELLDRSGVNLVLCGHWH---IPWVWRLNDMFIISAGTVCSSKIRGKTSQC-YNLI 229

Query: 271 YIE 273
            +E
Sbjct: 230 ELE 232


>gi|134081525|emb|CAK41961.1| unnamed protein product [Aspergillus niger]
          Length = 388

 Score = 42.4 bits (98), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 15/79 (18%)

Query: 31  PKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWL 90
           P R++ + + H       + E  ++   D+L+H        GD+ N    REI  + +WL
Sbjct: 46  PIRVVCISDTH-------TLEYPDVPDGDLLIH-------AGDLCNDGSAREIQAAVNWL 91

Query: 91  RSIGNPHDISIVPGNHDAY 109
           RS+ +PH + I  GNHD+Y
Sbjct: 92  RSLPHPHKVVIC-GNHDSY 109


>gi|317034663|ref|XP_001400850.2| phosphoric ester hydrolase [Aspergillus niger CBS 513.88]
          Length = 383

 Score = 42.0 bits (97), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 15/79 (18%)

Query: 31  PKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWL 90
           P R++ + + H       + E  ++   D+L+H        GD+ N    REI  + +WL
Sbjct: 46  PIRVVCISDTH-------TLEYPDVPDGDLLIH-------AGDLCNDGSAREIQAAVNWL 91

Query: 91  RSIGNPHDISIVPGNHDAY 109
           RS+ +PH + I  GNHD+Y
Sbjct: 92  RSLPHPHKVVIC-GNHDSY 109


>gi|313202104|ref|YP_004040762.1| metallophosphoesterase [Methylovorus sp. MP688]
 gi|312441420|gb|ADQ85526.1| metallophosphoesterase [Methylovorus sp. MP688]
          Length = 268

 Score = 42.0 bits (97), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 77/179 (43%), Gaps = 12/179 (6%)

Query: 57  INDILLHNVDHVSI-TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE 115
           +  +L     H+ I +GDI       +   +  ++ S+  PH + ++PGNHD  +     
Sbjct: 23  LQSLLWQQAPHLLILSGDITQRARRSQFKHARAFVDSLNIPHRL-VIPGNHDIPLFNLLA 81

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHAT 175
           + L  ++ +       + G++L P  R    +A+   +T         +G     Q    
Sbjct: 82  RVLAPYRRH-----RHAFGQELEPVYRDDKTLAITVNTTRAYR---HEDGEVSPAQIKRV 133

Query: 176 SKLLRKANKKGFFRIIMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
            + L++A+ +   R+++ H P  V +     N + G Q   +     GADLIL GH HL
Sbjct: 134 CEQLQQASPQQL-RLVITHQPVYVTEVRDESNLLHGYQAAVRAWAEAGADLILGGHIHL 191


>gi|255594763|ref|XP_002536159.1| conserved hypothetical protein [Ricinus communis]
 gi|223520651|gb|EEF26224.1| conserved hypothetical protein [Ricinus communis]
          Length = 224

 Score = 42.0 bits (97), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 106/259 (40%), Gaps = 37/259 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD+H      F    P  +  L+            ++A  L  D+LL      
Sbjct: 1   MSTILHISDLH------FGTERPPVVRALL------------QLARELKPDLLL------ 36

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGDI       +   +  ++ ++  P  + IV GNHD  +     ++LH +++Y    
Sbjct: 37  -ITGDITQRARRAQFREAAAFVEALAAPAQV-IVSGNHDVPLYNLFARALHPFRNY---- 90

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              + G  L P     +++ ++G ++    P     G    EQ    S  LR A      
Sbjct: 91  -RRAFGANLEPDF-ASDDLLVLGVNS--TRPQRHTRGSVSVEQIERVSARLRAAAPDQ-L 145

Query: 189 RIIMMHHPPV-LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           RI+ MHHP + +     +N +       +     GADLI+ GH HL  +  + +  + + 
Sbjct: 146 RIVAMHHPVLAISDGDRHNLLHNRAAALRAWALAGADLIIGGHIHLPYVRPLPDLPRSLW 205

Query: 248 VVGIASASQ-KVHSNKPQA 265
            V   +A+  +V  + P +
Sbjct: 206 TVQAGTATSWRVRGDAPNS 224


>gi|332710042|ref|ZP_08429997.1| putative phosphohydrolase [Lyngbya majuscula 3L]
 gi|332351185|gb|EGJ30770.1| putative phosphohydrolase [Lyngbya majuscula 3L]
          Length = 539

 Score = 42.0 bits (97), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 50/99 (50%), Gaps = 24/99 (24%)

Query: 14  HISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGD 73
           H+SD+H++        +PK+              +S ++A  L  ++ + ++D + ++GD
Sbjct: 209 HLSDLHIT--------TPKQAT-----------LWSNQLAQDLSYELQIPDLDALILSGD 249

Query: 74  IVNFTCNREIFTSTHWLRSIG-----NPHDISIVPGNHD 107
           I N++   E   +  +L ++G     +P  I IVPGNHD
Sbjct: 250 IANYSTPEEYQAAQQFLDNLGKDFPLDPEKIVIVPGNHD 288


>gi|189347350|ref|YP_001943879.1| metallophosphoesterase [Chlorobium limicola DSM 245]
 gi|189341497|gb|ACD90900.1| metallophosphoesterase [Chlorobium limicola DSM 245]
          Length = 288

 Score = 41.6 bits (96), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 107/268 (39%), Gaps = 78/268 (29%)

Query: 12  LAHISDIHLSYSPSFFEL-SPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           +AHISD+HL+       L S  R++     HFN +K                  +DH+ I
Sbjct: 8   VAHISDLHLAGRHDRRSLASLDRML----RHFNERK------------------IDHLVI 45

Query: 71  TGDIVNFTCNREIFTSTHW--LRSIGNPHDI------SIVPGNHDAY------------- 109
           TGD+ +       +    W  +R     HD       +++PGNHD               
Sbjct: 46  TGDLFD------TYMPAEWPVMREKLREHDFCSWERTTLIPGNHDLITIEEEMRIYNALN 99

Query: 110 -ISGAKEKSLHA--------WKDYITSDTTCSTGKKLFPYLRI----RNNIALIGCSTA- 155
              G+++++L          + D +  D      KK FPY+++    R ++A +G ++  
Sbjct: 100 PFPGSRKRALQERLSGFCALFGDLMGGDGEI---KKGFPYVKVMRFPRVSLAFVGVNSVW 156

Query: 156 ---IATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMFG- 210
               +  P  A G+    +  A S+       +G F I + HH   V  TSS  ++ F  
Sbjct: 157 PWHRSDNPLGARGFIDPAEFRALSQPSVAEALRGSFVIGLCHHALRVYGTSSPIDQAFDW 216

Query: 211 ----IQR--FQKMIWHEGADLILHGHTH 232
               I R  +  ++     ++I+HGH H
Sbjct: 217 TMELINRDEYLAVMQELRTNVIVHGHFH 244


>gi|146281671|ref|YP_001171824.1| DNA repair exonuclease [Pseudomonas stutzeri A1501]
 gi|145569876|gb|ABP78982.1| probable DNA repair exonuclease [Pseudomonas stutzeri A1501]
          Length = 373

 Score = 41.6 bits (96), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 58/270 (21%), Positives = 105/270 (38%), Gaps = 27/270 (10%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ + + HF  ++     V   L + +  H  D +  +GDI       +  ++  ++R +
Sbjct: 110 IVQISDTHFGTEQ---PAVVQALEDHVREHRADLLVFSGDITQRARRGQFASAAAFVRRL 166

Query: 94  --GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
                 D  ++PGNHD  +     +    + +Y         G  L P       + +IG
Sbjct: 167 EADGVGDTLVIPGNHDIPLYNVFARLFTPYGNYRQH-----FGDDLEPVFE-NEQMLVIG 220

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMFG 210
            +T    P    +G     Q    ++ L +++  G  RI++ H P   +  S L N   G
Sbjct: 221 LNTT--HPRRHKDGVVTARQVERVARRLGESDP-GKIRIVVAHQPFGAMVPSDLSNLQHG 277

Query: 211 IQRFQKMIWHEGADLILHGHTHLN-----SLHWIKNEKKLIPVVGIASASQKVHSNKPQA 265
            +   +     G DL++ GH HL      S  +    +++  V    + S ++    P  
Sbjct: 278 AEPALQRWAEHGLDLVMGGHIHLPYVLPLSRQYPGLAREIWMVQAGTTLSTRLRGTSPN- 336

Query: 266 SYNLFYI----EKK--NEYWTLEGKRYTLS 289
           S+N   +    EKK   E W L   R+ L 
Sbjct: 337 SFNRLKLHPGDEKKVCVERWDLSAGRFVLG 366


>gi|237735160|ref|ZP_04565641.1| metallophosphoesterase [Mollicutes bacterium D7]
 gi|229381936|gb|EEO32027.1| metallophosphoesterase [Coprobacillus sp. D7]
          Length = 360

 Score = 41.6 bits (96), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 91/234 (38%), Gaps = 66/234 (28%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +  I+D+H+S S S  EL               +KY   E++ L        N D V +T
Sbjct: 131 ILEIADLHMSTSLSVTEL---------------QKY-CDEMSQL--------NADLVVLT 166

Query: 72  GDIVNF-TCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD--YITSD 128
           GDI +  T   ++  ++  L SI N   I  V GNHD           HA+ D  +   D
Sbjct: 167 GDIFDENTPLDDMVNASKALASINNQQGIYYVYGNHD--------NGSHAFSDSEFGPED 218

Query: 129 TTCSTGKKLFPYLRIR----NNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK--A 182
              +  K     L       +NI +IG   A          ++G     +TS+LL     
Sbjct: 219 VRVTLEKNGIVVLEDAVVSLDNINIIGRKDA---------SFWGTNPRLSTSQLLEMIPE 269

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL 236
           NK+G + I++ H P  LD ++                  G DL L GHTH   L
Sbjct: 270 NKRGNYTIMLEHQPLNLDENAAL----------------GIDLQLSGHTHGGQL 307


>gi|256397978|ref|YP_003119542.1| metallophosphoesterase [Catenulispora acidiphila DSM 44928]
 gi|256364204|gb|ACU77701.1| metallophosphoesterase [Catenulispora acidiphila DSM 44928]
          Length = 247

 Score = 41.6 bits (96), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 83/210 (39%), Gaps = 42/210 (20%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           V+AH+SDIH+   P                   R    ++ V + L  D L  ++D V +
Sbjct: 4   VIAHVSDIHIDAGP-------------------RAAERTRRVFDHL--DALPADLDLVVL 42

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGDI +   + E  T     ++    H + + PGNHD            A++  +     
Sbjct: 43  TGDIADHGLDSEYETVR---QATATRHPLLVCPGNHD---------DREAFRRALLG-VP 89

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            STG     +   R  +AL  C ++I   P   +G+   E     +  L  A   G   +
Sbjct: 90  ASTGPINQVHRTDRFVVAL--CDSSI---PKQDDGFLADETLAWLAAEL-DATPDGVPVL 143

Query: 191 IMMHHPPVLDTSSLYN--RMFGIQRFQKMI 218
           I  HHPPV   +   +  R FG +R  + +
Sbjct: 144 IGFHHPPVELHTPFVDKIRQFGEERLAEAV 173


>gi|254000140|ref|YP_003052203.1| metallophosphoesterase [Methylovorus sp. SIP3-4]
 gi|253986819|gb|ACT51676.1| metallophosphoesterase [Methylovorus sp. SIP3-4]
          Length = 268

 Score = 41.6 bits (96), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 77/179 (43%), Gaps = 12/179 (6%)

Query: 57  INDILLHNVDHVSI-TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE 115
           +  +L     H+ I +GDI       +   +  ++ S+  PH + ++PGNHD  +     
Sbjct: 23  LQSLLWQQAPHLLILSGDITQRARRSQFKHARAFVDSLNIPHRL-VIPGNHDIPLFNLLA 81

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHAT 175
           + L  ++ +       + G++L P  R    +A+   +T         +G     Q    
Sbjct: 82  RLLTPYRRH-----RHAFGQELEPVYRDDKTLAITVNTTRAYR---HEDGEVSPAQIKRV 133

Query: 176 SKLLRKANKKGFFRIIMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
            + L++A+ +   R+++ H P  V +     N + G Q   +     GADLIL GH HL
Sbjct: 134 CEQLQQASPQQL-RLVITHQPVYVTEVRDESNLLHGYQAAVRAWAEAGADLILGGHIHL 191


>gi|15679714|ref|NP_276832.1| transcriptional regulator Icc related protein [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|2622852|gb|AAB86192.1| transcriptional regulator Icc related protein [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 262

 Score = 41.2 bits (95), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 85/204 (41%), Gaps = 22/204 (10%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           K+I  + + HF  K  FS ++   L++ +   N D + ++GD+     + E   +  ++ 
Sbjct: 3   KKIAQISDVHFGEKN-FSDQLRKNLLHQLENENPDLIIVSGDLTTEGYSHEYELAAAFVD 61

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +        +PGNHDA   G     +H  K           G++ F +    +  A+IG
Sbjct: 62  ELRTITSTYTIPGNHDARNVGL----IHFEK---------LIGRRKFVHHD--SEFAVIG 106

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--PVLDTSSLYNRMF 209
             ++    P   +G  G +Q     K L +       +I+  HH   P+ +T    N + 
Sbjct: 107 LDSS---EPDINDGQIGMDQLDWLRKELERVPDH-LCKIVTFHHHLLPIPNTGRERNILL 162

Query: 210 GIQRFQKMIWHEGADLILHGHTHL 233
                 K++   G D +L+GH H+
Sbjct: 163 DSGDLLKLLKEYGVDFVLNGHKHV 186


>gi|167757606|ref|ZP_02429733.1| hypothetical protein CLORAM_03156 [Clostridium ramosum DSM 1402]
 gi|167702603|gb|EDS17182.1| hypothetical protein CLORAM_03156 [Clostridium ramosum DSM 1402]
          Length = 356

 Score = 41.2 bits (95), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 91/234 (38%), Gaps = 66/234 (28%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +  I+D+H+S S S  EL               +KY   E++ L        N D V +T
Sbjct: 127 ILEIADLHMSTSLSVTEL---------------QKY-CDEMSQL--------NADLVVLT 162

Query: 72  GDIVNF-TCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD--YITSD 128
           GDI +  T   ++  ++  L SI N   I  V GNHD           HA+ D  +   D
Sbjct: 163 GDIFDENTPLDDMVNASKALASINNQQGIYYVYGNHD--------NGSHAFSDSEFGPED 214

Query: 129 TTCSTGKKLFPYLRIR----NNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK--A 182
              +  K     L       +NI +IG   A          ++G     +TS+LL     
Sbjct: 215 VRATLEKNGIVVLEDAVVSLDNINIIGRKDA---------SFWGTNPRLSTSQLLEMIPE 265

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL 236
           NK+G + I++ H P  LD ++                  G DL L GHTH   L
Sbjct: 266 NKRGNYTIMLDHQPLNLDENAAL----------------GIDLQLSGHTHGGQL 303


>gi|194335841|ref|YP_002017635.1| metallophosphoesterase [Pelodictyon phaeoclathratiforme BU-1]
 gi|194308318|gb|ACF43018.1| metallophosphoesterase [Pelodictyon phaeoclathratiforme BU-1]
          Length = 291

 Score = 41.2 bits (95), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 79/204 (38%), Gaps = 37/204 (18%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPH--DISIVPGNHDA--------------- 108
           DH+ ITGD+ N +   E       L S G  H    +++ GNHD                
Sbjct: 41  DHLVITGDLSNSSNPEEWRIVKEKLESHGLYHWDKTTVIAGNHDLINLEEEMRFYNALNP 100

Query: 109 ---YISGAKEKSLHAWKDYITSDTTCST-GKKLFPYLRIRN----NIALIGCSTAI---- 156
                  A ++ + A+  +     +    G++ FP+++I N     IA +  ++      
Sbjct: 101 LPLLRKKAFDRKMAAFCTFFQELISGEEHGERAFPFVKIINYPSVRIAFVALNSVYPWYP 160

Query: 157 ATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMF------ 209
           A  P  A G     Q  A S     A+ K  F I + HH   V  T SL ++ F      
Sbjct: 161 ADNPLGARGVISAGQLRALSAQSTLASLKECFVIGLCHHAYRVYGTDSLIDQAFDWTMEL 220

Query: 210 -GIQRFQKMIWHEGADLILHGHTH 232
              + F  ++    A L+LHGH H
Sbjct: 221 KNREEFLALMQTMQAKLVLHGHFH 244


>gi|146277006|ref|YP_001167165.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17025]
 gi|145555247|gb|ABP69860.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17025]
          Length = 270

 Score = 41.2 bits (95), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 88/206 (42%), Gaps = 25/206 (12%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           KR++ L + HF R +    E+   LI  +     D V+I+GD+       +   +  ++ 
Sbjct: 2   KRLLHLSDLHFGRDR---PELLRPLIETVNGLAPDLVAISGDLTQRATEAQFRAAAAFVE 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  P  + +VPGNHD  +     + +  WK Y         G+ L P      +  +I 
Sbjct: 59  RLKPP--VLVVPGNHDVPLHNLYVRLVKPWKRY-----RRWFGRDLEPCW---EDDEMIV 108

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRK-ANKKGFFRIIM----MHHPPVLDTSSLYN 206
                  P     G+F   ++ + +++ R  AN++   R+++    M H P  DT  L  
Sbjct: 109 AGANTVNPLAWQQGWF---RSRSLARIRRIFANEESRVRVVVVHHPMEHTPE-DTKEL-- 162

Query: 207 RMFGIQRFQKMIWHEGADLILHGHTH 232
            M G  R    +   GAD+IL GH H
Sbjct: 163 -MRGAGRAIGELAECGADVILSGHLH 187


>gi|332708908|ref|ZP_08428879.1| heat domain-containing protein [Lyngbya majuscula 3L]
 gi|332352450|gb|EGJ32019.1| heat domain-containing protein [Lyngbya majuscula 3L]
          Length = 1365

 Score = 41.2 bits (95), Expect = 0.21,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 54/107 (50%), Gaps = 25/107 (23%)

Query: 6    TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
            T  M++L H+SD+H++        +P           ++   +S ++A  LI D+ + ++
Sbjct: 1029 TQTMYIL-HLSDLHIT--------TP-----------DQATLWSNQLAQDLIQDLQIPHL 1068

Query: 66   DHVSITGDIVNFTCNREIFTSTHWLRSIG-----NPHDISIVPGNHD 107
            D + ++GDI N++   E   +  +L ++      +   I +VPGNHD
Sbjct: 1069 DALILSGDIANYSTPEEYQAAQQFLHNLRQDFSLDSKQIVLVPGNHD 1115


>gi|118589028|ref|ZP_01546435.1| Ser/Thr protein phosphatase family protein [Stappia aggregata IAM
           12614]
 gi|118438357|gb|EAV44991.1| Ser/Thr protein phosphatase family protein [Stappia aggregata IAM
           12614]
          Length = 272

 Score = 40.8 bits (94), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 53/134 (39%), Gaps = 16/134 (11%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D + ITGDI +    RE   +   L  +  P  + +VPGNHD      +E +        
Sbjct: 38  DALVITGDITDGNDPREYALARSILSRVDMP--VFLVPGNHDGTQVMRRELAGFPGLAGS 95

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D  C T            +I LI   T I   P    G  GQ Q       L++++K 
Sbjct: 96  LDDKICYTADI--------ADIRLIALDTHI---PGDPRGRLGQAQLDWLDGQLKESSKT 144

Query: 186 GFFRIIMMHHPPVL 199
               +I +HHPP L
Sbjct: 145 ---TLIALHHPPAL 155


>gi|240102780|ref|YP_002959089.1| Metallophosphoesterase, Calcineurin-like phosphoesterase family
           [Thermococcus gammatolerans EJ3]
 gi|239910334|gb|ACS33225.1| Metallophosphoesterase, Calcineurin-like phosphoesterase family
           [Thermococcus gammatolerans EJ3]
          Length = 503

 Score = 40.8 bits (94), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 90/237 (37%), Gaps = 49/237 (20%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   +F                  K Y      +L++ +I   + D V
Sbjct: 4   MIKIAHISDTHITNEGAF------------------KGY----AFDLIVEEINRGDFDFV 41

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAK--EKSLHAWKDYIT 126
             TGDI N     E   + + L  I  P  + ++PGNHD    G K  EK +        
Sbjct: 42  VHTGDITNQGLREEYEQAAYQLGKIRKP--LVVIPGNHDVRNVGYKLFEKFIGPLNGVYE 99

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D                 N  LI   + I  P  S     G +     +KL   ++++ 
Sbjct: 100 FD-----------------NGVLIWVDSTI--PDLSDGRIGGHKFRWLKAKLEEYSDRR- 139

Query: 187 FFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            F+I+  HH   P+ DT    N +F       ++      L   GH H+ +++ +++
Sbjct: 140 -FKIVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLRHEVTLYTCGHKHVPNVYRVED 195



 Score = 38.5 bits (88), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 10/126 (7%)

Query: 148 ALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPV-LDTSSLYN 206
            +I   +A    P    G  GQ++     K+L + + +  FRI++MHH  + +  S    
Sbjct: 359 VIIPVLSAQYETPIGVVGRMGQKK---LEKVLEEYDDR--FRIVVMHHNVIPIPRSREIG 413

Query: 207 RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQAS 266
            +       K++  EG +L+L GH    + + +K E+   P+V   S S ++H N    S
Sbjct: 414 FLEDGGDVLKLLTREGTELVLTGHG--GNAYGVKVERT--PIVNAGSVSWELHRNPFGNS 469

Query: 267 YNLFYI 272
           +NL  +
Sbjct: 470 FNLIDV 475


>gi|303241252|ref|ZP_07327759.1| metallophosphoesterase [Acetivibrio cellulolyticus CD2]
 gi|302591263|gb|EFL61004.1| metallophosphoesterase [Acetivibrio cellulolyticus CD2]
          Length = 270

 Score = 40.8 bits (94), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 78/202 (38%), Gaps = 42/202 (20%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + H    K F K    +LI+ +     D +  TGD+VN+   ++   S + L  
Sbjct: 44  RIVHLSDLH---DKQFGKG-NKILIDKVKQQEPDIIVFTGDLVNWNT-KDFTASVNTLSE 98

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNN--IALI 150
           +     +  +PGNH+ Y SG  E      +        C+T      Y+ I N   I +I
Sbjct: 99  LNKFAQVYFIPGNHE-YRSGKSESIFKMLRKVDIEVLNCAT-----KYI-IANGEKIDII 151

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
           G   +IA             +     K L +  K   F+I++ H P              
Sbjct: 152 GLDKSIA-------------RVKTAEKKLIEFEKSSNFKIVLSHFP-------------- 184

Query: 211 IQRFQKMIWHEGADLILHGHTH 232
            + F +   +   DL+L GH H
Sbjct: 185 -EDFSRYYCNYNVDLVLSGHAH 205


>gi|227112617|ref|ZP_03826273.1| putative calcineurin-like phosphoesterase [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 274

 Score = 40.8 bits (94), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 95/237 (40%), Gaps = 54/237 (22%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            +LA ISD+H       F    +++   ++ +    K     V N L  + L    D V 
Sbjct: 1   MLLAQISDLH-------FRSEGRKLYEFIDINGENAK-----VINQL--NALSERPDAVV 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS-- 127
           I+GDIVN   ++E   +   L+ +  P  + ++PGNHD      K+  L+A +       
Sbjct: 47  ISGDIVNCGSSQEYQVAQRVLQMLDYP--MYVIPGNHD-----DKQHFLNAMRPLCPQLG 99

Query: 128 --DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQE-QAHATSKLLRKANK 184
                       FP   +  + +L G +    TP  S  G+  Q+ Q H+T +       
Sbjct: 100 DDPENIRYAVDDFPMRLLFIDTSLAGQAKGWLTP--STLGWLEQQLQEHSTRE------- 150

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFG---------IQRFQKMIWHEGADLILHGHTH 232
                 I MHHPP+   S+  +R+           I+RF +M        I  GHTH
Sbjct: 151 ----TAIFMHHPPLPLGSAHMDRIACENGSELLTLIERFPQMTR------IFCGHTH 197


>gi|162457579|ref|YP_001619946.1| hypothetical protein sce9293 [Sorangium cellulosum 'So ce 56']
 gi|161168161|emb|CAN99466.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
          Length = 269

 Score = 40.4 bits (93), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 88/206 (42%), Gaps = 20/206 (9%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           + ++ L + HF R     K +   LI  I       V I+GD+     + E   +  +L 
Sbjct: 2   RTLVHLSDLHFGR---VDKAILRPLIERIGGLEPHVVVISGDLTQRARDAEFAEARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEK---SLHAWKDYITSDTTCSTGKKLFPYLRIRNNIA 148
           ++ +P    +VPGNHD  +    ++    L  ++ +IT D        L P+  +   IA
Sbjct: 59  ALPSPR--IVVPGNHDVPLYNLFDRFFRPLDRYRSHITDD--------LSPF-HLDAEIA 107

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRM 208
           ++G +TA +      +G     Q       +     +   +I++ HHP  L  +S +  +
Sbjct: 108 VLGINTARSLT--IKDGRINARQVEGIKARMCDLGPE-ITKIVVTHHPFDLPENSPHAIV 164

Query: 209 FGIQRFQKMIWHEGADLILHGHTHLN 234
              ++    I   G D+IL GH H++
Sbjct: 165 GRARQAMAAIAGCGVDVILSGHLHMS 190


>gi|317054282|ref|YP_004118307.1| metallophosphoesterase [Pantoea sp. At-9b]
 gi|316952277|gb|ADU71751.1| metallophosphoesterase [Pantoea sp. At-9b]
          Length = 371

 Score = 40.4 bits (93), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 84/208 (40%), Gaps = 40/208 (19%)

Query: 28  ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTST 87
           E +  +++ L + H +  K F+      ++   +  +VD + ITGD+++ T N       
Sbjct: 140 EFAGYQLLQLTDLHIS--KLFNANWTAKMVKKAMALDVDLIVITGDVIDGTLNNR-RADV 196

Query: 88  HWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNI 147
             LR +  P  +  + GNH+ +   A      AW D++      S G K  P L     +
Sbjct: 197 EPLRGLHAPDGVLAITGNHEYFFEQA------AWTDHL-----ASLGLK--PLLNSHTVV 243

Query: 148 ALIGCSTAIATPPFSA---NGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSL 204
           A  G S  IA    ++    G  G + A A S     AN      ++++ H P       
Sbjct: 244 ARDGASLVIAGVTDASAPRRGATGPDLAGALSG--APANAP----VVLLDHQP------- 290

Query: 205 YNRMFGIQRFQKMIWHEGADLILHGHTH 232
                   R  +    +GAD+ L GHTH
Sbjct: 291 --------RNARQNAAQGADVQLSGHTH 310


>gi|14520324|ref|NP_125799.1| lacZ expression regulatory protein [Pyrococcus abyssi GE5]
 gi|5457539|emb|CAB49030.1| Predicted phosphohydrolase, putative [Pyrococcus abyssi GE5]
          Length = 505

 Score = 40.4 bits (93), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 105/267 (39%), Gaps = 49/267 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            ++AHISD H++   +F                  K Y      +L+ N+I     D V 
Sbjct: 4   MLIAHISDTHITNEVAF------------------KSY----AYDLIANEINTRPFDLVI 41

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+ N     E   +++ L+ I  P  + + PGNHDA   G +      ++ YI    
Sbjct: 42  HTGDVTNNGLREEYEHASYLLKKIEKP--LIVAPGNHDARNVGYE-----LFEKYIGP-- 92

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                  L      ++ + +   ST    P  S     G +     +KL   ++KK   +
Sbjct: 93  -------LIGVYEFKDGVIIWLDST---IPDLSDGRVGGYKFKWLKAKLEEYSHKK--IK 140

Query: 190 IIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           I+  HH   P+ DT    N +F       ++      L + GH H+ +++ +  E  ++ 
Sbjct: 141 IVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLSHDVTLYMCGHKHVPNVYRV--EDLVVD 198

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEK 274
             G AS  +    +    SYN+  I K
Sbjct: 199 NAGCASCRKTRKGD--VNSYNIVKITK 223


>gi|241764122|ref|ZP_04762158.1| metallophosphoesterase [Acidovorax delafieldii 2AN]
 gi|241366528|gb|EER61021.1| metallophosphoesterase [Acidovorax delafieldii 2AN]
          Length = 382

 Score = 40.4 bits (93), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 86/231 (37%), Gaps = 45/231 (19%)

Query: 17  DIHLSYSPSFFELSPKRIIGLVNWHFNR---KKYFSKEVANLLINDILLHNVDHVSITGD 73
           ++ L+  P   EL   R++ L + H +R   + +    VA    N +   N D + ITGD
Sbjct: 135 EVQLAQLPP--ELDGFRLVQLTDLHASRLLQRPWMEAVVAR--TNAL---NPDLIVITGD 187

Query: 74  IVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCST 133
           +V+ T           LR +   H +  +PGNH+ Y           W ++         
Sbjct: 188 LVDGTVGMRTH-DVEPLRDLTAGHGVYAIPGNHEYY------AEYQQWLEHFE-----RL 235

Query: 134 GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMM 193
           G ++   L     IA  G    +A     A   FGQ      + L     +     I++ 
Sbjct: 236 GVRML--LNEHVTIAGAGAEFVLAGITDRAAAPFGQPMPDIGAALAGVPQEAAV--ILLS 291

Query: 194 HHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH---LNSLHWIKN 241
           H PP            G Q   +     GADL L GHTH   +  LHW+  
Sbjct: 292 HRPP------------GAQDNAR----AGADLQLSGHTHGGQVLGLHWVTQ 326


>gi|262375894|ref|ZP_06069125.1| phosphohydrolase [Acinetobacter lwoffii SH145]
 gi|262308988|gb|EEY90120.1| phosphohydrolase [Acinetobacter lwoffii SH145]
          Length = 258

 Score = 40.4 bits (93), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 93/246 (37%), Gaps = 27/246 (10%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ L + HF  +K    E    + +    H ++ V I+GD+       + F    +L  +
Sbjct: 2   ILHLSDLHFGTEK---PECLEAIRHFCQTHPLEAVVISGDLTQRARLGQFFACKKFLDQL 58

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
             P+   ++PGNHD  +        H W       T           +    N  LIG +
Sbjct: 59  NTPY--MVIPGNHDIPL-------YHLWNRLFNPFTRYQIFFGELEPIFETENFYLIGVN 109

Query: 154 TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP---PVLDTSSLYNRMFG 210
           +      +   G+   EQ       L +A      +II+ H P   P  +     +    
Sbjct: 110 SIRRR--YHTKGHLSLEQIQRIDLQLAQAPASKL-KIIVSHQPFYVPFQNKRGFKDSPL- 165

Query: 211 IQRFQKMIWHE-GADLILHGHTH------LNSLHWIKNEKKLIPVVGIASASQKVHSNKP 263
           + +     W E G   +LHGH H      LN +  +  +  +  V    SAS ++H N+P
Sbjct: 166 MAKIALEAWAEHGLFAVLHGHLHQPAIYDLNQMFGLGMDHPVYDVHAGTSASNRLHKNEP 225

Query: 264 QASYNL 269
             S+NL
Sbjct: 226 N-SFNL 230


>gi|242398150|ref|YP_002993574.1| Predicted phosphohydrolase [Thermococcus sibiricus MM 739]
 gi|242264543|gb|ACS89225.1| Predicted phosphohydrolase [Thermococcus sibiricus MM 739]
          Length = 504

 Score = 40.4 bits (93), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 110/291 (37%), Gaps = 70/291 (24%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   ++                  K Y      +L+ N+I   + + V
Sbjct: 1   MIKIAHISDTHITSGEAY------------------KGY----AYDLIANEINTLDYNLV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISG--------AKEKSLHA 120
             TGD+ N     E   +++ L+ I  P  + ++PGNHDA   G             ++ 
Sbjct: 39  IHTGDVTNDGLREEYERASYELKKIQKP--LIVLPGNHDARNVGYELFQKYIGPLNGIYE 96

Query: 121 WKDYIT--SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
           WKD +   +D+T                            P  +     G +      KL
Sbjct: 97  WKDLVIIWTDSTI---------------------------PDLNDGRIGGYKFRWLKEKL 129

Query: 179 LRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL 236
              ++KK  F+I+  HH   P+ DT    N +F      +++     +L L GH H+ ++
Sbjct: 130 EEYSHKK--FKIVASHHHLVPLPDTGRERNVLFNAGDVLELLLKHEVNLYLCGHKHVPNI 187

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
           + ++     + V      S +        SYN+  I K N   ++  KR T
Sbjct: 188 YSVEG----LVVANSGCTSCRKTRKGDVNSYNMIKI-KDNGKISVTIKRVT 233


>gi|83942073|ref|ZP_00954535.1| possible phospodiesterase [Sulfitobacter sp. EE-36]
 gi|83847893|gb|EAP85768.1| possible phospodiesterase [Sulfitobacter sp. EE-36]
          Length = 268

 Score = 40.4 bits (93), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 86/202 (42%), Gaps = 20/202 (9%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           ++ L + HF + +    E     +N++   N D V+I+GD        +   + ++++ I
Sbjct: 4   LVHLSDLHFGKDRPDLLEPLLSCVNEL---NPDIVAISGDFTQRARRSQFEEAHNFIQRI 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDY---ITSDTTCSTGKKLFPYLRIRNNIALI 150
             P  +  VPGNHD  +    ++    W+ Y   I +D T              +++ +I
Sbjct: 61  NAP--VLGVPGNHDVLLDRPFQRFFMPWRRYRKWINADLTPRYED---------DDMVVI 109

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
           G ++ +    +          AHA   +   A +K   R++++HHP      +    + G
Sbjct: 110 GINS-VDRFSWQTGKLTAGRIAHACKAMDDTAARKA--RVLVVHHPLEHPNHTKKKPIPG 166

Query: 211 IQRFQKMIWHEGADLILHGHTH 232
            +   + +   GA+LIL GH H
Sbjct: 167 AEIALEKLLSCGANLILSGHLH 188


>gi|329766400|ref|ZP_08257946.1| metallophosphoesterase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329137169|gb|EGG41459.1| metallophosphoesterase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 248

 Score = 40.0 bits (92), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 101/250 (40%), Gaps = 36/250 (14%)

Query: 48  FSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD 107
           F ++  + L++++   N + + +TGD+ N     E       L    +   I+I  GNHD
Sbjct: 15  FLQDKFDQLVDEVNQLNPNVIVVTGDLTNEGLMHEYERCRELLTKFKSKKIITI-SGNHD 73

Query: 108 AYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIR---NNIALIGCSTAIATPPFSAN 164
              +G           Y+         KK FP+  I    +++ L+   TA    P    
Sbjct: 74  YRNTG-----------YLLF-------KKFFPFEAINELSDDVVLVTLGTA---RPDRNE 112

Query: 165 GYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEG 222
           G  G  Q     + ++K   K   +I+ MHH    + DT S    +       + I   G
Sbjct: 113 GEVGYRQNLWLERTMKKYKDK--VKILAMHHHLIAIPDTGSDQLTVVDAGDVLRTILDTG 170

Query: 223 ADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN---EYW 279
            DL+L GH H     W  N  KL+ V    + S++V     + +YN+  I  K+   +  
Sbjct: 171 VDLVLCGHKH---RPWEWNFGKLMVVNAGTATSERVRG-LFENTYNIITISNKSINVDLK 226

Query: 280 TLEGKRYTLS 289
            + GKR  L+
Sbjct: 227 IVGGKRIQLN 236


>gi|85709833|ref|ZP_01040898.1| hypothetical protein NAP1_13148 [Erythrobacter sp. NAP1]
 gi|85688543|gb|EAQ28547.1| hypothetical protein NAP1_13148 [Erythrobacter sp. NAP1]
          Length = 248

 Score = 40.0 bits (92), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 92/248 (37%), Gaps = 17/248 (6%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R+  + + HF  +   + E     I D      D +  TGD+     + E   +  W   
Sbjct: 4   RLFHVSDVHFGVENREALEHVAKAIRD---ERPDALVCTGDVTQRAKHSEYAAAAEWFAG 60

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNN-IALIG 151
           +G P  + + PGNHD       E+    ++ +   D+   +        R  N+ + L+ 
Sbjct: 61  LGVP--VVLEPGNHDMPYYNLLERFSDPYRRFRRLDSEVGS--------RFENDDVVLVS 110

Query: 152 C-STAIATPPFS-ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
             ST  A P F  ++G   +     T   LRK +      I+  HHP +       N   
Sbjct: 111 LKSTVRAQPRFPWSDGIVTKRSLERTLAELRKLSGDPRHVIVTAHHPLLGPKEDAGNPTI 170

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
           G  R    +   GAD I+ GH H       +     + ++G  + S ++    P  SY +
Sbjct: 171 GGDRAFAALASAGADAIMTGHVHRPFDETREMAGASMRMIGAGTLSTRLRHGAP-PSYRV 229

Query: 270 FYIEKKNE 277
               +  E
Sbjct: 230 LNCRRGEE 237


>gi|332158280|ref|YP_004423559.1| lacZ expression regulatory protein [Pyrococcus sp. NA2]
 gi|331033743|gb|AEC51555.1| lacZ expression regulatory protein [Pyrococcus sp. NA2]
          Length = 502

 Score = 40.0 bits (92), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 104/265 (39%), Gaps = 49/265 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            ++AHISD H++   +F                  K Y      +L+ N++     D V 
Sbjct: 1   MLIAHISDTHITNEVAF------------------KSY----AYDLIANEVNTKPFDLVI 38

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+ N     E   +++ LR I  P  + +VPGNHDA   G +      ++ YI   +
Sbjct: 39  HTGDVTNNGLREEYEHASYLLRKIEKP--LVVVPGNHDARNVGYE-----LFEKYIGPLS 91

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                K          +  LI   + I  P  S     G +      KL   ++K+   +
Sbjct: 92  GVYEFK----------DGVLIWIDSTI--PDLSDGRVGGYKFKWLKEKLEEYSHKR--IK 137

Query: 190 IIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           I+  HH   P+ DT    N +F       ++      L + GH H+ +++ +  E  ++ 
Sbjct: 138 IVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLSHEVTLYMCGHKHVPNVYRV--EDLVVD 195

Query: 248 VVGIASASQKVHSNKPQASYNLFYI 272
             G AS  +    +    SYN+  I
Sbjct: 196 NAGCASCRKTRKGD--VNSYNIVKI 218


>gi|326799333|ref|YP_004317152.1| metallophosphoesterase [Sphingobacterium sp. 21]
 gi|326550097|gb|ADZ78482.1| metallophosphoesterase [Sphingobacterium sp. 21]
          Length = 401

 Score = 39.3 bits (90), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 161 FSANGYFGQEQAH-ATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIW 219
            +A   F +E+A    ++L  K+ K+  FR+++MH PP   +   +  M   + F  +  
Sbjct: 269 LAAFDVFREEEARWLEAELQSKSAKEAAFRVVLMHIPP-FHSGDWHGTMHCRKLFSPLFE 327

Query: 220 HEGADLILHGHTHLNSLH 237
             G D+++ GHTH   +H
Sbjct: 328 KYGVDMVISGHTHRYGVH 345


>gi|317049093|ref|YP_004116741.1| metallophosphoesterase [Pantoea sp. At-9b]
 gi|316950710|gb|ADU70185.1| metallophosphoesterase [Pantoea sp. At-9b]
          Length = 276

 Score = 39.3 bits (90), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 57/134 (42%), Gaps = 17/134 (12%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D V ITGD+V+F    E  T    L  +  P+   ++PGNHD            A +D  
Sbjct: 48  DVVVITGDLVDFGLAEEYQTLRQALAELQLPY--LLMPGNHD---------DRQALRDAF 96

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                   G+ L     ++  + L+   +++   P+   GY  + Q     + L++A   
Sbjct: 97  PEHRYLQQGETLHWQQHVK-GVNLLALDSSVPQQPW---GYVDEAQLQWLDEKLKQAPHT 152

Query: 186 GFFRIIMMHHPPVL 199
               ++M+HHPP +
Sbjct: 153 P--ALVMLHHPPFM 164


>gi|317152355|ref|YP_004120403.1| metallophosphoesterase [Desulfovibrio aespoeensis Aspo-2]
 gi|316942606|gb|ADU61657.1| metallophosphoesterase [Desulfovibrio aespoeensis Aspo-2]
          Length = 282

 Score = 38.9 bits (89), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 101/265 (38%), Gaps = 31/265 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHF-NRKKYFSKEVANLLINDILLHNVDHV 68
            ++AHISD+H+            R  G   + F +     S+ VA L        + D V
Sbjct: 1   MLIAHISDLHI------------RPHGEKLYDFVDTNALISRHVATLNSIAKTTDSPDAV 48

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS- 127
            ITGDIVN    +E   +   L  +  P  + I+PGNHD          L A  D     
Sbjct: 49  LITGDIVNCGQKQEYAMARRILGQLTMP--LYIIPGNHD-----NNANLLEALTDICPPL 101

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           +    TG+    Y      +  I   ++I       +G  G+EQ     K L+K    G 
Sbjct: 102 ENVGKTGEHTIRYTIEEFPVRFIMLDSSIGG---ELHGEIGREQMAWLEKELQKGT--GR 156

Query: 188 FRIIMMHHPPVLDTSSLYNRM---FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
              + MHH P+   ++  + +    G    + +  +     ++ GHTH +    +   + 
Sbjct: 157 ETAVCMHHHPLPSGNAHMDAIKCHDGEALIEMLSRYPNVTRLICGHTHRSIFQNVG--RI 214

Query: 245 LIPVVGIASASQKVHSNKPQASYNL 269
           LI  V  A+     HS     SY L
Sbjct: 215 LICTVPGAAHQVPFHSTDLDGSYTL 239


>gi|297530075|ref|YP_003671350.1| 5'-nucleotidase domain protein [Geobacillus sp. C56-T3]
 gi|297253327|gb|ADI26773.1| 5'-Nucleotidase domain protein [Geobacillus sp. C56-T3]
          Length = 540

 Score = 38.9 bits (89), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 9/117 (7%)

Query: 124 YITSDTT-CSTGKKLFP-YLRIRNN---IALIGCS---TAIATPPFSANGYFGQEQAHAT 175
           Y++++     TGK + P Y+  R N   I LIG +   T +   P    G    ++A A 
Sbjct: 163 YVSANVVDAQTGKPILPPYVIKRVNGMPIGLIGVTLTETPMIVTPSGVAGVKFIDEATAI 222

Query: 176 SKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
           +K +R+  KKG   I+++ H P +      N    I    K +  E  D+I  GH H
Sbjct: 223 NKAVRELKKKGVQTIVVLAHNPGVSNPDGTNASGEIVDIAKNVDDE-VDVIFAGHNH 278


>gi|319428450|gb|ADV56524.1| metallophosphoesterase [Shewanella putrefaciens 200]
          Length = 547

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 84/217 (38%), Gaps = 55/217 (25%)

Query: 68  VSITGDIVNFTCNREIFT-STHWLRSIGN-----PHDISIVPGNHDA------------- 108
           ++I+GDI  +   +E F  ++ +++ I +     P D+ I PGNHD              
Sbjct: 251 LAISGDIT-WQSQKEGFNHASKFIKDIISSQSLTPDDLIICPGNHDVGLVTREEYYNNLQ 309

Query: 109 --------------YISGAKEKSLHAWKDYITSD--TTCSTGKK-LFPYLRIRNNIALIG 151
                         Y   +K+  +  +KD    D  +  + G+K L    +I    A+  
Sbjct: 310 TTPSEQDWNTLATEYHETSKKNYVDFYKDIFLRDPESNLAQGRKFLLGGHKIVEFAAMNS 369

Query: 152 CSTAIATPPFSANGYFGQEQAHATS---------KLLRKANKKGFFRIIMMHH--PPVLD 200
           C        F   G+ G+ Q    +         +L+ K N  G  RI+M+HH   PV +
Sbjct: 370 CILQQVKNQFQGIGFIGESQLEQAANGMGWIKGGQLIPKKN--GVTRIVMLHHHLTPVNE 427

Query: 201 TS-----SLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
                  + Y+     +R  + I     D +LHGH H
Sbjct: 428 VEDALLDARYSVTLDAERLMRWIVTHKVDYVLHGHMH 464


>gi|67551230|ref|XP_660080.1| hypothetical protein AN2476.2 [Aspergillus nidulans FGSC A4]
 gi|40744638|gb|EAA63794.1| hypothetical protein AN2476.2 [Aspergillus nidulans FGSC A4]
 gi|259487897|tpe|CBF86933.1| TPA: phosphoric ester hydrolase, putative (AFU_orthologue;
           AFUA_4G03130) [Aspergillus nidulans FGSC A4]
          Length = 365

 Score = 38.9 bits (89), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 15/82 (18%)

Query: 28  ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTST 87
           +  P R++ + + H       + E+A++   D+L+H        GD+ N    +EI  + 
Sbjct: 43  DARPIRVVCISDTH-------TLELADVPDGDLLIH-------AGDLCNDGSAKEIQAAV 88

Query: 88  HWLRSIGNPHDISIVPGNHDAY 109
            WLR + +P  + I  GNHD+Y
Sbjct: 89  DWLRKLPHPQKVVIC-GNHDSY 109


>gi|254412378|ref|ZP_05026152.1| Ser/Thr protein phosphatase family protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196180688|gb|EDX75678.1| Ser/Thr protein phosphatase family protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 1184

 Score = 38.5 bits (88), Expect = 1.2,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 8/82 (9%)

Query: 34  IIGLVNWHF---NRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWL 90
           I+ L + HF   ++   +S ++   L  ++ +  +D + ++GDI N++   E   +  +L
Sbjct: 853 ILHLSDLHFSTPDQATLWSTQLRLDLRRELNISQLDALILSGDIANYSTPEEYEAAAKFL 912

Query: 91  RSIG-----NPHDISIVPGNHD 107
            ++      NP  I+IVPGNHD
Sbjct: 913 NTLCQTFSLNPEQITIVPGNHD 934


>gi|328950407|ref|YP_004367742.1| metallophosphoesterase [Marinithermus hydrothermalis DSM 14884]
 gi|328450731|gb|AEB11632.1| metallophosphoesterase [Marinithermus hydrothermalis DSM 14884]
          Length = 248

 Score = 38.5 bits (88), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 98/267 (36%), Gaps = 50/267 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M +L HISDIH++                        KYF  E+   LI++I     D V
Sbjct: 1   MPLLYHISDIHVA-----------------------SKYFLPELMERLIDEINTVGPDLV 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+ +     E   +  W   I  P  + + PGNHD+   G           YI  +
Sbjct: 38  VLSGDLTDRGLRHEFEEAKAWTDRIQVP--MLVTPGNHDSRNVG-----------YIHFE 84

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                  +L+        +  +    A ++ P    G  G+       + L  A      
Sbjct: 85  -------ELYGPRYATRRLEGVYVVAADSSEPDLDEGRIGRTIYPWLEEALSTAEPSEIK 137

Query: 189 RIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI-KNEKKLI 246
             +  HH  PV       N +       K++     DL+L+GH H+    W+ + E  LI
Sbjct: 138 VFVTHHHLLPVPGAGRERNILQDAGDLLKILVDHKVDLVLNGHKHVP---WVWRFEGMLI 194

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIE 273
              G ++ ++     +P  SY +  I+
Sbjct: 195 VNAGTSTTNRVRGRGRP--SYTVIEID 219


>gi|82617413|emb|CAI64324.1| probable phosphodiesterase [uncultured archaeon]
          Length = 266

 Score = 38.5 bits (88), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 102/253 (40%), Gaps = 32/253 (12%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + H     +F  +VA  ++  +   + D + ITGD+      +E   +  W+  
Sbjct: 3   RIVHLSDLHVC-GAHFLTDVAESVVQGVNKISPDILVITGDLTQNGSCQEYKEAKEWIDR 61

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
               + + IVPGNHD     ++      ++D   + ++C +           + + ++G 
Sbjct: 62  FECRNKV-IVPGNHD-----SRNVGYLLFEDIFGARSSCCS----------LDGVTVVGV 105

Query: 153 STAIATPPFSANGYFGQE-----QAHATSKLLRKANKKGF-FRIIMMHH--PPVLDTSSL 204
            ++        +G+ G+E       +  S L  K+N     FRI  +HH   PV  T   
Sbjct: 106 DSSQHDID---DGHLGREVYGWIAENFNSNLSSKSNLNSTDFRIFALHHHLIPVPMTGRE 162

Query: 205 YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQ 264
                      +++   G D++L GH H   + W+     +  V    + S K+ +   Q
Sbjct: 163 EEIPVDSGDVLELLDRCGVDIVLCGHRH---VPWVWKLNGMFVVNAGTACSNKIKAKTTQ 219

Query: 265 ASYNLFYIEKKNE 277
             YNL  IE   +
Sbjct: 220 C-YNLIEIENDGK 231


>gi|310829969|ref|YP_003962326.1| metallophosphoesterase [Eubacterium limosum KIST612]
 gi|308741703|gb|ADO39363.1| metallophosphoesterase [Eubacterium limosum KIST612]
          Length = 285

 Score = 38.1 bits (87), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 110/278 (39%), Gaps = 36/278 (12%)

Query: 7   TIMFVLAHISDIHL--SYSPSFFELSPKRIIGLVNWHFNRKKYFSKE-VANLLINDILLH 63
           TI F  AH+SD+H+   Y  S F    K ++     H  +K     E +A  L  +    
Sbjct: 3   TITF--AHLSDLHILKDYGNSMF----KDMV----CHMEKKPCEVLEGIAGWLRGNA--G 50

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
            +D V +TGD+V+     E       L    +   +  V GNHD      +  + H   +
Sbjct: 51  KLDFVLLTGDLVHEGGADEYRYLKMLLEEYFDGTPVCPVLGNHD------RVAAFHEGYE 104

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
               DT      +   Y R  + + LI   +++       +G F + Q     K L K  
Sbjct: 105 NREPDT------EPVCYAREFDGLQLIVLDSSVGCDATHHSGRFDEAQFVFLEKALEKKM 158

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQ---RFQKMIWHEGADLILHGHTHLN---SLH 237
            +G   I+  HHP   + +      FG++   R +++I  +    +L GHTH N   + +
Sbjct: 159 PRG--HIVAFHHPAFDEWADERVSAFGVEGSERLKEIISGKNVLALLSGHTHENINTTFY 216

Query: 238 WIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKK 275
            +          G+A   + ++   P A +NL  +  +
Sbjct: 217 GVPAYTAESTAFGVALNEKGMYMT-PAAGFNLCTVTDR 253


>gi|312194409|ref|YP_004014470.1| pentapeptide repeat protein [Frankia sp. EuI1c]
 gi|311225745|gb|ADP78600.1| pentapeptide repeat protein [Frankia sp. EuI1c]
          Length = 2027

 Score = 38.1 bits (87), Expect = 1.7,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 9/97 (9%)

Query: 137 LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP 196
           L+P   +R  +A +  + A++       G  GQ QA   +  L    + G+FR+ + HHP
Sbjct: 383 LYPMADLRLVVAGLNSTMAMSHLQADDRGEVGQAQARWFADRLAGYERAGWFRLAVGHHP 442

Query: 197 PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
           P L    +++         K     G DLIL GH +L
Sbjct: 443 P-LAADRVHS--------AKATDAYGVDLILGGHVNL 470


>gi|85375401|ref|YP_459463.1| hypothetical protein ELI_12870 [Erythrobacter litoralis HTCC2594]
 gi|84788484|gb|ABC64666.1| hypothetical protein ELI_12870 [Erythrobacter litoralis HTCC2594]
          Length = 284

 Score = 38.1 bits (87), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 88/225 (39%), Gaps = 24/225 (10%)

Query: 47  YFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNH 106
           +  +E+A L          D V+ITGD+     +RE   +T W+R +G P  + +  GNH
Sbjct: 24  WVQQEIAEL--------RPDAVAITGDLTMRARHREFDAATKWIRGLGVPVTVEV--GNH 73

Query: 107 DAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGY 166
           D       E+    ++ +            L        +IA++   TA+   P   N  
Sbjct: 74  DMPYFNPIERFFDPYRRFRGMQDLVEKEIDL-------PDIAIVPLKTAVRAQP-RLNWS 125

Query: 167 FGQEQAHATSKLLRKAN--KKGFFRIIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGA 223
            G     A  K L   +    G   ++ +HHP   + T        G +  +++     A
Sbjct: 126 KGWVTQTALDKCLAAVDALPPGTQALVAVHHPLREVGTEGTALTRNGTKALRELATRPVA 185

Query: 224 DLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYN 268
             ++ GH H       + ++  + ++G  + S++  S  P  S+N
Sbjct: 186 -AVISGHVHDAFDIVEQTDRGPVRMIGAGTLSKRTRSTPP--SFN 227


>gi|149185235|ref|ZP_01863552.1| hypothetical protein ED21_19317 [Erythrobacter sp. SD-21]
 gi|148831346|gb|EDL49780.1| hypothetical protein ED21_19317 [Erythrobacter sp. SD-21]
          Length = 286

 Score = 38.1 bits (87), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 52/242 (21%), Positives = 95/242 (39%), Gaps = 23/242 (9%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +RI  L + HF  +   +    + +  +I     D V+ITGD+     +RE   +THW+ 
Sbjct: 6   RRIFHLSDIHFGLE---NNRALDWVKQEISEKRPDAVAITGDLTMRARHREFEAATHWIN 62

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           S+  P  + +  GNHD       E+    +K +   +        L         +A++ 
Sbjct: 63  SLEAPVTVEV--GNHDMPYFNPIERFFAPYKRFRGMEEKVEKEIDL-------GCLAIVP 113

Query: 152 CSTAI-ATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP----PVLDTSSLYN 206
             TA+ A P  + +  +  + A A       A  +G   ++ +HHP        T+   N
Sbjct: 114 LKTAVRAQPRLNWSKGWVTDDALAKCLAAIDALPEGTRAVVAVHHPLREVGTQGTALTKN 173

Query: 207 RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQAS 266
               +    K       + +L GH H         E+  + ++G  + S++  S  P  S
Sbjct: 174 GDKALLALAK----RPVEAVLSGHVHDAFDIMESTEEGPVRMIGAGTLSKRTRSTPP--S 227

Query: 267 YN 268
           +N
Sbjct: 228 FN 229


>gi|326572601|gb|EGE22590.1| nuclease SbcCD subunit D [Moraxella catarrhalis CO72]
 gi|326574197|gb|EGE24145.1| nuclease SbcCD subunit D [Moraxella catarrhalis 101P30B1]
          Length = 477

 Score = 38.1 bits (87), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 55/116 (47%), Gaps = 17/116 (14%)

Query: 19  HLSYSPSFFELSPK-----RIIGLVNWH-----FNRKKY--FSKEVANLLINDILLHNVD 66
           HL++        PK     R++   +WH     +N+ +Y  F+K   + LI  ++LH VD
Sbjct: 24  HLTHQSPIVPALPKPKDSLRLLHTSDWHLGKLLYNQSRYDEFAK-FLDWLIEALILHQVD 82

Query: 67  HVSITGDIVNFTC--NREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSL 118
            + I GDI +     NR  +   H+L S    H   I IV GNHD+  S  K K +
Sbjct: 83  ILIIAGDIFDTMTPSNRAEYLYHHFLASAFKNHIQHIIIVAGNHDSPTSLQKTKEV 138


>gi|326574982|gb|EGE24911.1| nuclease SbcCD subunit D [Moraxella catarrhalis O35E]
          Length = 477

 Score = 38.1 bits (87), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 55/116 (47%), Gaps = 17/116 (14%)

Query: 19  HLSYSPSFFELSPK-----RIIGLVNWH-----FNRKKY--FSKEVANLLINDILLHNVD 66
           HL++        PK     R++   +WH     +N+ +Y  F+K   + LI  ++LH VD
Sbjct: 24  HLTHQSPIVPALPKPKDSLRLLHTSDWHLGKLLYNQSRYDEFAK-FLDWLIEALILHQVD 82

Query: 67  HVSITGDIVNFTC--NREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSL 118
            + I GDI +     NR  +   H+L S    H   I IV GNHD+  S  K K +
Sbjct: 83  ILIIAGDIFDTMTPSNRAEYLYHHFLASAFKNHIQHIIIVAGNHDSPTSLQKTKEV 138


>gi|326562701|gb|EGE13003.1| nuclease SbcCD subunit D [Moraxella catarrhalis 103P14B1]
          Length = 216

 Score = 37.7 bits (86), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 56/116 (48%), Gaps = 17/116 (14%)

Query: 19  HLSYSPSFFELSPK-----RIIGLVNWH-----FNRKKY--FSKEVANLLINDILLHNVD 66
           HL++        PK     R++   +WH     +N+ +Y  F+K + + LI  ++LH VD
Sbjct: 24  HLTHQSPIVPALPKPKDSLRLLHTSDWHLGKLLYNQSRYDEFAKFL-DWLIEALILHQVD 82

Query: 67  HVSITGDIVNFTC--NREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSL 118
            + I GDI +     NR  +   H+L S    H   I IV GNHD+  S  K K +
Sbjct: 83  ILIIAGDIFDTMTPSNRAEYLYHHFLASAFKNHIQHIIIVAGNHDSPTSLQKTKEV 138


>gi|206901247|ref|YP_002251371.1| membrane-associated protein, putative [Dictyoglomus thermophilum
           H-6-12]
 gi|206740350|gb|ACI19408.1| membrane-associated protein, putative [Dictyoglomus thermophilum
           H-6-12]
          Length = 252

 Score = 37.7 bits (86), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 58/140 (41%), Gaps = 25/140 (17%)

Query: 57  INDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEK 116
           +++IL    D +   GDI+     +E       LR++  P    IVPGNHD Y       
Sbjct: 45  LSEILKRKPDFIIQLGDILVEGTEKEYKYIGELLRNVNIP--FYIVPGNHDLY------- 95

Query: 117 SLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATS 176
                KD         TG+ L+ Y    N   +I  +++         G  G+ Q    +
Sbjct: 96  -----KDPRGEKFQKFTGRPLYYYFDYENARFIILNNSS---------GILGKTQLEWLT 141

Query: 177 KLLRKANKKGFFRIIMMHHP 196
            +L++ +KK  ++ + MH P
Sbjct: 142 NVLKENDKK--YKFVFMHQP 159


>gi|326568732|gb|EGE18802.1| nuclease SbcCD subunit D [Moraxella catarrhalis BC8]
          Length = 477

 Score = 37.7 bits (86), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 55/116 (47%), Gaps = 17/116 (14%)

Query: 19  HLSYSPSFFELSPK-----RIIGLVNWH-----FNRKKY--FSKEVANLLINDILLHNVD 66
           HL++        PK     R++   +WH     +N+ +Y  F+K   + LI  ++LH VD
Sbjct: 24  HLTHQSPIVPALPKPKDSLRLLHTSDWHLGKLLYNQSRYDEFAK-FLDWLIEALILHQVD 82

Query: 67  HVSITGDIVNFTC--NREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSL 118
            + I GDI +     NR  +   H+L S    H   I IV GNHD+  S  K K +
Sbjct: 83  ILIIAGDIFDTMTPSNRAEYLYHHFLASAFKNHIQHIIIVAGNHDSPTSLQKTKEV 138


>gi|296113560|ref|YP_003627498.1| nuclease SbcCD subunit D [Moraxella catarrhalis RH4]
 gi|295921254|gb|ADG61605.1| nuclease SbcCD subunit D [Moraxella catarrhalis RH4]
 gi|326559562|gb|EGE09976.1| nuclease SbcCD subunit D [Moraxella catarrhalis 7169]
 gi|326564663|gb|EGE14881.1| nuclease SbcCD subunit D [Moraxella catarrhalis 46P47B1]
 gi|326565478|gb|EGE15649.1| nuclease SbcCD subunit D [Moraxella catarrhalis 12P80B1]
 gi|326567756|gb|EGE17862.1| nuclease SbcCD subunit D [Moraxella catarrhalis BC1]
 gi|326568607|gb|EGE18678.1| nuclease SbcCD subunit D [Moraxella catarrhalis BC7]
          Length = 477

 Score = 37.7 bits (86), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 55/116 (47%), Gaps = 17/116 (14%)

Query: 19  HLSYSPSFFELSPK-----RIIGLVNWH-----FNRKKY--FSKEVANLLINDILLHNVD 66
           HL++        PK     R++   +WH     +N+ +Y  F+K   + LI  ++LH VD
Sbjct: 24  HLTHQSPIVPALPKPKDSLRLLHTSDWHLGKLLYNQSRYDEFAK-FLDWLIEALILHQVD 82

Query: 67  HVSITGDIVNFTC--NREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSL 118
            + I GDI +     NR  +   H+L S    H   I IV GNHD+  S  K K +
Sbjct: 83  ILIIAGDIFDTMTPSNRAEYLYHHFLASAFKNHIQHIIIVAGNHDSPTSLQKTKEV 138


>gi|308272514|emb|CBX29118.1| hypothetical protein N47_J00990 [uncultured Desulfobacterium sp.]
          Length = 319

 Score = 37.7 bits (86), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 80/218 (36%), Gaps = 52/218 (23%)

Query: 28  ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNF-TCNREIFTS 86
           ELS   I+ L + H +  K  SK     ++   L    D + ITGD+++   C  + F  
Sbjct: 89  ELSGFTIVQLSDLHADLSK--SKRQFENIVAQTLALKPDLIVITGDLIDTDICRLDDFCK 146

Query: 87  THWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNN 146
              LR +   + +  V GNH+ Y                       TG  LF  +   ++
Sbjct: 147 I--LRGLKAKYGVYAVTGNHEFY-----------------------TGIPLFMKIAANSD 181

Query: 147 IALIGCSTAIATPPFSANGYFGQEQAH-----ATSKLLRKANKKGFFR---IIMMHHPPV 198
           I ++  +  +        G    + A      +  + L  A KK  FR   I++ H P V
Sbjct: 182 IKVLRNTNVLIAGAIELAGIDDAQTAKRFENISLQESLSSAFKKIDFRNTVILLSHQPDV 241

Query: 199 LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL 236
            D SS                  GADL L GHTH   L
Sbjct: 242 FDLSS----------------DMGADLQLSGHTHAGQL 263


>gi|29347546|ref|NP_811049.1| putative purple acid phosphatase [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29339446|gb|AAO77243.1| putative purple acid phosphatase [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 452

 Score = 37.7 bits (86), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 80/187 (42%), Gaps = 16/187 (8%)

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           SI     I + PGNH+ Y+ G   + L     Y+ S    S  K         NN+  I 
Sbjct: 202 SIAPTKPILVSPGNHE-YVKGLV-RVLEKRFAYVFSYLLESRYKN--------NNVYSID 251

Query: 152 CSTA-IATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
            + A I T   + + +F   Q     K L+ + KK  ++I+M+HHP V       N +  
Sbjct: 252 YNDATIITLDSNRDPWFLFSQREWLEKTLKASKKK--WKIVMLHHP-VYSIKGKTNNLAV 308

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI--PVVGIASASQKVHSNKPQASYN 268
              F  +    G DL+L GH H  +    KN++  +  P+  ++ AS K +       Y+
Sbjct: 309 RWMFDGLFREYGVDLVLQGHEHNYARMTNKNDEGEMTTPLYLVSHASPKSYRLSFNDKYD 368

Query: 269 LFYIEKK 275
            F  +++
Sbjct: 369 RFGTDRR 375


>gi|242240671|ref|YP_002988852.1| metallophosphoesterase [Dickeya dadantii Ech703]
 gi|242132728|gb|ACS87030.1| metallophosphoesterase [Dickeya dadantii Ech703]
          Length = 274

 Score = 37.7 bits (86), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 44/98 (44%), Gaps = 16/98 (16%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            +LAHISD H       F  S +++ G ++ +       S+  A       L    D V 
Sbjct: 1   MLLAHISDTH-------FRSSGQKLYGFIDINAGNADVVSQLNA-------LSEQPDAVV 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD 107
           I+GDIVN     E   +   L ++  P  + I+PGNHD
Sbjct: 47  ISGDIVNCGQPAEYLVARQTLGNLKYP--LYIIPGNHD 82


>gi|83953123|ref|ZP_00961845.1| possible phospodiesterase [Sulfitobacter sp. NAS-14.1]
 gi|83842091|gb|EAP81259.1| possible phospodiesterase [Sulfitobacter sp. NAS-14.1]
          Length = 268

 Score = 37.7 bits (86), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 81/202 (40%), Gaps = 20/202 (9%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           ++ L + HF + +    E     +N++   N D V+I+GD        +   + ++++ I
Sbjct: 4   LVHLSDLHFGKDRPDLLEPLLSCVNEL---NPDIVAISGDFTQRARRSQFEEAHNFIQRI 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDY---ITSDTTCSTGKKLFPYLRIRNNIALI 150
             P  +  VPGNHD  +    ++    W+ Y   I +D T          + I N++   
Sbjct: 61  NAP--VLGVPGNHDVLLDRPFQRFFMPWRRYRKWINADLTPRYEDDDMVVIGI-NSVDRF 117

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
              T   T      G   Q          RKA      R++++HHP      +    + G
Sbjct: 118 SWQTGKLTA-----GRIAQACKAIDDTAARKA------RVLVVHHPLEHPNHTNKKPIPG 166

Query: 211 IQRFQKMIWHEGADLILHGHTH 232
            +   + +   GA+LIL GH H
Sbjct: 167 AEIALEKLLSCGANLILSGHLH 188


>gi|119487409|ref|XP_001262497.1| phosphoric ester hydrolase, putative [Neosartorya fischeri NRRL
           181]
 gi|119410654|gb|EAW20600.1| phosphoric ester hydrolase, putative [Neosartorya fischeri NRRL
           181]
          Length = 364

 Score = 37.4 bits (85), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 18/106 (16%)

Query: 6   TTIMFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           T +++ L HI  + L   P     +  P R++ + + H       + E  ++   D+L+H
Sbjct: 20  TALLYPLHHIL-LRLRGPPRLPSPDAHPIRVVCISDTH-------TLEWDDVPDGDLLIH 71

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAY 109
                   GD+ N    REI  + +WL+++ +PH + I  GNHD+Y
Sbjct: 72  -------AGDLCNDGSIREIQAAVNWLQTLPHPHKVVIC-GNHDSY 109


>gi|269127362|ref|YP_003300732.1| metallophosphoesterase [Thermomonospora curvata DSM 43183]
 gi|268312320|gb|ACY98694.1| metallophosphoesterase [Thermomonospora curvata DSM 43183]
          Length = 1831

 Score = 37.4 bits (85), Expect = 2.7,   Method: Composition-based stats.
 Identities = 37/153 (24%), Positives = 69/153 (45%), Gaps = 3/153 (1%)

Query: 137 LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP 196
           L+    +R  +A +  + A +       GY G+EQ    +  LR+  ++G+ RI +MHH 
Sbjct: 159 LYEMPELRTVVAALNSTMAESHREEDHYGYCGEEQLQWFADRLRRFKEEGWLRIGVMHHN 218

Query: 197 PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQ 256
           P +   +    +    RF +++     +L+LHGHTH  +L  +  +   +PV+   SA  
Sbjct: 219 PEISDETDEAFLRDRDRFTELL-APSLNLLLHGHTHQAALCSLGPDG--LPVLCAGSAGV 275

Query: 257 KVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
           +  +   +       I     +  + G+RY  S
Sbjct: 276 RPQARPAEVPNQYQLIRITAGHLEVYGRRYNPS 308


>gi|315504560|ref|YP_004083447.1| metallophosphoesterase [Micromonospora sp. L5]
 gi|315411179|gb|ADU09296.1| metallophosphoesterase [Micromonospora sp. L5]
          Length = 562

 Score = 37.4 bits (85), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 87/232 (37%), Gaps = 40/232 (17%)

Query: 39  NWHFNRKKYFSKEVANLLINDILLHN---VDHVSITGDIV------NFTCNRE-IFTSTH 88
            W    +   ++      I+D L  +   V  V +TGD+        F   R  +F  T+
Sbjct: 237 QWRLETEDGATRPTMVDAISDALARDQRPVGAVLVTGDLTYVAHRDEFAAARAGLFKLTN 296

Query: 89  WLRSIGNPHDISIVPGNHD-AYISGAK------------------EKSLHAWKDYITSDT 129
            L  +G  H + ++PGNHD A+  G                     +   A   Y  S  
Sbjct: 297 GLLGLGMEH-LVVIPGNHDIAWTRGDSYEYGAPVEVAPAAATANYREFFRALYGYPASPH 355

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAH-ATSKLLRKANKKGFF 188
                + +FP   +  +IA +  S+      F A     QE A+   +  L  +N     
Sbjct: 356 LSMARRFIFPGGNL-VDIAAVNSSSLEQGQSFLAGMGRVQESAYREVTSALAWSNPGSAL 414

Query: 189 RIIMMHH----PPVLDTSSLYNRMFGIQ----RFQKMIWHEGADLILHGHTH 232
           R++ +HH       L++   Y   FGI     R Q++   +G  L +HGH H
Sbjct: 415 RVLALHHHLALTEDLESPDEYATGFGIAIDAPRIQRLAARDGVHLAVHGHKH 466


>gi|254485594|ref|ZP_05098799.1| 3',5'-cyclic-nucleotide phosphodiesterase [Roseobacter sp. GAI101]
 gi|214042463|gb|EEB83101.1| 3',5'-cyclic-nucleotide phosphodiesterase [Roseobacter sp. GAI101]
          Length = 265

 Score = 37.4 bits (85), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 81/202 (40%), Gaps = 20/202 (9%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           +I L + HF + +    ++   L+  + +   D V I+GD+       +   +  +++ I
Sbjct: 4   LIHLSDLHFGKDR---PDLLEPLVERVNVLAPDLVVISGDLTQRAREEQFKEARDFIKKI 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAW---KDYITSDTTCSTGKKLFPYLRIRNNIALI 150
            N   +S VPGNHD  +     +    W   K YI  D T           R  N+  ++
Sbjct: 61  -NARVLS-VPGNHDVSLHRPFRRFFWPWRSYKKYIDQDLTP----------RFENDEMIV 108

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
               ++    +       +   HA   +    + K   RI+++HHP      +    + G
Sbjct: 109 VGINSVDRFSWQTGRLTAERINHACDAMDHAPDGKT--RILVVHHPLEHPAETEKKPIPG 166

Query: 211 IQRFQKMIWHEGADLILHGHTH 232
            +   + +   GA+LIL GH H
Sbjct: 167 AEEALERLLSCGANLILSGHLH 188


>gi|255933710|ref|XP_002558234.1| Pc12g14290 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211582853|emb|CAP81056.1| Pc12g14290 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 449

 Score = 37.4 bits (85), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 15/79 (18%)

Query: 31  PKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWL 90
           P R++ + + H       + E  ++   D+L+H        GD+ N    R+I  +  WL
Sbjct: 46  PIRVVCISDTH-------TLEWPDVPDGDLLIH-------AGDLCNDGSARDIQAAVDWL 91

Query: 91  RSIGNPHDISIVPGNHDAY 109
           RS+ +P+ ++I  GNHD+Y
Sbjct: 92  RSLPHPYKVAIG-GNHDSY 109


>gi|302868970|ref|YP_003837607.1| metallophosphoesterase [Micromonospora aurantiaca ATCC 27029]
 gi|302571829|gb|ADL48031.1| metallophosphoesterase [Micromonospora aurantiaca ATCC 27029]
          Length = 562

 Score = 37.4 bits (85), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 87/232 (37%), Gaps = 40/232 (17%)

Query: 39  NWHFNRKKYFSKEVANLLINDILLHN---VDHVSITGDIV------NFTCNRE-IFTSTH 88
            W    +   ++      I+D L  +   V  V +TGD+        F   R  +F  T+
Sbjct: 237 QWRLETEDGATRPTMVDAISDALARDQRSVGAVLVTGDLTYVAHRDEFAAARAGLFKLTN 296

Query: 89  WLRSIGNPHDISIVPGNHD-AYISGAK------------------EKSLHAWKDYITSDT 129
            L  +G  H + ++PGNHD A+  G                     +   A   Y  S  
Sbjct: 297 GLLGLGMEH-LVVIPGNHDIAWTRGDSYEYGAPVEVAPAAATANYREFFRALYGYPASPH 355

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAH-ATSKLLRKANKKGFF 188
                + +FP   +  +IA +  S+      F A     QE A+   +  L  +N     
Sbjct: 356 LSMARRFIFPGGNL-VDIAAVNSSSLEQGQSFLAGMGRVQESAYREVTSALAWSNPGSAL 414

Query: 189 RIIMMHH----PPVLDTSSLYNRMFGIQ----RFQKMIWHEGADLILHGHTH 232
           R++ +HH       L++   Y   FGI     R Q++   +G  L +HGH H
Sbjct: 415 RVLALHHHLALTEDLESPDEYATGFGIAIDAPRIQRLAARDGVHLAVHGHKH 466


>gi|167756626|ref|ZP_02428753.1| hypothetical protein CLORAM_02163 [Clostridium ramosum DSM 1402]
 gi|237733915|ref|ZP_04564396.1| phosphohydrolase [Mollicutes bacterium D7]
 gi|167702801|gb|EDS17380.1| hypothetical protein CLORAM_02163 [Clostridium ramosum DSM 1402]
 gi|229382996|gb|EEO33087.1| phosphohydrolase [Coprobacillus sp. D7]
          Length = 487

 Score = 37.4 bits (85), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 58/124 (46%), Gaps = 23/124 (18%)

Query: 2   TKRYTTIMFVLAHISDIHLSY-SP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLIN 58
           T+    ++F + H +   + Y SP  SFF       + L + H   KK   K +  L + 
Sbjct: 176 TQDIEEVIFKIEHDTIFSIRYLSPYDSFF-------VQLSDLHLGSKK---KNIGRLALE 225

Query: 59  DILLHNVDHVS--------ITGDIVNFTCNREIFTSTHWLRSIGNPH--DISIVPGNHDA 108
           D L   V  +         ITGD++N    + ++ ++ +++ + N +  D+S + GNHD 
Sbjct: 226 DSLDQTVKQLRSYYPLKFLITGDLMNSPNRKNMYEASGFMKGLKNRYNADVSFILGNHDV 285

Query: 109 YISG 112
            ++G
Sbjct: 286 IVNG 289


>gi|20090538|ref|NP_616613.1| 3',5'-cyclic-nucleotide phosphodiesterase [Methanosarcina
           acetivorans C2A]
 gi|19915566|gb|AAM05093.1| 3',5'-cyclic-nucleotide phosphodiesterase [Methanosarcina
           acetivorans C2A]
          Length = 244

 Score = 37.4 bits (85), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 103/256 (40%), Gaps = 31/256 (12%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           +I+ L + HF+ + YF  E+A  ++  I   + D V ITGD+     + E      ++  
Sbjct: 2   QIVHLSDIHFS-EAYFVPEIAESMLQKINQLDPDIVVITGDLTENGFSAEYDGVKEFIDK 60

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           I    D  +VPGNHD+  +G     LH ++D           +  FP  R   N+ ++G 
Sbjct: 61  I-ECKDKVLVPGNHDSKNAGY----LH-FEDLF---------ENRFPT-RNLGNVTVVG- 103

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFG 210
             A ++ P    G+ G+E      +     N    F++  +HH   P+         +  
Sbjct: 104 --ADSSQPDLDEGHLGRENYGWIKEAFSGEN----FKVFALHHHLVPIPLAGRENTVLVD 157

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                 ++     +L+L GH H+  + W  N   ++      S+  +    K    +NL 
Sbjct: 158 AGDVLDLLNRCKVNLVLCGHCHIPHV-WNLNNMLVVNAGTFCSSKTR---GKTTQCFNLI 213

Query: 271 YIEK-KNEYWTLEGKR 285
             E  +N  W +   R
Sbjct: 214 QAENGENNNWNVRVSR 229


>gi|83643366|ref|YP_431801.1| phosphohydrolase [Hahella chejuensis KCTC 2396]
 gi|83631409|gb|ABC27376.1| predicted phosphohydrolase [Hahella chejuensis KCTC 2396]
          Length = 795

 Score = 37.4 bits (85), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 77/191 (40%), Gaps = 45/191 (23%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH------------VSITGDIVNFTCN 80
           RII L +   +R +Y +K + N++    L H  D             ++I+GD+V    N
Sbjct: 145 RIIALSDTQLDRDEY-AKVLTNVVNQGFLQHECDAAQPQTCAENIAAITISGDVVQVGGN 203

Query: 81  REIFTSTHW-------LRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCST 133
           R+     HW       L +I     +  VPGNHD Y     +  L  ++ Y+      S 
Sbjct: 204 RQ-----HWREQLFGSLAAITPYVPLVTVPGNHDYY----SDAELRLYRSYMAPPENGSI 254

Query: 134 GKK----LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQE----QAHATSKLLRKANKK 185
           G +       YL +R    L+G  +   +    A+G F ++    Q     + L  A  +
Sbjct: 255 GYEDKWYYLDYLDLR----LVGLDSYSIS---GAHGAFNRDTLAVQRQWLKETLNDAEVQ 307

Query: 186 G-FFRIIMMHH 195
           G  F + M HH
Sbjct: 308 GKHFVLGMFHH 318


>gi|108763357|ref|YP_633039.1| metallophosphoesterase [Myxococcus xanthus DK 1622]
 gi|108467237|gb|ABF92422.1| metallophosphoesterase [Myxococcus xanthus DK 1622]
          Length = 234

 Score = 37.4 bits (85), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 41/90 (45%), Gaps = 12/90 (13%)

Query: 189 RIIMMHHPPVLDTSSLYN---RMF-GIQRFQKMIWHEGADLILHGHTHLNSLHWIKN--E 242
           ++++MH+ PV DT    N   R F G  R    I H GA+ + HGH H    H  +N   
Sbjct: 151 KVVIMHYAPVPDTLEGENIEIRPFLGTSRLSMPIDHYGAEAVFHGHAH----HGARNGKT 206

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYI 272
           K  IPV  +A      H+  P   Y L  +
Sbjct: 207 KSGIPVYNVAMPLLAKHT--PDQRYVLLEV 234


>gi|330752000|emb|CBL80513.1| periplasmic serine protease [uncultured Polaribacter sp.]
          Length = 462

 Score = 37.0 bits (84), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 18/131 (13%)

Query: 43  NRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFT----CNREIFTSTHWLRSIGNPHD 98
           N+KKY +  V N   NDI L  ++  +      NF      N +      W+ ++GNP++
Sbjct: 139 NKKKYKAVLVGNDAANDIALLKIESNT------NFPYVPFANSDNIKIGEWVLAVGNPYN 192

Query: 99  ISIVPGNHDAYISGAKEKSLHAWKD---YITSDTTCSTGKKLFPYLRIRNNIALIGCSTA 155
           ++       A I  AK + L   ++   +I +D   + G      +  R    LIG +TA
Sbjct: 193 LT---STVTAGIVSAKGRDLEGNRNIESFIQTDAAVNPGNSGGALVNGRGE--LIGINTA 247

Query: 156 IATPPFSANGY 166
           I+T   S  GY
Sbjct: 248 ISTKTGSFIGY 258


>gi|189499586|ref|YP_001959056.1| metallophosphoesterase [Chlorobium phaeobacteroides BS1]
 gi|189495027|gb|ACE03575.1| metallophosphoesterase [Chlorobium phaeobacteroides BS1]
          Length = 286

 Score = 37.0 bits (84), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 115/269 (42%), Gaps = 63/269 (23%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           MT++Y      LAH SD+HL+        + +R +G ++           E+   ++N+ 
Sbjct: 1   MTEKYLK----LAHFSDLHLAGR------TARRQLGYLD-----------ELLTAIVNN- 38

Query: 61  LLHNVDHVSITGDIVNFT--CNREIFTSTHWLRSIGNPHDISIVPGNHD----------- 107
                 H+ ITGD+VN     + ++       + +     ++++PGNHD           
Sbjct: 39  ---GCSHIVITGDLVNSANPADWQVVKDALQKKGLYAWDKVTLIPGNHDLINLEEEIRLY 95

Query: 108 ----AYISGAKEKSLHAWKDYITSDTTCSTGKKL---FPYLRIRN----NIALIGCSTAI 156
                  +G K++     +++    +   TG++    FP++++       ++L+  +T  
Sbjct: 96  NSLNPLGNGRKKRFRRKMREFCRFFSELMTGEEQDTGFPFIKVLKYSDVTLSLVLVNTVS 155

Query: 157 ----ATPPFSANGYF--GQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
                  P  A GY   G+ +A ATS+ ++ A K  F   +  H   +  T SL ++ F 
Sbjct: 156 HWMNIENPLGARGYVSPGEFKALATSQ-VQNAIKDSFVIGVFHHAYNIYGTDSLIDQAFD 214

Query: 211 -----IQRFQKMIWHE--GADLILHGHTH 232
                  R + ++  +   AD++LHGH H
Sbjct: 215 WTMELRNRRELLVAMKKLNADMLLHGHFH 243


>gi|298383760|ref|ZP_06993321.1| purple acid phosphatase [Bacteroides sp. 1_1_14]
 gi|298263364|gb|EFI06227.1| purple acid phosphatase [Bacteroides sp. 1_1_14]
          Length = 452

 Score = 37.0 bits (84), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 79/187 (42%), Gaps = 16/187 (8%)

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           SI     I + PGNH+ Y+ G   + L     Y+ S    S  K         NN+  I 
Sbjct: 202 SIAPTKPILVSPGNHE-YVKGLV-RVLEKRFAYVFSYLLESRYKN--------NNVYSID 251

Query: 152 CSTA-IATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
            + A I T   + + +F   Q     K L+ + KK  ++I+M+HHP V       N +  
Sbjct: 252 YNDATIITLDSNRDPWFLFSQREWLEKTLKASKKK--WKIVMLHHP-VYSIKGKTNNLAV 308

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI--PVVGIASASQKVHSNKPQASYN 268
              F  +    G DL+L GH H  +    KN++  +  P+  ++ AS K +       Y+
Sbjct: 309 RWMFDGLFREYGVDLVLQGHEHNYARMTNKNDEGEMTTPLYLVSHASPKSYRLSFNDEYD 368

Query: 269 LFYIEKK 275
            F   ++
Sbjct: 369 RFGTNRR 375


>gi|289164482|ref|YP_003454620.1| Acid sphingomyelinase-like phosphodiesterase [Legionella
           longbeachae NSW150]
 gi|288857655|emb|CBJ11498.1| putative Acid sphingomyelinase-like phosphodiesterase [Legionella
           longbeachae NSW150]
          Length = 382

 Score = 37.0 bits (84), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 78/157 (49%), Gaps = 18/157 (11%)

Query: 156 IATPPFSANGYFGQEQAHATSKLLR--KANKKGFFRIIMMHHPPVLDTSSLYNRMFG--I 211
           ++ P FS +    +E+     K +R  KAN +    ++ MH PP  +  S+Y   F   I
Sbjct: 176 VSRPNFSPSRDGAKEELQWLEKEIRTSKANHENI--LLAMHVPPQ-NWESIYKESFIKII 232

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK--LIPVVGIASASQKVHSNKPQASYNL 269
           + + ++I       ++  HTH + LH IK+E K  +IP++  AS     H N   +S+ +
Sbjct: 233 KTYPEIILG-----MVAAHTHFDELHAIKSENKNFVIPIIYSASIGSD-HGNA--SSFKI 284

Query: 270 FYIEKKNEYWTLEGKRY-TLSPDSLSIQKDYSDIFYD 305
             + +KN+  + + K Y T +    + +K   +++YD
Sbjct: 285 LNLSRKNDTASWQLKNYVTYNFIGSTAEKSQLNLYYD 321


>gi|325983364|ref|YP_004295766.1| metallophosphoesterase [Nitrosomonas sp. AL212]
 gi|325532883|gb|ADZ27604.1| metallophosphoesterase [Nitrosomonas sp. AL212]
          Length = 280

 Score = 36.6 bits (83), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 87/200 (43%), Gaps = 26/200 (13%)

Query: 41  HFNRKKYFSKEVANLLINDILLHNV--DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHD 98
           HF  ++    EV + L  + L+H++  + V ++GDI       +   +  ++  +G P  
Sbjct: 9   HFGTER---PEVVSAL--EALIHSMPPELVVLSGDITQRARRSQFQAARSFVDRLGAPAT 63

Query: 99  ISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIAT 158
           + ++PGNHD  +     ++L+ + ++  S      G +L P   + ++  L+        
Sbjct: 64  L-VIPGNHDIPLFNLISRALNPYANHCRS-----FGAELEP---VYDSPTLLVIGVNTTR 114

Query: 159 PPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMFGIQRFQKM 217
                +G     Q    ++ L  A+ +   RI++ H P  V     + N + G     K 
Sbjct: 115 RWRHVDGEVSAYQRQRVAQRLSHASAEQL-RIVVTHQPVAVTREEDVTNLLHG----HKA 169

Query: 218 IWHE----GADLILHGHTHL 233
             HE    GAD+IL GH HL
Sbjct: 170 AVHEWSSAGADIILGGHIHL 189


>gi|169775997|ref|XP_001822465.1| phosphoric ester hydrolase [Aspergillus oryzae RIB40]
 gi|238502673|ref|XP_002382570.1| phosphoric ester hydrolase, putative [Aspergillus flavus NRRL3357]
 gi|83771200|dbj|BAE61332.1| unnamed protein product [Aspergillus oryzae]
 gi|220691380|gb|EED47728.1| phosphoric ester hydrolase, putative [Aspergillus flavus NRRL3357]
          Length = 358

 Score = 36.6 bits (83), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 51  EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAY 109
           E  ++   D+L+H        GD+ N    REI  +  WL+ + +PH + I  GNHD+Y
Sbjct: 59  EWDDVPDGDLLIH-------AGDLCNDGSVREIQAAVDWLQGLPHPHKVVIC-GNHDSY 109


>gi|268319468|ref|YP_003293124.1| hypothetical protein FI9785_990 [Lactobacillus johnsonii FI9785]
 gi|262397843|emb|CAX66857.1| hypothetical protein predicted by Glimmer/Critica [Lactobacillus
           johnsonii FI9785]
          Length = 410

 Score = 36.6 bits (83), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 55/254 (21%), Positives = 101/254 (39%), Gaps = 39/254 (15%)

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHD---ISIVPGNHDAYISGAKE----KSLHA 120
           + +TGD V F   R    S      I  P +   + ++PGNHD Y   A+E    K  +A
Sbjct: 64  IIVTGD-VTFNGER---VSAEKFAEIFKPLEETQLLVLPGNHDIYDGWAREFRGKKQYYA 119

Query: 121 -------WKDYITS---------DTTCSTGKKLFP-YLRIRNNIALIGCSTAIATPPFSA 163
                  W++   +         D + +   +L P YL I  +    G   A   P  + 
Sbjct: 120 GQISPRMWRNIFKTSYKNAVSVDDKSLAYSVQLNPNYLLILADSNDYGKEEATTAP--AT 177

Query: 164 NGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI---QRFQKMIWH 220
            G+ G+EQ       L+ A++     I  MHH   +   ++ N+ + +   +  +K++  
Sbjct: 178 AGFLGREQRRWIKAQLQYASENNLQVIFCMHHNLYVHNPAV-NKGYVVDDYRELRKLLAQ 236

Query: 221 EGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQK-----VHSNKPQASYNLFYIEKK 275
               L+  GH H  ++   ++      VV  +  S       V  +  + SY  ++ + K
Sbjct: 237 YNVKLVFSGHIHAQNIMLPQDPCPATEVVTASFCSNDQGYGVVKVSPKEVSYTCYHFKMK 296

Query: 276 NEYWTLEGKRYTLS 289
           +     E + +TL+
Sbjct: 297 DYLTDKEKQNWTLT 310


>gi|167378356|ref|XP_001734770.1| hypothetical protein [Entamoeba dispar SAW760]
 gi|165903571|gb|EDR29061.1| hypothetical protein, conserved [Entamoeba dispar SAW760]
          Length = 262

 Score = 36.6 bits (83), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 44/224 (19%), Positives = 83/224 (37%), Gaps = 28/224 (12%)

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIG--NPHDISIVPGNHDAYISGAKEKSLHAWKD- 123
           ++ ++GD+    C+ +   +  W       N     I+ GNHD +     E+ +  W   
Sbjct: 32  YLVVSGDL----CDHDSLNNVQWFFDWCSINYEQTYILYGNHDCFGITNLEQLMSGWNKS 87

Query: 124 ------YITSDTTCSTGKKLF-----PYLRIRNNIALIGCSTAIATPPFSANGYFGQEQA 172
                 Y+ +        +LF       L I +   L+  +       ++ +     E  
Sbjct: 88  VRSNVHYVNNSNILINSTELFFTTLWSELDINDKQYLLNNAVDFDKIKYNNSTSLSFELY 147

Query: 173 HATSKLLRK------ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLI 226
           +    + R        N +  ++I+  HH P    S   + +F + R       +G +L 
Sbjct: 148 NYVHTVCRNWLKEKIQNSRAQYKIVFSHHCPTTSLSKKKDSLFSLFRSNDEDLMKGVNLW 207

Query: 227 LHGHTHLN-SLHWIKNEKKLIPVVGIASASQKVHSN-KPQASYN 268
           ++GHTH N S  W   E+ L+         +K H+   PQ + N
Sbjct: 208 VYGHTHFNISPKWF--EETLLVSNQFGHFKEKDHTGWNPQQTTN 249


>gi|34540177|ref|NP_904656.1| purple acid phosphatase [Porphyromonas gingivalis W83]
 gi|34396489|gb|AAQ65555.1| purple acid phosphatase [Porphyromonas gingivalis W83]
          Length = 489

 Score = 36.2 bits (82), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQR--FQKMIWHEGADLILHGHTHLNSLHWIKNEK-- 243
           ++++M HH      S    RM  I R  F+ ++   GADL+L GH H  S    K E   
Sbjct: 322 WKVVMFHHGVY---SVRQGRMNPIIRYGFRSILEEGGADLVLQGHDHAYSRITTKTESGT 378

Query: 244 KLIPVVGIASASQKVHSN 261
           K  PV  I+SAS K + N
Sbjct: 379 KTTPVYIISSASPKHYRN 396


>gi|312195989|ref|YP_004016050.1| metallophosphoesterase [Frankia sp. EuI1c]
 gi|311227325|gb|ADP80180.1| metallophosphoesterase [Frankia sp. EuI1c]
          Length = 266

 Score = 36.2 bits (82), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 81/200 (40%), Gaps = 24/200 (12%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI  + + HF R    +  +A  L+ D+   +   V++ GD+     + E   +  +L  
Sbjct: 4   RIAQISDLHFGRT---AAAIAENLLADLRDLDATLVAVCGDLTQRAKDTEFQAARAFLGR 60

Query: 93  IGNPHDISIVPGNHDA---YISGAKEKSLHAWKDYI---TSDTTCSTGKKLFPYLRIRNN 146
           +  P    +VPGNHD     I     +  H W+       +D T  +G          + 
Sbjct: 61  L--PAPALVVPGNHDLPVWPIWTRIARPWHPWRRQFGANPADVTTHSG----------DG 108

Query: 147 IALIGCSTAIATPPFS--ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSL 204
           +  +G +TA  +      + G     Q  A  ++  + + +G  R+++ HHP +L+  + 
Sbjct: 109 LTAVGLNTARRSSLHVDWSRGRVNDRQVAAALRVFEE-SPRGDLRVLVAHHPFLLEPRAG 167

Query: 205 YNRMFGIQRFQKMIWHEGAD 224
            + + G         H+ AD
Sbjct: 168 GHGLVGRSDLALRQLHQRAD 187


>gi|188995481|ref|YP_001929733.1| probable metallophosphoesterase [Porphyromonas gingivalis ATCC
           33277]
 gi|188595161|dbj|BAG34136.1| probable metallophosphoesterase [Porphyromonas gingivalis ATCC
           33277]
          Length = 489

 Score = 36.2 bits (82), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 7/78 (8%)

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQR--FQKMIWHEGADLILHGHTHLNSLHWIKNEK-- 243
           ++++M HH      S    RM  I R  F+ ++   GADL+L GH H  S    K E   
Sbjct: 322 WKVVMFHHGVY---SVRQGRMNPIIRYGFRSILEEGGADLVLQGHDHAYSRITTKTESGT 378

Query: 244 KLIPVVGIASASQKVHSN 261
           K  PV  I+SAS K + N
Sbjct: 379 KTTPVYIISSASPKHYRN 396


>gi|73668764|ref|YP_304779.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina barkeri
           str. Fusaro]
 gi|72395926|gb|AAZ70199.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina barkeri
           str. Fusaro]
          Length = 230

 Score = 36.2 bits (82), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 94/240 (39%), Gaps = 32/240 (13%)

Query: 51  EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI 110
           E+AN ++ +I   + D + ITGD+       E   +  ++  I   + + IVPGNHD+  
Sbjct: 3   EIANSMLENINRSSPDIIVITGDLTENGLAAEYNGAKKFIDRIECKNKV-IVPGNHDSRN 61

Query: 111 SGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQE 170
           +G     L     + T  T+   G+           I ++G  +   + P    G+ G+E
Sbjct: 62  AGY----LFFEDLFKTRSTSGQFGE-----------ITVVGLDS---SQPELDEGHIGRE 103

Query: 171 QAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILH 228
             +              F++  +HH   P+  T    N +       +++   G +L+L 
Sbjct: 104 NYNWIENTFSVNG----FKVFALHHHLIPIPRTGRGNNVLVDAGDVLELLDRSGVNLVLC 159

Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYI---EKKNEYWTLEGKR 285
           GH H   + W+     ++ +      S KV     Q  YN   +   E   + W L+  R
Sbjct: 160 GHWH---IPWVWRLNDMLVISAGTVCSSKVRGKMSQC-YNFIEVDAPESDCKRWHLQVCR 215


>gi|217978481|ref|YP_002362628.1| metallophosphoesterase [Methylocella silvestris BL2]
 gi|217503857|gb|ACK51266.1| metallophosphoesterase [Methylocella silvestris BL2]
          Length = 278

 Score = 36.2 bits (82), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 70/174 (40%), Gaps = 22/174 (12%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEK---SLHAWK 122
           D   ++GD+     ++E   +  WL S+  P  ++  PGNHD  +    ++       ++
Sbjct: 39  DLTIVSGDLTAEGRSQEFSAARDWLASLPQPQIVT--PGNHDTPVWNLPQRLFWPFGRYR 96

Query: 123 DYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFS-ANGYFGQEQAHATSKLLRK 181
            Y+             P L +R+     G       P F  + G    +     +K +  
Sbjct: 97  AYVGQPAAAG----FLPGLTVRSLNTARGVQ-----PRFDWSKGSIDLDAVRQAAKEMTV 147

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQR---FQKMIWHEGADLILHGHTH 232
           A K    ++ + HHP V  T++  +   G+ R     +++  +  DLIL GH H
Sbjct: 148 ATKA--LKVFVCHHPLVEMTNAAVSG--GVHRGLAAARLLAEQNIDLILSGHVH 197


>gi|154249978|ref|YP_001410803.1| metallophosphoesterase [Fervidobacterium nodosum Rt17-B1]
 gi|154153914|gb|ABS61146.1| metallophosphoesterase [Fervidobacterium nodosum Rt17-B1]
          Length = 606

 Score = 36.2 bits (82), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 69/172 (40%), Gaps = 30/172 (17%)

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSI--GNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
           +V + GD+       E F     + S+   N  + +I+ GNHD             W D 
Sbjct: 59  YVFMLGDLTEMGKEEE-FDDLSKILSVFSNNGINYNILLGNHDT-----------RWSDK 106

Query: 125 ITSDTTCSTGKKLFPYLRIR-NNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +    T +    L+   R+    I+ IG  T++    F   G+ G++Q       L    
Sbjct: 107 VRK--TKNIDNALYENFRVDIGEISFIGIDTSMY---FQHLGHIGEKQLEWIKTQLEDCK 161

Query: 184 KKGFFRIIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
           K+G   I++ HHP   P+  T   +  M  I+ +          +IL+GHTH
Sbjct: 162 KQGKLAILLSHHPFGGPINYTDDGWKLMDIIKNYN-------VPIILYGHTH 206


>gi|329960913|ref|ZP_08299192.1| Ser/Thr phosphatase family protein [Bacteroides fluxus YIT 12057]
 gi|328532199|gb|EGF59003.1| Ser/Thr phosphatase family protein [Bacteroides fluxus YIT 12057]
          Length = 388

 Score = 36.2 bits (82), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 83/206 (40%), Gaps = 33/206 (16%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + H    +  + E   LL+  +   N D +  TGD+VN   + EI      L  
Sbjct: 152 RIVQLSDIHIGSWQG-NPEAIKLLVEMVNAQNPDLIVFTGDLVN-QQSHEIDGFQDILSQ 209

Query: 93  IGNPHDISIVPGNHD--AYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRI----RNN 146
           +  P  +  + GNHD   Y      K+  A  DY+         K L     I     ++
Sbjct: 210 LHAPDGVYSILGNHDYGTYYRWKSRKAEIANLDYLIRQQKAMGWKLLNNEHDILYHKGDS 269

Query: 147 IALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYN 206
           IALIG       PPFS       + +HA          +G F+I++ H+P      + + 
Sbjct: 270 IALIGVEND-GEPPFSQFA----DLSHAME------GTEGMFQILLSHNP------THWR 312

Query: 207 RMFGIQRFQKMIWHEGADLILHGHTH 232
           R        +++   G  L+L GHTH
Sbjct: 313 R--------EVLPASGIPLMLAGHTH 330


>gi|253570888|ref|ZP_04848296.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|251839837|gb|EES67920.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 452

 Score = 36.2 bits (82), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 79/187 (42%), Gaps = 16/187 (8%)

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           SI     + + PGNH+ Y+ G   + L     Y+ S    S  K         NN+  I 
Sbjct: 202 SIAPTKPVLVSPGNHE-YVKGLV-RVLEKRFAYVFSYLLESRYKN--------NNVYSID 251

Query: 152 CSTA-IATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
            + A I T   + + +F   Q     K L+ + KK  ++I+M+HHP V       N +  
Sbjct: 252 YNDATIITLDSNRDPWFLFSQREWLEKTLKASKKK--WKIVMLHHP-VYSIKGKTNNLAV 308

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI--PVVGIASASQKVHSNKPQASYN 268
              F  +    G DL+L GH H  +    KN++  +  P+  ++ AS K +       Y+
Sbjct: 309 RWMFDGLFREYGVDLVLQGHEHNYARMTNKNDEGEMTTPLYLVSHASPKSYRLSFNDKYD 368

Query: 269 LFYIEKK 275
            F   ++
Sbjct: 369 RFGTNRR 375


>gi|332654065|ref|ZP_08419809.1| phosphoesterase [Ruminococcaceae bacterium D16]
 gi|332517151|gb|EGJ46756.1| phosphoesterase [Ruminococcaceae bacterium D16]
          Length = 196

 Score = 35.8 bits (81), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 162 SANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPP--VLDTSSLYNRMFGIQRFQKMIW 219
             N Y  +E      +LL +  +K  F I++ H P   ++D   L +   G + F K++ 
Sbjct: 97  GVNQYTEKEMNRRVWRLLPRIMRKRGFDILLTHAPGKGMVDCHDLCHT--GFETFNKLLD 154

Query: 220 HEGADLILHGHTHLNSLHWIKNEKK 244
                L LHGHTHLN    I  E +
Sbjct: 155 KYQPALFLHGHTHLNYGRNIPRESR 179


>gi|121714633|ref|XP_001274927.1| phosphoric ester hydrolase, putative [Aspergillus clavatus NRRL 1]
 gi|119403081|gb|EAW13501.1| phosphoric ester hydrolase, putative [Aspergillus clavatus NRRL 1]
          Length = 365

 Score = 35.8 bits (81), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 8/59 (13%)

Query: 51  EVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAY 109
           E +++   D+L+H        GD+ N    REI  +  WL+ + +PH + I  GNHD+Y
Sbjct: 59  EWSDVPDGDLLIH-------AGDLSNDGSIREIQAAVDWLQKLPHPHKVVIC-GNHDSY 109


>gi|226308498|ref|YP_002768458.1| hypothetical protein RER_50110 [Rhodococcus erythropolis PR4]
 gi|226187615|dbj|BAH35719.1| conserved hypothetical membrane protein [Rhodococcus erythropolis
           PR4]
          Length = 394

 Score = 35.8 bits (81), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 80/203 (39%), Gaps = 38/203 (18%)

Query: 33  RIIGLVNWHF---NRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHW 89
           R++ + + HF   NR+K+  + +A   +ND+   + D V+  GDI + T  + +  +T  
Sbjct: 168 RVVAITDTHFGPINREKWSERVIAA--VNDL---DADIVAHVGDIADGTVEQRLGQATP- 221

Query: 90  LRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIAL 149
           L S+        V GNH+ Y   A+E     W DY+TS    +   +     +  + + +
Sbjct: 222 LASVEAGLARVYVTGNHE-YFHEAQE-----WLDYMTSIGWDALHNRHLVVTKGGDRLVI 275

Query: 150 IGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
            G   A A           +   H  +  +  A       I+M+ H P   T S      
Sbjct: 276 AGVDDATA--------LGSKLDGHGANFDMALAGSDPELPILMLAHQPKQVTQSA----- 322

Query: 210 GIQRFQKMIWHEGADLILHGHTH 232
                       G DL L GHTH
Sbjct: 323 ----------SAGVDLQLAGHTH 335


>gi|262371999|ref|ZP_06065278.1| phosphohydrolase [Acinetobacter junii SH205]
 gi|262312024|gb|EEY93109.1| phosphohydrolase [Acinetobacter junii SH205]
          Length = 256

 Score = 35.8 bits (81), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 61/150 (40%), Gaps = 15/150 (10%)

Query: 49  SKEVANLLINDIL-LHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD 107
            +EV    I D   LH  + V ++GD+      ++ F    +L S+  P+   +VPGNHD
Sbjct: 13  EREVCIQAIRDFCELHRPEAVIVSGDLTQRARLKQFFDCRQFLDSLDLPY--LVVPGNHD 70

Query: 108 AYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYF 167
             +        H W  + +                  +N  ++G ++      +   G+ 
Sbjct: 71  IPL-------FHVWNRFFSPFVRYQAFFGRLETTLETSNFYIVGVNS--IRRRYHTRGHV 121

Query: 168 GQEQAHATSKLLRKA-NKKGFFRIIMMHHP 196
             EQ H  ++ LR A N K   ++++ H P
Sbjct: 122 SLEQIHEVAEKLRNAPNNKT--KLVVFHQP 149


>gi|70981941|ref|XP_746499.1| phosphoric ester hydrolase [Aspergillus fumigatus Af293]
 gi|66844122|gb|EAL84461.1| phosphoric ester hydrolase, putative [Aspergillus fumigatus Af293]
 gi|159122276|gb|EDP47398.1| phosphoric ester hydrolase, putative [Aspergillus fumigatus A1163]
          Length = 364

 Score = 35.4 bits (80), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 8/52 (15%)

Query: 58  NDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAY 109
            D+L+H        GD+ N    REI  +  WL+ + +PH + I  GNHD+Y
Sbjct: 66  GDLLIH-------AGDLCNDGSIREIQAAVDWLQRLPHPHKVVIC-GNHDSY 109


>gi|217968044|ref|YP_002353550.1| metallophosphoesterase [Dictyoglomus turgidum DSM 6724]
 gi|217337143|gb|ACK42936.1| metallophosphoesterase [Dictyoglomus turgidum DSM 6724]
          Length = 252

 Score = 35.4 bits (80), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 48/226 (21%), Positives = 94/226 (41%), Gaps = 34/226 (15%)

Query: 57  INDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEK 116
           +++++    D +   GDI+  + + E       L+++  P    IVPGNHD Y       
Sbjct: 45  LSEVVKRKPDFIVQLGDILVESSDEEYRYVGSILKNVSVP--FYIVPGNHDLY------- 95

Query: 117 SLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATS 176
                KD   +     T + L+ Y    N   +I           +A+G  G+ Q     
Sbjct: 96  -----KDPKGARFQSFTKRPLYYYFDYENARFIILN---------NASGSLGKVQLEWLI 141

Query: 177 KLLRKANKKGFFRIIMMHHPPVLDTS--SLYNRMFGIQR--FQKMIWHEGADLILHGHTH 232
           ++L+  NKK  ++ + MH  PV+  S   L+++   ++     K+      + +  GH H
Sbjct: 142 EVLKGTNKK--YKFVFMHQ-PVISPSWFFLFHKADPVESKILMKLFEEYHVNYVFSGHIH 198

Query: 233 LNSLHWIKNEKKLIPVV-GIASASQKVHSNKPQASYNLFYIEKKNE 277
              +++ K    ++ ++ GI  A   + SN  +   +   I+  +E
Sbjct: 199 ---MYYRKEINGVVYIISGIGGARPYISSNLDEGKPHFILIKVSDE 241


Searching..................................................done


Results from round 2




>gi|255764495|ref|YP_003065022.2| putative phosphoesterase protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254547846|gb|ACT57082.2| putative phosphoesterase protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 309

 Score =  443 bits (1139), Expect = e-122,   Method: Composition-based stats.
 Identities = 309/309 (100%), Positives = 309/309 (100%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI
Sbjct: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60

Query: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
           LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA
Sbjct: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
           WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR
Sbjct: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
           KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK
Sbjct: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
           NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS
Sbjct: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300

Query: 301 DIFYDTLVL 309
           DIFYDTLVL
Sbjct: 301 DIFYDTLVL 309


>gi|240850132|ref|YP_002971525.1| hypothetical protein Bgr_05230 [Bartonella grahamii as4aup]
 gi|240267255|gb|ACS50843.1| hypothetical protein Bgr_05230 [Bartonella grahamii as4aup]
          Length = 296

 Score =  391 bits (1005), Expect = e-107,   Method: Composition-based stats.
 Identities = 126/282 (44%), Positives = 179/282 (63%), Gaps = 3/282 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS FELS KR+ G +NW   RK      V   LI+ +     D
Sbjct: 1   MFYLAHISDVHLSPLPQPSLFELSGKRLTGYLNWQRKRKSQMVTNVLETLIDALNKKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN   ++E   +  WL ++G P DIS+  GNHDAY+ GA +K+   +K +IT
Sbjct: 61  HLVISGDLVNLALDKEFEQAHRWLLNLGQPQDISLTFGNHDAYVRGAFQKACTLFKPWIT 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D    +   LFPY+RIR N+A+I  S+AIATPPF A+GYFG+ QA      L++A ++ 
Sbjct: 121 GDVPQKSAF-LFPYMRIRKNVAIIATSSAIATPPFQASGYFGKMQAQTLPLFLKEAAQRN 179

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP    +S + ++  I+RF  +I + G +LILHGHTHL +L++I+   K I
Sbjct: 180 LFRVVMIHHPPFPKATSWHKKLRDIKRFLDVIKYHGCELILHGHTHLPTLNYIEGPIKKI 239

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG+ SASQ     KP A +NLF IE+    W  + +RY++
Sbjct: 240 PIVGVPSASQAFGDKKPPAGFNLFSIERLQNQWHCQLQRYSI 281


>gi|153008931|ref|YP_001370146.1| metallophosphoesterase [Ochrobactrum anthropi ATCC 49188]
 gi|151560819|gb|ABS14317.1| metallophosphoesterase [Ochrobactrum anthropi ATCC 49188]
          Length = 303

 Score =  388 bits (996), Expect = e-106,   Method: Composition-based stats.
 Identities = 129/303 (42%), Positives = 185/303 (61%), Gaps = 4/303 (1%)

Query: 6   TTIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
             +MF LAHISDIHLS  P   + EL+ KRI G +NW  NRK      V + LI+D+   
Sbjct: 1   MGLMFRLAHISDIHLSPLPRVRYRELASKRITGYINWLRNRKNAMHGTVLDTLIDDMQAQ 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+++TGD+VN   N EI  +  WL  +G+P D+S+VPGNHDAY+ GA +KS   W+ 
Sbjct: 61  TPDHIAVTGDLVNLALNLEIDIAHDWLSKLGSPDDVSVVPGNHDAYVPGALDKSCRKWEP 120

Query: 124 YITSDT-TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
           ++  D       +  FPY+R+R  +ALIG S+A AT PF A+G F  EQ    + +L +A
Sbjct: 121 WMRGDGIDNKDNRPQFPYMRVRGPVALIGVSSARATAPFMASGDFRSEQGKRLAAMLDEA 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +G FRI+M+HHPP+   +  + R++GI+RFQK+I   GA+L+LHGHTHL + + I   
Sbjct: 181 GARGLFRIVMIHHPPIYGATPAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGP 240

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY-WTLEGKRYTLSPDSLSIQKDYSD 301
              IPV+ + SASQ    +KP A YN+F I+K+ +  W+   + + +S  S  I K    
Sbjct: 241 NGKIPVISVPSASQNFGGHKPAARYNIFNIDKRPDGSWSCLMEEHGVSDASEKITKLNER 300

Query: 302 IFY 304
           + Y
Sbjct: 301 VLY 303


>gi|49475919|ref|YP_033960.1| hypothetical protein BH11990 [Bartonella henselae str. Houston-1]
 gi|49238727|emb|CAF27982.1| hypothetical protein BH11990 [Bartonella henselae str. Houston-1]
          Length = 300

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 131/284 (46%), Positives = 185/284 (65%), Gaps = 3/284 (1%)

Query: 7   TIMFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           T MF LAHISD+HLS  P  SFFEL  KR+ G +NW   RK   +      LI  +   N
Sbjct: 3   TPMFCLAHISDMHLSPLPKPSFFELFGKRLTGYLNWQKKRKGQMATNTLETLIEALKKKN 62

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+ I+GD+VN   ++E   + +WL + G P +IS+  GNHDAY+ GA +K+   ++ +
Sbjct: 63  PDHLVISGDLVNLALDKEFEQARNWLLNQGQPQNISLTFGNHDAYVRGAFQKACTLFQPW 122

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
           IT D         FPY+RIR N+A+IG S+AIATPPF A+GYFG+ QA A S+LL +A +
Sbjct: 123 ITGDFPQKNAPP-FPYIRIRKNVAIIGASSAIATPPFQASGYFGKMQAQALSQLLNEAAR 181

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +  FR+IM+HHPP    +S + +++GI+RF ++I H G +LILHGHTHL +L+ IK +  
Sbjct: 182 RNLFRVIMIHHPPFHHATSWHKKLWGIERFLEVIKHHGCELILHGHTHLPTLNIIKGKMG 241

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
            IP+VG+ASA+Q      P A +N F IE+ N+ W  + +RY+L
Sbjct: 242 KIPIVGVASAAQAFGDTPPPAGFNFFSIEQFNQQWHCQLQRYSL 285


>gi|49474499|ref|YP_032541.1| hypothetical protein BQ09400 [Bartonella quintana str. Toulouse]
 gi|49240003|emb|CAF26417.1| hypothetical protein BQ09400 [Bartonella quintana str. Toulouse]
          Length = 300

 Score =  385 bits (988), Expect = e-105,   Method: Composition-based stats.
 Identities = 125/284 (44%), Positives = 179/284 (63%), Gaps = 3/284 (1%)

Query: 7   TIMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           T MF LAHISD+HLS    PS  EL  KR  G +NW   RK   +      LI+ +    
Sbjct: 3   TPMFYLAHISDVHLSPLPQPSLVELLGKRFTGYLNWQKKRKNQMATNALETLIDTLKKKK 62

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+ I+GD++N   ++E   + +WL + G P +IS+  GNHDAY+ GA +K+   ++ +
Sbjct: 63  PDHLVISGDLINLALDKEFEQARNWLLNQGQPQNISLTFGNHDAYVRGAFQKACTLFQPW 122

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
           IT D         FPY+RIR N+A+IG S+AIATPPF A+GYFG+ QA   ++LL +   
Sbjct: 123 ITGDFPQKNALP-FPYMRIRKNVAIIGASSAIATPPFQASGYFGKMQAQTLAQLLNETAA 181

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +  FR+IM+HHPP    +S + +++GI+RF K+I H G DL+LHGHTHL +L+ ++    
Sbjct: 182 RNLFRVIMIHHPPFHHATSWHKKLWGIERFLKVIKHHGCDLVLHGHTHLPTLNIVEGTMG 241

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
            IP+VG+ASASQ    N P A +NLF IE+ +  W  + +RY+L
Sbjct: 242 KIPIVGVASASQAFGDNPPPAGFNLFSIERFHHQWHCQLQRYSL 285


>gi|306844563|ref|ZP_07477152.1| phosphohydrolase, Icc family protein [Brucella sp. BO1]
 gi|306275174|gb|EFM56930.1| phosphohydrolase, Icc family protein [Brucella sp. BO1]
          Length = 303

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 129/303 (42%), Positives = 185/303 (61%), Gaps = 4/303 (1%)

Query: 6   TTIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
            ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L  
Sbjct: 1   MSVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADLLAQ 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ 
Sbjct: 61  TPDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEP 120

Query: 124 YITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
           ++  D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A
Sbjct: 121 WMRGDGVDNKGKRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEA 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I   
Sbjct: 181 GARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGP 240

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSD 301
              +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    
Sbjct: 241 DGKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACTMEEHGISDASEKITKLNER 300

Query: 302 IFY 304
           + Y
Sbjct: 301 VLY 303


>gi|148559695|ref|YP_001259438.1| hypothetical protein BOV_1512 [Brucella ovis ATCC 25840]
 gi|148370952|gb|ABQ60931.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 303

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 128/303 (42%), Positives = 185/303 (61%), Gaps = 4/303 (1%)

Query: 6   TTIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
            ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L  
Sbjct: 1   MSVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQ 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ 
Sbjct: 61  TPDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEP 120

Query: 124 YITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
           ++  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A
Sbjct: 121 WMRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEA 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I   
Sbjct: 181 GARGLFRVVMIHHPPVYGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGP 240

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSD 301
              +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    
Sbjct: 241 DGKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNER 300

Query: 302 IFY 304
           + Y
Sbjct: 301 VLY 303


>gi|15966127|ref|NP_386480.1| hypothetical protein SMc02712 [Sinorhizobium meliloti 1021]
 gi|307305682|ref|ZP_07585429.1| metallophosphoesterase [Sinorhizobium meliloti BL225C]
 gi|307317685|ref|ZP_07597124.1| metallophosphoesterase [Sinorhizobium meliloti AK83]
 gi|15075397|emb|CAC46953.1| Hypothetical protein SMc02712 [Sinorhizobium meliloti 1021]
 gi|306896843|gb|EFN27590.1| metallophosphoesterase [Sinorhizobium meliloti AK83]
 gi|306902385|gb|EFN32981.1| metallophosphoesterase [Sinorhizobium meliloti BL225C]
          Length = 300

 Score =  381 bits (980), Expect = e-104,   Method: Composition-based stats.
 Identities = 150/300 (50%), Positives = 199/300 (66%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL+ KRI G VNWH NR ++      + L+ DI + N D
Sbjct: 1   MFKLAHISDVHLGPLPDLSLRELASKRITGFVNWHRNRVRHLFPGTLDCLMKDIEVRNPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN   + EI   T WL   G+P++IS+VPGNHDAY+ GA EK  HAW  ++ 
Sbjct: 61  HLAITGDLVNLASSLEIEAVTEWLAEAGDPNEISVVPGNHDAYVPGAYEKITHAWYPFMR 120

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   S   K    FPY+R+R  +ALIGCSTA+ATPPF+A+GYFG  QA AT  LLR+A 
Sbjct: 121 GDDGPSGWMKKHACFPYMRVRGKVALIGCSTAVATPPFAASGYFGPRQARATVNLLRQAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FRI+M+HHPP+   +S++ RM GI+RF   I   GA+L+LHGHTHLN+LHW+K   
Sbjct: 181 EAGLFRIVMIHHPPIRGATSMHKRMIGIRRFAATISAGGAELVLHGHTHLNTLHWLKGHT 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +PVVGIASASQ    +KP A+YNLF ++ +   W L  +RY ++PD+  +    +  F
Sbjct: 241 GPVPVVGIASASQGPGGSKPVAAYNLFSVDGEPGDWRLTRERYAINPDATGVVLAETTYF 300


>gi|239832447|ref|ZP_04680776.1| metallophosphoesterase [Ochrobactrum intermedium LMG 3301]
 gi|239824714|gb|EEQ96282.1| metallophosphoesterase [Ochrobactrum intermedium LMG 3301]
          Length = 300

 Score =  381 bits (979), Expect = e-104,   Method: Composition-based stats.
 Identities = 130/300 (43%), Positives = 187/300 (62%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISDIHLS  P   + EL+ KRI G +NW  NRK      V + LI D+   + D
Sbjct: 1   MFRLAHISDIHLSPLPRVRYRELASKRITGYINWLRNRKNAMHGTVLDSLIADMQAQSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL  +GNP+D+S+VPGNHDAY+ GA +KS   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLTRLGNPNDVSVVPGNHDAYVPGALDKSCRKWEPWMR 120

Query: 127 SDTTCSTG-KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   ++G +  FPY+R+R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGIDNSGNRPQFPYMRVRGPVALIGVSSARATAPFMASGDFRSAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FRI+M+HHPP+   +  + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRIVMIHHPPIHGATPAHKRLYGIRRFQKIIRKHGAELVLHGHTHLVTHYEIDGPNGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PVV + SASQ    +KP A YN+F I+++ E  W+   + + +S  S  I K    + Y
Sbjct: 241 VPVVSVPSASQNFGGHKPAARYNIFGIDRRPEGGWSCLMEEHGVSDASEKITKLNERVLY 300


>gi|265984605|ref|ZP_06097340.1| metallophosphoesterase [Brucella sp. 83/13]
 gi|306837914|ref|ZP_07470774.1| phosphohydrolase, Icc family protein [Brucella sp. NF 2653]
 gi|264663197|gb|EEZ33458.1| metallophosphoesterase [Brucella sp. 83/13]
 gi|306407002|gb|EFM63221.1| phosphohydrolase, Icc family protein [Brucella sp. NF 2653]
          Length = 303

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 129/303 (42%), Positives = 185/303 (61%), Gaps = 4/303 (1%)

Query: 6   TTIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
            ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L  
Sbjct: 1   MSVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQ 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ 
Sbjct: 61  TPDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEP 120

Query: 124 YITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
           ++  D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A
Sbjct: 121 WMRGDGVDNKGKRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEA 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I   
Sbjct: 181 GARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGP 240

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSD 301
              +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    
Sbjct: 241 DGKVPVISVPSASQSFGGRKPAARYNIFNIDRNADGGWACIMEEHGISDASEKITKLNER 300

Query: 302 IFY 304
           + Y
Sbjct: 301 VLY 303


>gi|17986735|ref|NP_539369.1| Icc family phosphohydrolase [Brucella melitensis bv. 1 str. 16M]
 gi|189024678|ref|YP_001935446.1| phosphohydrolase, Icc family [Brucella abortus S19]
 gi|225628004|ref|ZP_03786040.1| Icc family phosphohydrolase [Brucella ceti str. Cudo]
 gi|237815956|ref|ZP_04594953.1| Icc family phosphohydrolase [Brucella abortus str. 2308 A]
 gi|256255496|ref|ZP_05461032.1| putative phosphohydrolase, Icc family protein [Brucella ceti B1/94]
 gi|260546983|ref|ZP_05822722.1| metallophosphoesterase [Brucella abortus NCTC 8038]
 gi|260565215|ref|ZP_05835699.1| metallophosphoesterase [Brucella melitensis bv. 1 str. 16M]
 gi|260755281|ref|ZP_05867629.1| metallophosphoesterase [Brucella abortus bv. 6 str. 870]
 gi|260758502|ref|ZP_05870850.1| metallophosphoesterase [Brucella abortus bv. 4 str. 292]
 gi|260762326|ref|ZP_05874669.1| metallophosphoesterase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884296|ref|ZP_05895910.1| metallophosphoesterase [Brucella abortus bv. 9 str. C68]
 gi|261214545|ref|ZP_05928826.1| metallophosphoesterase [Brucella abortus bv. 3 str. Tulya]
 gi|261219690|ref|ZP_05933971.1| metallophosphoesterase [Brucella ceti M13/05/1]
 gi|261222702|ref|ZP_05936983.1| metallophosphoesterase [Brucella ceti B1/94]
 gi|261318172|ref|ZP_05957369.1| metallophosphoesterase [Brucella pinnipedialis B2/94]
 gi|261322579|ref|ZP_05961776.1| metallophosphoesterase [Brucella ceti M644/93/1]
 gi|261325623|ref|ZP_05964820.1| metallophosphoesterase [Brucella neotomae 5K33]
 gi|261758741|ref|ZP_06002450.1| metallophosphoesterase [Brucella sp. F5/99]
 gi|265989203|ref|ZP_06101760.1| metallophosphoesterase [Brucella pinnipedialis M292/94/1]
 gi|265991617|ref|ZP_06104174.1| metallophosphoesterase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995455|ref|ZP_06108012.1| metallophosphoesterase [Brucella melitensis bv. 3 str. Ether]
 gi|265998666|ref|ZP_06111223.1| metallophosphoesterase [Brucella ceti M490/95/1]
 gi|265999369|ref|ZP_05466008.2| metallophosphoesterase [Brucella melitensis bv. 2 str. 63/9]
 gi|297248833|ref|ZP_06932551.1| icc family phosphohydrolase [Brucella abortus bv. 5 str. B3196]
 gi|17982361|gb|AAL51633.1| putative phosphohydrolases, icc family [Brucella melitensis bv. 1
           str. 16M]
 gi|189020250|gb|ACD72972.1| putative phosphohydrolase, Icc family [Brucella abortus S19]
 gi|225617167|gb|EEH14213.1| Icc family phosphohydrolase [Brucella ceti str. Cudo]
 gi|237789254|gb|EEP63465.1| Icc family phosphohydrolase [Brucella abortus str. 2308 A]
 gi|260096033|gb|EEW79910.1| metallophosphoesterase [Brucella abortus NCTC 8038]
 gi|260151283|gb|EEW86377.1| metallophosphoesterase [Brucella melitensis bv. 1 str. 16M]
 gi|260668820|gb|EEX55760.1| metallophosphoesterase [Brucella abortus bv. 4 str. 292]
 gi|260672758|gb|EEX59579.1| metallophosphoesterase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675389|gb|EEX62210.1| metallophosphoesterase [Brucella abortus bv. 6 str. 870]
 gi|260873824|gb|EEX80893.1| metallophosphoesterase [Brucella abortus bv. 9 str. C68]
 gi|260916152|gb|EEX83013.1| metallophosphoesterase [Brucella abortus bv. 3 str. Tulya]
 gi|260921286|gb|EEX87939.1| metallophosphoesterase [Brucella ceti B1/94]
 gi|260924779|gb|EEX91347.1| metallophosphoesterase [Brucella ceti M13/05/1]
 gi|261295269|gb|EEX98765.1| metallophosphoesterase [Brucella ceti M644/93/1]
 gi|261297395|gb|EEY00892.1| metallophosphoesterase [Brucella pinnipedialis B2/94]
 gi|261301603|gb|EEY05100.1| metallophosphoesterase [Brucella neotomae 5K33]
 gi|261738725|gb|EEY26721.1| metallophosphoesterase [Brucella sp. F5/99]
 gi|262553290|gb|EEZ09124.1| metallophosphoesterase [Brucella ceti M490/95/1]
 gi|262766568|gb|EEZ12357.1| metallophosphoesterase [Brucella melitensis bv. 3 str. Ether]
 gi|263002401|gb|EEZ14976.1| metallophosphoesterase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093500|gb|EEZ17534.1| metallophosphoesterase [Brucella melitensis bv. 2 str. 63/9]
 gi|264661400|gb|EEZ31661.1| metallophosphoesterase [Brucella pinnipedialis M292/94/1]
 gi|297176002|gb|EFH35349.1| icc family phosphohydrolase [Brucella abortus bv. 5 str. B3196]
          Length = 303

 Score =  380 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 128/303 (42%), Positives = 185/303 (61%), Gaps = 4/303 (1%)

Query: 6   TTIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
            ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L  
Sbjct: 1   MSVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQ 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ 
Sbjct: 61  TPDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEP 120

Query: 124 YITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
           ++  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A
Sbjct: 121 WMRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEA 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I   
Sbjct: 181 GARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGP 240

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSD 301
              +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    
Sbjct: 241 DGKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNER 300

Query: 302 IFY 304
           + Y
Sbjct: 301 VLY 303


>gi|150397483|ref|YP_001327950.1| metallophosphoesterase [Sinorhizobium medicae WSM419]
 gi|150028998|gb|ABR61115.1| metallophosphoesterase [Sinorhizobium medicae WSM419]
          Length = 300

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 147/300 (49%), Positives = 197/300 (65%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL+ KRI G VNWH NR ++      + L+ DI   + D
Sbjct: 1   MFKLAHISDVHLGPLPDLSLRELASKRITGFVNWHRNRVRHLFPGTLDCLMKDIEKRDPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN   + EI   T WL   G P +IS+VPGNHDAY+ GA EKS HAW  ++ 
Sbjct: 61  HLAITGDLVNLASSLEIEAVTEWLTEAGEPDEISVVPGNHDAYVPGAYEKSTHAWYPFMR 120

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   S   K    FPY+R+R ++ALIGCSTA+ATPPF+A+GYFG  QA  T  LLR+A 
Sbjct: 121 GDDAPSGWVKKHACFPYMRVRGSVALIGCSTAVATPPFAASGYFGPRQARETVNLLRRAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FRI+M+HHPP+   +S++ RM GI+RF   I   GA+++LHGHTHLNSL+W+K   
Sbjct: 181 EAGLFRIVMIHHPPIRGATSMHKRMIGIRRFAATISAGGAEMVLHGHTHLNSLYWLKGHA 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +PV+GIASASQ    +KP A+YNLF ++ +   W L  +RY ++PD+  +    +  F
Sbjct: 241 GPVPVIGIASASQGPGGSKPVAAYNLFSVDGEPGDWRLTRERYAINPDATGVVLAETTFF 300


>gi|241205764|ref|YP_002976860.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859654|gb|ACS57321.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 302

 Score =  379 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 147/300 (49%), Positives = 203/300 (67%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   PS    EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPSLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR+ G+P + S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRAFGDPANTSVVPGNHDAYVPGAYEKSMRAWYDYVR 120

Query: 127 SDTTCSTG---KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         + +FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLAPPQWQDDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 181 EAGLFRVVMIHHPPIRGATAFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  + +DIF
Sbjct: 241 QPVPVVGIASASQGPGSVKPPAAYNLFSIDGSPGAWELSGERFSLNRAGDAVMPESTDIF 300


>gi|319403806|emb|CBI77390.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 298

 Score =  379 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 130/289 (44%), Positives = 192/289 (66%), Gaps = 5/289 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS  EL  KR+ G +NW   R      +   +L++ +     D
Sbjct: 5   MFYLAHISDVHLSPLPQPSLLELCGKRLTGYLNWKKKRNNQMKSDALEILMHALKQKKPD 64

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   + +WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 65  HIVISGDLVNLSLDKEFTQARNWLLAQNNPENISLTFGNHDAYVRGAFQKACTYFQPWIK 124

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD   S+ K  FPY+RIRNNIA+IG S+AIATPPF A+GYFG++QA   S+ L +A K+G
Sbjct: 125 SD---SSQKNPFPYMRIRNNIAIIGASSAIATPPFQASGYFGKQQAKTLSQFLNEAEKQG 181

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP    +S + +++GI+RF K++ H G +LILHGHTHL +L+ I+ + + I
Sbjct: 182 LFRVVMIHHPPFHHATSWHKKLWGIERFLKVVKHHGCELILHGHTHLPTLNIIEGKVRKI 241

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           P+VG++SASQ   S KP AS+NLF IE  +  W  + +RY +   + +I
Sbjct: 242 PIVGVSSASQSFGSKKPPASFNLFAIEYLHNQWHCQLQRYCIINHNNTI 290


>gi|222086630|ref|YP_002545164.1| phosphatase protein [Agrobacterium radiobacter K84]
 gi|221724078|gb|ACM27234.1| phosphatase protein [Agrobacterium radiobacter K84]
          Length = 316

 Score =  379 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 142/303 (46%), Positives = 194/303 (64%), Gaps = 5/303 (1%)

Query: 6   TTIMFVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           +  MF LAHISD+HL   P     EL+ KRI G VNWH NR+K+      +LL++DI   
Sbjct: 13  SQPMFKLAHISDVHLGPLPRLSIRELASKRITGFVNWHRNRRKHLFGGTLDLLLDDIRAK 72

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+++TGD+VN     EI T+  WL+++G+P   S+VPGNHDAY+ GA EK++ AW  
Sbjct: 73  QADHLAVTGDLVNLGSGIEIRTAAEWLKTVGDPAFTSVVPGNHDAYVPGAYEKAMRAWYP 132

Query: 124 YITSDTTCSTGK---KLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
           Y+  D           +FPYLRIR+ +ALIGCSTA+ATPPF+A+G+F   QA  T  +LR
Sbjct: 133 YVQGDLAPPEWPEDQHVFPYLRIRDRVALIGCSTAVATPPFAASGFFSARQARETVNMLR 192

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
            A + G FR++M+HHPP+   +S Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW+ 
Sbjct: 193 AAGEAGLFRVVMIHHPPIRGATSFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLN 252

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
                +PVVGIASASQ     KP A+YNLF I      W L+ +R++L+     ++    
Sbjct: 253 GPTGPVPVVGIASASQGPGGLKPAAAYNLFTIAGHPGAWELKAERFSLNAHGDGVETQGV 312

Query: 301 DIF 303
           D+ 
Sbjct: 313 DVL 315


>gi|190892804|ref|YP_001979346.1| phosphoesterase [Rhizobium etli CIAT 652]
 gi|190698083|gb|ACE92168.1| putative phosphoesterase protein [Rhizobium etli CIAT 652]
          Length = 312

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/300 (48%), Positives = 200/300 (66%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 11  MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 70

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR +G+P   S+VPGNHDAY+ GA EKS+ AW +Y+ 
Sbjct: 71  HLAVTGDLVNLASGIEIRAAAAWLRELGDPAHTSVVPGNHDAYVPGAYEKSMRAWYEYVR 130

Query: 127 SDTTCS---TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         + +FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 131 GDLAPPQWQEDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 190

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 191 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 250

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  +  DIF
Sbjct: 251 QPVPVVGIASASQGPGSIKPAAAYNLFSIDGSPGAWELSGERFSLNRAGDAVIPESVDIF 310


>gi|306843090|ref|ZP_07475712.1| phosphohydrolase, Icc family protein [Brucella sp. BO2]
 gi|306286695|gb|EFM58248.1| phosphohydrolase, Icc family protein [Brucella sp. BO2]
          Length = 300

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 129/300 (43%), Positives = 183/300 (61%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGKRPQFPYMRQRGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNMFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|254719597|ref|ZP_05181408.1| putative phosphohydrolase, Icc family protein [Brucella sp. 83/13]
          Length = 300

 Score =  378 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 129/300 (43%), Positives = 183/300 (61%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGKRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNADGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|327193481|gb|EGE60376.1| putative phosphoesterase protein [Rhizobium etli CNPAF512]
          Length = 306

 Score =  378 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/300 (48%), Positives = 200/300 (66%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 5   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 64

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR +G+P   S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 65  HLAVTGDLVNLASGIEIRAAAAWLRELGDPAHTSVVPGNHDAYVPGAYEKSMRAWYDYVR 124

Query: 127 SDTTCS---TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         + +FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 125 GDLAPPQWQEDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 184

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 185 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 244

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  +  DIF
Sbjct: 245 QPVPVVGIASASQGPGSIKPAAAYNLFSIDGSPGAWELSGERFSLNRAGDAVIPESVDIF 304


>gi|260565941|ref|ZP_05836411.1| metallophosphoesterase [Brucella suis bv. 4 str. 40]
 gi|261755510|ref|ZP_05999219.1| metallophosphoesterase [Brucella suis bv. 3 str. 686]
 gi|260155459|gb|EEW90539.1| metallophosphoesterase [Brucella suis bv. 4 str. 40]
 gi|261745263|gb|EEY33189.1| metallophosphoesterase [Brucella suis bv. 3 str. 686]
          Length = 303

 Score =  378 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 128/303 (42%), Positives = 185/303 (61%), Gaps = 4/303 (1%)

Query: 6   TTIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
            ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L  
Sbjct: 1   MSVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQ 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ 
Sbjct: 61  TPDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEP 120

Query: 124 YITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
           ++  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A
Sbjct: 121 WMRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEA 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I   
Sbjct: 181 GARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGP 240

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSD 301
              +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    
Sbjct: 241 DGKVPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNER 300

Query: 302 IFY 304
           + Y
Sbjct: 301 VLY 303


>gi|62290448|ref|YP_222241.1| hypothetical protein BruAb1_1553 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700371|ref|YP_414945.1| metallo-phosphoesterase [Brucella melitensis biovar Abortus 2308]
 gi|225853042|ref|YP_002733275.1| metallophosphoesterase [Brucella melitensis ATCC 23457]
 gi|254689750|ref|ZP_05153004.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           6 str. 870]
 gi|254694239|ref|ZP_05156067.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           3 str. Tulya]
 gi|254697895|ref|ZP_05159723.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254710601|ref|ZP_05172412.1| putative phosphohydrolase, Icc family protein [Brucella
           pinnipedialis B2/94]
 gi|254714784|ref|ZP_05176595.1| putative phosphohydrolase, Icc family protein [Brucella ceti
           M644/93/1]
 gi|254717845|ref|ZP_05179656.1| putative phosphohydrolase, Icc family protein [Brucella ceti
           M13/05/1]
 gi|254730785|ref|ZP_05189363.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           4 str. 292]
 gi|256032095|ref|ZP_05445709.1| putative phosphohydrolase, Icc family protein [Brucella
           pinnipedialis M292/94/1]
 gi|256045187|ref|ZP_05448086.1| putative phosphohydrolase, Icc family protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256061617|ref|ZP_05451758.1| putative phosphohydrolase, Icc family protein [Brucella neotomae
           5K33]
 gi|256114138|ref|ZP_05454892.1| putative phosphohydrolase, Icc family protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|256160291|ref|ZP_05457985.1| putative phosphohydrolase, Icc family protein [Brucella ceti
           M490/95/1]
 gi|256258003|ref|ZP_05463539.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           9 str. C68]
 gi|256369980|ref|YP_003107491.1| hypothetical protein BMI_I1578 [Brucella microti CCM 4915]
 gi|260169230|ref|ZP_05756041.1| putative phosphohydrolase, Icc family protein [Brucella sp. F5/99]
 gi|294852882|ref|ZP_06793555.1| icc family phosphohydrolase [Brucella sp. NVSL 07-0026]
 gi|62196580|gb|AAX74880.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616472|emb|CAJ11537.1| Metallo-phosphoesterase [Brucella melitensis biovar Abortus 2308]
 gi|225641407|gb|ACO01321.1| metallophosphoesterase [Brucella melitensis ATCC 23457]
 gi|256000143|gb|ACU48542.1| hypothetical protein BMI_I1578 [Brucella microti CCM 4915]
 gi|294821471|gb|EFG38470.1| icc family phosphohydrolase [Brucella sp. NVSL 07-0026]
 gi|326409584|gb|ADZ66649.1| putative phosphohydrolase, Icc family [Brucella melitensis M28]
 gi|326539288|gb|ADZ87503.1| metallophosphoesterase [Brucella melitensis M5-90]
          Length = 300

 Score =  378 bits (971), Expect = e-103,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 183/300 (61%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|261752852|ref|ZP_05996561.1| metallophosphoesterase [Brucella suis bv. 5 str. 513]
 gi|261742605|gb|EEY30531.1| metallophosphoesterase [Brucella suis bv. 5 str. 513]
          Length = 303

 Score =  377 bits (969), Expect = e-103,   Method: Composition-based stats.
 Identities = 128/303 (42%), Positives = 184/303 (60%), Gaps = 4/303 (1%)

Query: 6   TTIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
            ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L  
Sbjct: 1   MSVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQ 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ 
Sbjct: 61  TPDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEP 120

Query: 124 YITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
           ++  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A
Sbjct: 121 WMRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEA 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +G FR +M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I   
Sbjct: 181 GARGLFRAVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGP 240

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSD 301
              +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    
Sbjct: 241 DGKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNER 300

Query: 302 IFY 304
           + Y
Sbjct: 301 VLY 303


>gi|261315734|ref|ZP_05954931.1| metallophosphoesterase [Brucella pinnipedialis M163/99/10]
 gi|261304760|gb|EEY08257.1| metallophosphoesterase [Brucella pinnipedialis M163/99/10]
          Length = 303

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 128/303 (42%), Positives = 185/303 (61%), Gaps = 4/303 (1%)

Query: 6   TTIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
            ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L  
Sbjct: 1   MSVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQ 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ 
Sbjct: 61  TPDHIAVTGDLVNLVLNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEP 120

Query: 124 YITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
           ++  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A
Sbjct: 121 WMRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEA 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I   
Sbjct: 181 GARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGP 240

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSD 301
              +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    
Sbjct: 241 DGKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNER 300

Query: 302 IFY 304
           + Y
Sbjct: 301 VLY 303


>gi|319406812|emb|CBI80445.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 294

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 130/289 (44%), Positives = 190/289 (65%), Gaps = 5/289 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS +EL  KR+ G +NW   R      +    L++ +     D
Sbjct: 1   MFYLAHISDVHLSPLPQPSLWELCGKRLTGYLNWKKKRNNQMKSDALETLMHALKQKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   + +WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 61  HIVISGDLVNLSLDKEFTQARNWLLAQNNPENISLTFGNHDAYVRGAFQKACTYFQPWIK 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD    + K  FPY+RIRNNIA+IG S+AIATPPF A+GYFG++QA   S+ L +A K+G
Sbjct: 121 SD---FSQKNPFPYMRIRNNIAIIGASSAIATPPFQASGYFGKKQAKILSQFLNEAAKQG 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           FFR++M+HHPP    +S Y +++GI+RF +++ H G +LILHGHTHL +L+ I+ +   I
Sbjct: 178 FFRVVMIHHPPFHHATSWYKKLWGIERFLEVVKHHGCELILHGHTHLPTLNIIEEKISKI 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           PVVG++SASQ   S KP AS+NLF I+  +  W  + +RY +   +  I
Sbjct: 238 PVVGVSSASQSFGSKKPPASFNLFAIKYLHHQWHCQLQRYGIINHNNKI 286


>gi|325293623|ref|YP_004279487.1| hypothetical protein AGROH133_07855 [Agrobacterium sp. H13-3]
 gi|325061476|gb|ADY65167.1| hypothetical protein AGROH133_07855 [Agrobacterium sp. H13-3]
          Length = 316

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 144/304 (47%), Positives = 203/304 (66%), Gaps = 7/304 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P   F EL+ KRI G VNWH NR+K+   +    L++D+   + D
Sbjct: 1   MFKLAHISDVHLGPLPKLTFRELASKRITGFVNWHRNRRKHLFTDTLEKLLDDLEAKSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN     EI  +  WL  +G+P  IS+VPGNHDAY+SGA +K++ AW  Y+ 
Sbjct: 61  HLAITGDLVNLATGIEIRAAADWLEEVGDPEKISVVPGNHDAYVSGAHDKAMRAWYPYVR 120

Query: 127 SDTTCSTG---KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   +     +K+FPY+R+R  +ALIGCST+IATPPFSA GYFG  QA AT++LL+KA 
Sbjct: 121 GDGDPAEWDDDRKIFPYMRVRGPVALIGCSTSIATPPFSATGYFGNRQARATAELLKKAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           ++G FR++M+HHPP+   ++ + RMFGI+RF   +   GA+L+LHGHTHLN+++W+    
Sbjct: 181 EQGLFRVVMIHHPPIRGAAAAHKRMFGIRRFAAALGVGGAELVLHGHTHLNTVYWLNTHH 240

Query: 244 K--LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
               IPVVGIASASQ     KP+A+YNLF+I      W +  +R++L+     I  +   
Sbjct: 241 GQEHIPVVGIASASQGPGGEKPRAAYNLFHISGGPGTWNVACERHSLNDTGTGIGLEDIR 300

Query: 302 IFYD 305
           +FY+
Sbjct: 301 VFYE 304


>gi|163843817|ref|YP_001628221.1| metallophosphoesterase [Brucella suis ATCC 23445]
 gi|163674540|gb|ABY38651.1| metallophosphoesterase [Brucella suis ATCC 23445]
          Length = 300

 Score =  376 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 182/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P     EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYCELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|161619507|ref|YP_001593394.1| metallophosphoesterase [Brucella canis ATCC 23365]
 gi|254704817|ref|ZP_05166645.1| metallophosphoesterase [Brucella suis bv. 3 str. 686]
 gi|161336318|gb|ABX62623.1| metallophosphoesterase [Brucella canis ATCC 23365]
          Length = 300

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 183/300 (61%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|254702285|ref|ZP_05164113.1| putative phosphohydrolase, Icc family protein [Brucella suis bv. 5
           str. 513]
          Length = 300

 Score =  375 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 182/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR +M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRAVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|254708232|ref|ZP_05170060.1| putative phosphohydrolase, Icc family protein [Brucella
           pinnipedialis M163/99/10]
          Length = 300

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 183/300 (61%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLVLNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|254500795|ref|ZP_05112946.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
 gi|222436866|gb|EEE43545.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
          Length = 308

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 105/301 (34%), Positives = 163/301 (54%), Gaps = 8/301 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH+SD HL     P   +L  KR++G +NW  NR K         LI D+     D
Sbjct: 1   MFKLAHLSDPHLGPLPDPKLLQLFSKRLLGYLNWQRNRSKIMGGNHLEQLIEDMKAQAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WL  +G P  +S+VPGNHDAY+ GA +K+  AW  Y+ 
Sbjct: 61  HIAVTGDLVNIALPLEISGARAWLDELGAPDQVSVVPGNHDAYVRGAVKKARTAWWPYMR 120

Query: 127 SDTTCST------GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
            D            +  FPY+R R +IA+IG +T  AT P+ A+G  G +Q      +L 
Sbjct: 121 GDGEDDVPSEKVGSEATFPYVRKRGDIAIIGVTTGRATAPWFASGRVGTKQTRRLRAILE 180

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
           +  ++  FR++++HHPP  + +  + R+    R + ++   GA+LILHGHTH++S   I+
Sbjct: 181 ELAEEKLFRVVLIHHPPFKNATKWHKRLSDASRLRTVVKRAGAELILHGHTHIDSFENIE 240

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
                +PV+G+ SA+     +KP A YNLF I ++N+ WT + + +        ++    
Sbjct: 241 GPNGPVPVIGVPSATSAPGGHKPAARYNLFSIARENDGWTCQMEEHGYDESGGPVKPLSQ 300

Query: 301 D 301
            
Sbjct: 301 R 301


>gi|227822882|ref|YP_002826854.1| putative phosphohydrolase, Icc family [Sinorhizobium fredii NGR234]
 gi|227341883|gb|ACP26101.1| putative phosphohydrolase, Icc family [Sinorhizobium fredii NGR234]
          Length = 302

 Score =  375 bits (963), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/301 (47%), Positives = 198/301 (65%), Gaps = 5/301 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  SF EL+ KRI G VNWH NR ++        L++DI   + D
Sbjct: 1   MFKLAHISDVHLGPLPDLSFRELASKRITGFVNWHRNRARHLFPGTLESLMDDIEKRDPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN   + EI   T WL   G+P DIS+VPGNHDAY+ GA EK+  AW  ++ 
Sbjct: 61  HLAITGDLVNLASSLEIQAVTEWLTEAGDPEDISVVPGNHDAYVPGAYEKTARAWFPFMR 120

Query: 127 SDTTCSTG---KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D+  +        FPY+R+R ++ALIGCSTA+ATPPF+A+GYFG  QA AT  LLR A 
Sbjct: 121 GDSGPAGWMKDHHCFPYIRVRGSVALIGCSTAVATPPFAASGYFGPRQARATVNLLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   +S++ RM GI+RF   I   GA+L++HGHTHLN+++W++   
Sbjct: 181 EAGLFRVVMIHHPPIRGATSMHKRMIGIRRFAATISSGGAELVIHGHTHLNTVYWLRGHA 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +PVVGIASASQ    +KP A+YNLF I+ +   W L  +R+ L  D+ ++    +  F
Sbjct: 241 APVPVVGIASASQGPGGSKPVAAYNLFSIDGEPGAWRLTRERFALGADAKTVSLAETTQF 300

Query: 304 Y 304
           +
Sbjct: 301 H 301


>gi|15889538|ref|NP_355219.1| hypothetical protein Atu2263 [Agrobacterium tumefaciens str. C58]
 gi|15157419|gb|AAK88004.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 316

 Score =  374 bits (961), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/304 (46%), Positives = 202/304 (66%), Gaps = 7/304 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P   F EL+ KRI G VNWH NR+K+   +    L++D+   + D
Sbjct: 1   MFKLAHISDVHLGPLPKLTFRELASKRITGFVNWHRNRRKHLFTDTLEKLLDDLETKSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN     EI  +  WL  +G+P   S+VPGNHDAY+SGA +K++ AW  Y+ 
Sbjct: 61  HLAITGDLVNLATGIEIRAAADWLEEVGDPEKTSVVPGNHDAYVSGAHDKAMQAWYPYVR 120

Query: 127 SDTTCSTG---KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   +     +K+FPY+R+R  +ALIGCST+IATPPFSA GYFG  QA AT++LL+KA 
Sbjct: 121 GDGDPAEWDDDRKIFPYMRVRGPVALIGCSTSIATPPFSATGYFGNRQARATAELLKKAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           ++G FR++M+HHPP+   ++ + RMFG++RF   +   GA+L+LHGHTHLN+++W+    
Sbjct: 181 EQGLFRVVMIHHPPIRGAAAAHKRMFGMRRFAAALGVGGAELVLHGHTHLNTVYWLNTHH 240

Query: 244 K--LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
               IPVVGI+SASQ     KP+A+YNLF+I      W +  +R++L+     +  +   
Sbjct: 241 GEDHIPVVGISSASQGPGGEKPRAAYNLFHISGGPGTWNVACERHSLNETGTGVALEDIR 300

Query: 302 IFYD 305
           +FY+
Sbjct: 301 VFYE 304


>gi|23502428|ref|NP_698555.1| hypothetical protein BR1564 [Brucella suis 1330]
 gi|23348417|gb|AAN30470.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 300

 Score =  374 bits (961), Expect = e-102,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 182/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V   LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLGSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++  +  W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|319405244|emb|CBI78849.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 294

 Score =  374 bits (961), Expect = e-102,   Method: Composition-based stats.
 Identities = 126/289 (43%), Positives = 181/289 (62%), Gaps = 5/289 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS FEL  KR+ G +NW   R      +    L+  +     D
Sbjct: 1   MFYLAHISDVHLSPLPQPSLFELCGKRLTGYLNWKKKRNNQMKADALETLMRALKQKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN    +E   +  WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 61  HIVISGDLVNLALEKEFTQARSWLLAQNNPQNISLTFGNHDAYVRGAFQKACTYFQPWIK 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD      K  FPY+RIR+NIA+IG S+AIATP F A+GYF ++QA   S+ L +A  +G
Sbjct: 121 SDFPQ---KNPFPYMRIRDNIAIIGASSAIATPFFQASGYFDKQQAKILSQFLTEAATRG 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           FFR++++HHPP    +S + +++GI+RF K++   G +LILHGHTHL +L+ I+ E   I
Sbjct: 178 FFRVVIIHHPPFHHATSWHKKLWGIERFLKVVKQHGCELILHGHTHLPTLNTIEGEMSKI 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           P+VG++SASQ   S KP AS+NLF IE  +  W  + +RY +   +  I
Sbjct: 238 PIVGVSSASQSFGSKKPPASFNLFAIEYLHHQWHCQLQRYGIINHNNEI 286


>gi|121602306|ref|YP_989290.1| Ser/Thr protein phosphatase family protein [Bartonella
           bacilliformis KC583]
 gi|120614483|gb|ABM45084.1| Ser/Thr protein phosphatase family protein [Bartonella
           bacilliformis KC583]
          Length = 294

 Score =  371 bits (953), Expect = e-101,   Method: Composition-based stats.
 Identities = 131/303 (43%), Positives = 189/303 (62%), Gaps = 11/303 (3%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISDIHLS    PSF EL  KR+ G +NW   RK   +  V   L+  I   N D
Sbjct: 1   MFYLAHISDIHLSPVPQPSFSELFGKRLTGYLNWQKKRKNQMTTGVLETLMCTIKEKNPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   + +WL + G PHDIS+  GNHDAY+  A +K+   ++ +I 
Sbjct: 61  HLVISGDLVNLSLDKEFKQARNWLLTQGQPHDISLTFGNHDAYVRRALQKACTIFQPWIQ 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D      K  FPY+RIR+NIA+IG S+AIATPPF A+GYFG++QA   S+LL +A  + 
Sbjct: 121 GDLPQ---KNAFPYMRIRDNIAIIGASSAIATPPFQASGYFGKKQAQILSQLLDEAAARN 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++ +HHPP    +  + +++GI RF  +I   G +LILHGHTHL +L+ I+ +K+ I
Sbjct: 178 LFRVVTIHHPPFHHATLWHKKLWGIGRFLDVIKRYGCELILHGHTHLPTLNIIEEKKRKI 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDT 306
           P+VG+ASASQ      P A++N F IE  +  W  + +RY++      I K+   +  +T
Sbjct: 238 PIVGVASASQGCGGKNPPANFNFFTIEHAHHQWHCQLQRYSI------INKNNDIVCTET 291

Query: 307 LVL 309
           + L
Sbjct: 292 IDL 294


>gi|13472484|ref|NP_104051.1| hypothetical protein mll2796 [Mesorhizobium loti MAFF303099]
 gi|14023230|dbj|BAB49837.1| mll2796 [Mesorhizobium loti MAFF303099]
          Length = 321

 Score =  370 bits (951), Expect = e-100,   Method: Composition-based stats.
 Identities = 131/292 (44%), Positives = 183/292 (62%), Gaps = 3/292 (1%)

Query: 5   YTTIMFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL 62
           Y   MF LAHISD+HL   P  S+ +L+ KR++G VNW  NR+++    V + +  DI  
Sbjct: 9   YEGWMFRLAHISDVHLGPLPDVSYRDLASKRVLGYVNWQRNRRRHMHDAVIDAITADIKT 68

Query: 63  HNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWK 122
            N DH+++TGD+VN   + EI  + HWL ++G+PHD+S+VPGNHDAY+ GA +K   +W 
Sbjct: 69  QNPDHLAVTGDLVNLALDGEIEMAKHWLETLGSPHDVSVVPGNHDAYVPGAFDKVCRSWA 128

Query: 123 DYITSDT-TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
            +++ D       +  FPYLR+R N+AL+G STA AT PF ANG+F + QA    K+LR 
Sbjct: 129 AWMSGDGVNTPVDRNAFPYLRVRGNVALVGVSTARATAPFMANGFFMEGQAERLGKILRD 188

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
              +G FR IM+HHPPV    S + R+FGI RF K+I   GA+L+LHGH+HL SL  I  
Sbjct: 189 TGGQGLFRAIMIHHPPVRGAVSQHKRLFGIARFHKVIRKNGAELVLHGHSHLPSLFQIGL 248

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
               +PVVG+A+A Q   S  P A YNLF I+ +   W +   R  L+  ++
Sbjct: 249 RGTKVPVVGVAAAGQAPGSKHPAAQYNLFDIDGEKGNWRIRLTRRGLTGPAI 300


>gi|90418313|ref|ZP_01226225.1| putative metallophophoesterase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337985|gb|EAS51636.1| putative metallophophoesterase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 319

 Score =  369 bits (948), Expect = e-100,   Method: Composition-based stats.
 Identities = 123/284 (43%), Positives = 176/284 (61%), Gaps = 2/284 (0%)

Query: 6   TTIMFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
            T MF LAH+SDIHL   P  S  EL+ KR+ G VNWH NR++    +    LI D+   
Sbjct: 1   MTGMFRLAHLSDIHLGPLPELSIRELASKRVTGYVNWHRNRRRVMFGDTLANLIQDLQQE 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+++TGD+VN     E   +  WL  +G PHD+S+VPGNHDAY+ GA ++S   W +
Sbjct: 61  APDHIAVTGDLVNLATKVETMAARIWLEELGKPHDVSVVPGNHDAYVPGALKRSYREWYE 120

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           Y+  D   +     FPY+R+R  +A+ G STA AT PF A G F + QA A +K L  A 
Sbjct: 121 YMIGDNPLNAIGNSFPYVRVRGPVAIFGVSTAEATAPFFATGTFRRRQAMALAKQLEHAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
             G FR++++HHPP+  +++ + R+ G Q F K+I   GA+L+LHGHTHL++LHW+K  +
Sbjct: 181 AHGQFRVVLIHHPPISGSTAWHKRLIGKQFFSKVIHEMGAELVLHGHTHLDTLHWLKGPQ 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
            ++PVVG+ SASQ   S+ P + YNLF I+ +   W+L  +   
Sbjct: 241 GMVPVVGVPSASQAPGSSHPASRYNLFEIDGEPGKWSLIQRERG 284


>gi|319898478|ref|YP_004158571.1| hypothetical protein BARCL_0302 [Bartonella clarridgeiae 73]
 gi|319402442|emb|CBI75983.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 298

 Score =  368 bits (944), Expect = e-100,   Method: Composition-based stats.
 Identities = 124/289 (42%), Positives = 179/289 (61%), Gaps = 5/289 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS  EL  KR+ G +NW   R      +    L++ +     D
Sbjct: 5   MFYLAHISDVHLSPLPQPSLLELCGKRLTGYLNWTKKRNNQMKTDALETLMHALKQKKPD 64

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD++N   ++E   +  WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 65  HIVISGDLINLALDKEFTQARSWLLAQNNPQNISLTFGNHDAYVRGAFQKACTCFQPWIK 124

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD      K  FPY+RIRNNIA+IG S+AIATPPF A GYF ++QA   S+ L +A  + 
Sbjct: 125 SDFPQ---KNPFPYMRIRNNIAIIGASSAIATPPFQAAGYFDKKQAKILSQFLSEAATRN 181

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FRI+ +HHPP    +S + +++G++RF K+I H G +LILHGHTHL +L+ I+ +    
Sbjct: 182 LFRIVTIHHPPFHHATSWHKKLWGVERFLKIIKHHGCELILHGHTHLPTLNIIEGKMGKT 241

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           P+VG+ASASQ   S KP A++NLF IE  +  W  + +RY +   +  I
Sbjct: 242 PIVGVASASQSFGSKKPPANFNLFTIEYLHHQWHCQLERYGIINHNNEI 290


>gi|307944145|ref|ZP_07659486.1| metallophosphoesterase [Roseibium sp. TrichSKD4]
 gi|307772491|gb|EFO31711.1| metallophosphoesterase [Roseibium sp. TrichSKD4]
          Length = 306

 Score =  366 bits (940), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 110/298 (36%), Positives = 166/298 (55%), Gaps = 5/298 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           M  LAH+SD HL   P+    +L  KRI+G +NW  +R K         L+ D+     D
Sbjct: 1   MLKLAHLSDPHLGPLPNPKLIQLFSKRILGYLNWWQHRSKNMGGNHLEQLVADMQDQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ITGD+VN     EI  +  WL  +G+P  +++VPGNHDAY+ GA +K+  AW  Y++
Sbjct: 61  HVAITGDLVNIALPLEIIGARTWLEGVGSPEHVTVVPGNHDAYVPGALKKARDAWLPYMS 120

Query: 127 SDTTCSTG---KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +D   +     +  FP++R R NIAL+G STA AT P+ A G  G +Q+ A    L++  
Sbjct: 121 ADNGLAADHPDEASFPFVRRRKNIALVGVSTARATGPWFATGRVGSKQSRALRDTLKELG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPP    ++ + R+    R + MI   GA+L+LHGHTH++S   I+   
Sbjct: 181 DEGLFRVVMIHHPPFPKATNWHKRLSDASRVRAMIKRVGAELVLHGHTHIDSFKEIEGPN 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
             +PV+G+ SA+      KP A YN+F I+     W ++      +     I+K  S 
Sbjct: 241 GPVPVIGVPSATSAPGGKKPAARYNIFEIDGSARNWNVQMTERGFTGSDSQIEKIRSR 298


>gi|315121809|ref|YP_004062298.1| putative phosphoesterase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495211|gb|ADR51810.1| putative phosphoesterase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 294

 Score =  365 bits (938), Expect = 4e-99,   Method: Composition-based stats.
 Identities = 210/301 (69%), Positives = 243/301 (80%), Gaps = 7/301 (2%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           MFVLAHISDIH+S   SF ELS KRIIGL NWHF RKKYFS  + +LL+NDIL HN++H+
Sbjct: 1   MFVLAHISDIHISCPLSFSELSLKRIIGLANWHFGRKKYFSHTMVDLLVNDILSHNINHL 60

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +ITGDIVN T N+EI  + HWL++I NPHDISIV GNHDAY + +K+KSL AW DYI  D
Sbjct: 61  AITGDIVNMTTNQEISEAIHWLKNIVNPHDISIVLGNHDAYTNSSKKKSLRAWSDYIAGD 120

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           T     KK FPYLR+RNNIALIGCSTAIATPPFSANGYFGQEQ H TSKLLRKA K+G F
Sbjct: 121 TPP-IEKKQFPYLRVRNNIALIGCSTAIATPPFSANGYFGQEQDHDTSKLLRKAKKEGLF 179

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++MMHHPP LDTS++YNRMFGI+RF+ MI  EGA+L+LHGHTH NSLHWI   KKLIPV
Sbjct: 180 RVVMMHHPPFLDTSTIYNRMFGIKRFKDMILREGAELMLHGHTHRNSLHWIDGAKKLIPV 239

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLV 308
           VGIA+A      +K  ASYNLFYIEKK++ WTL GKRYTLS DS  +QK+ S+IF +TL 
Sbjct: 240 VGIAAAC-----HKKNASYNLFYIEKKHDCWTLRGKRYTLS-DSNGVQKNCSNIFNETLS 293

Query: 309 L 309
           L
Sbjct: 294 L 294


>gi|116253249|ref|YP_769087.1| phosphoesterase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257897|emb|CAK08995.1| putative phosphoesterase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 312

 Score =  364 bits (936), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 148/300 (49%), Positives = 204/300 (68%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   PS    EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 11  MFKLAHISDVHLGPLPSLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 70

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV++TGD+VN     EI  +  WLR++G+P D S+VPGNHDAY+ G+ EKS+ AW DY+ 
Sbjct: 71  HVAVTGDLVNLASGIEIRAAAAWLRALGDPADTSVVPGNHDAYVPGSYEKSMRAWYDYVR 130

Query: 127 SDTTCSTG---KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         + +FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 131 GDLAPPQWPENRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNILRAAG 190

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 191 EAGLFRVVMIHHPPIRGATAFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQM 250

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  + +DIF
Sbjct: 251 QPVPVVGIASASQGPGSIKPPAAYNLFSIDGSPGAWELRGERFSLNRAGDAVMPESADIF 310


>gi|118593631|ref|ZP_01551007.1| Metallo-phosphoesterase [Stappia aggregata IAM 12614]
 gi|118433742|gb|EAV40403.1| Metallo-phosphoesterase [Stappia aggregata IAM 12614]
          Length = 312

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 110/301 (36%), Positives = 161/301 (53%), Gaps = 8/301 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
            F LAH+SD HL     P   +L  KRI+G +NW  NR +         L++D+     D
Sbjct: 3   TFRLAHLSDPHLGPLPDPKLLQLFSKRILGYLNWRRNRSRIMGGSYLEQLVDDMKRQAPD 62

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WL  IG P ++S+VPGNHDAY+ GA  ++  AW  Y+ 
Sbjct: 63  HIAVTGDLVNIALPLEISGARTWLEEIGAPENVSVVPGNHDAYVPGAVRRARAAWWPYMR 122

Query: 127 SDTTCSTGKKL------FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
            D               FPY+R R+ IAL+G +T  A+ P+ A G  G +Q+      L 
Sbjct: 123 GDGAGDVPPNGTKSQATFPYVRKRDGIALVGVTTGRASGPWFATGRAGSKQSKRLRATLD 182

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
              + GFFR++M+HHPP    +  + R+    R + ++   GA+LILHGHTH++S   I+
Sbjct: 183 DLGRDGFFRVVMLHHPPFPHATHWHKRLSDASRVRAVVKRAGAELILHGHTHIDSFEHIE 242

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
                +PVVG+ SA+      KP A YNLF IEK NE WT + + +  S  +  ++    
Sbjct: 243 GPDGRVPVVGVPSATSAPGGKKPAARYNLFRIEKTNEGWTCQMEEHGFSAPNEPVKLLSE 302

Query: 301 D 301
            
Sbjct: 303 R 303


>gi|222149376|ref|YP_002550333.1| hypothetical protein Avi_3243 [Agrobacterium vitis S4]
 gi|221736360|gb|ACM37323.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 302

 Score =  363 bits (931), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 147/293 (50%), Positives = 193/293 (65%), Gaps = 5/293 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISDIHL   P  +F EL+ KRI G VNWH NR K+        L+ DI     D
Sbjct: 1   MFKLAHISDIHLGPMPHLTFRELASKRITGYVNWHRNRAKHMVSGTLEALVADIHAKAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G P   S+VPGNHDAY+ GA EK++HAW DY+ 
Sbjct: 61  HLTVTGDLVNLASGLEINKAAEWLRTVGPPATTSVVPGNHDAYVPGAHEKAMHAWYDYVR 120

Query: 127 SDTTCSTGKKLF---PYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            DT     +K F   P  R R  + LIGCST+IATPPFSA+GYF   QA  T++LLR+A 
Sbjct: 121 GDTDPDIWRKDFKLWPTFRRRGPVGLIGCSTSIATPPFSASGYFSSRQARETAQLLRQAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           ++G FR++++HHPPV   +S + RM GI+RF   I   GA+L+LHGHTHLN+L+W+ N  
Sbjct: 181 EEGLFRVVLIHHPPVRGAASQHKRMIGIRRFAAAISLGGAELVLHGHTHLNTLNWLHNRH 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
             +PVVGIASASQ   + KPQA+YNLF I   +  W L+ +RY L+ D+  + 
Sbjct: 241 GRVPVVGIASASQGPGNKKPQAAYNLFSISGASGAWVLDWERYALTGDTSEVS 293


>gi|260462516|ref|ZP_05810723.1| metallophosphoesterase [Mesorhizobium opportunistum WSM2075]
 gi|259031712|gb|EEW32981.1| metallophosphoesterase [Mesorhizobium opportunistum WSM2075]
          Length = 309

 Score =  362 bits (929), Expect = 4e-98,   Method: Composition-based stats.
 Identities = 125/288 (43%), Positives = 180/288 (62%), Gaps = 3/288 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S+ +L+ KR++G VNW  NR+++    V + ++ D+   + D
Sbjct: 1   MFRLAHISDVHLGPLPDVSYRDLASKRVLGYVNWQRNRRRHMHDAVIDTIVADVKAQSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   + EI  + HWL ++G P D+S+VPGNHDAY+ GA +K   +W  +++
Sbjct: 61  HLAVTGDLVNLALDGEIEMARHWLETLGPPQDVSVVPGNHDAYVPGAFDKVCRSWAAWMS 120

Query: 127 SDT-TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D       +  FP+LR+R N+ALIG STA AT PF ANG+F + QA    K+LR    +
Sbjct: 121 GDGINTPVDRNAFPFLRVRGNVALIGVSTARATAPFMANGFFMEGQADRLGKILRDTGGQ 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR IM+HHPPV      + R+FGI RF K+I   GA+L+LHGH+HL SL  I      
Sbjct: 181 GLFRAIMIHHPPVRGAVPQHKRLFGIARFHKIIRRHGAELVLHGHSHLPSLFQIGVRGAK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
           +PVVG+A+A Q      P A YNLF I+ + + W +   R  L+  ++
Sbjct: 241 VPVVGVAAAGQAPGGKHPAAQYNLFDIDGEKDNWRIRLTRRGLTGPAI 288


>gi|86358665|ref|YP_470557.1| putative phosphatase protein [Rhizobium etli CFN 42]
 gi|86282767|gb|ABC91830.1| putative phosphatase protein [Rhizobium etli CFN 42]
          Length = 312

 Score =  361 bits (928), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 145/300 (48%), Positives = 203/300 (67%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 11  MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFASTLDLLLDDIRTHRAD 70

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G+P D S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 71  HLAVTGDLVNLASGIEIRAAAAWLRALGDPADTSVVPGNHDAYVPGAYEKSMRAWYDYVR 130

Query: 127 SDTTCS---TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         +++FPYLR+R+ +A++GCSTA+ATPPF+A+G+F   QA  T  +LR A 
Sbjct: 131 GDLAPPQWQEDRRIFPYLRVRDKVAIVGCSTAVATPPFAASGFFSARQARDTVNMLRAAG 190

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ + RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 191 EAGLFRVVMIHHPPIRGATAFHKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 250

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  +  DIF
Sbjct: 251 QPVPVVGIASASQGPGSIKPPAAYNLFSIDGAPGAWELTGERFSLNRTGDAMMPESVDIF 310


>gi|209550379|ref|YP_002282296.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536135|gb|ACI56070.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 302

 Score =  360 bits (925), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 146/300 (48%), Positives = 205/300 (68%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G+P D S+VPGNHDAY+ GA EKS+ AW +Y+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRALGDPADTSVVPGNHDAYVPGAYEKSMRAWYEYVR 120

Query: 127 SDTTCS---TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D +       + +FPYLRIR+ +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLSPPQWQEDRHIFPYLRIRDKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 181 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++++    ++  + +DIF
Sbjct: 241 QPVPVVGIASASQGPGSIKPPAAYNLFSIDGSPGAWELSGERFSVNRSGDAVMAESADIF 300


>gi|328542773|ref|YP_004302882.1| Ser/Thr protein phosphatase family protein [polymorphum gilvum
           SL003B-26A1]
 gi|326412519|gb|ADZ69582.1| Ser/Thr protein phosphatase family protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 308

 Score =  358 bits (920), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 111/299 (37%), Positives = 163/299 (54%), Gaps = 7/299 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH SD HL     P   +L  KRI+G VNW  NR +  S +    L++D+     D
Sbjct: 1   MFRLAHFSDPHLGPLPDPRLSQLLSKRILGYVNWRRNRARAMSGDFLVRLLDDMRAAAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV++TGD+VN     EI  +  WL S+  P D+S+VPGNHDAY+ GA + +L AW+ Y+T
Sbjct: 61  HVALTGDLVNIALPLEIEAARAWLESLSAPDDLSLVPGNHDAYVPGALKSALEAWRPYMT 120

Query: 127 SDTTCSTGKK----LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
            D   +         FP++R R+ IA++G STA A+ P+ A G  G  QA    + L + 
Sbjct: 121 GDARPALEPHGHQVQFPFVRKRDGIAIVGVSTARASAPWLATGKIGIAQARRLEEALARL 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +G FR++M+HHPP    ++ + R+    R +  I   GA+L+LHGHTH++S   +K  
Sbjct: 181 GAEGLFRVVMIHHPPFRKATAWHKRLQDASRVRAAIRKAGAELVLHGHTHVDSRETLKGP 240

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIE-KKNEYWTLEGKRYTLSPDSLSIQKDYS 300
              IPV+G+ SA+      KP A YNLF I  + +  W+        +    +I+    
Sbjct: 241 DGPIPVIGVPSATNAPGGRKPGARYNLFDIAPRDSGGWSCHLTERGFTAPGRAIETIAD 299


>gi|75676818|ref|YP_319239.1| metallophosphoesterase [Nitrobacter winogradskyi Nb-255]
 gi|74421688|gb|ABA05887.1| metallophosphoesterase [Nitrobacter winogradskyi Nb-255]
          Length = 301

 Score =  358 bits (918), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 100/301 (33%), Positives = 157/301 (52%), Gaps = 5/301 (1%)

Query: 10  FVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
             LAH+SD HL   P     +L+ KR IG +NW   R     ++V + L+ DI   + DH
Sbjct: 4   LTLAHLSDPHLGPLPPLRLHQLAGKRAIGYLNWKRGRHAIHRRDVLDALVADIKAQSPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD++N     E   +  WL  +G PH++++VPGNHDAY+    +K +  W+DY+  
Sbjct: 64  IAVTGDLINLALPDEFTQARAWLSQVGAPHNVTLVPGNHDAYVR-PTQKQISEWEDYMRG 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FP+LR R  + LIG S+++ T PF A G  G +Q  A  + L +      
Sbjct: 123 DNAGEGTPLSFPFLRRRGPLTLIGASSSVPTRPFMATGRLGPKQLDALDRGLSQLESDPN 182

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L +   Y R+        ++   G +LILHGH H++S  W    +  IP
Sbjct: 183 FRVLLIHHP--LSSKDSYKRLTDADALLDLLKRRGVNLILHGHDHIHSTMWFDGPQGRIP 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTL 307
            +G+ SAS   H + P A+YNLF I      W  E +    +  +   +K+ S++    L
Sbjct: 241 AIGVPSASAMPHRHYPPAAYNLFSITPDGNGWRCEQQVRGFADQAAIERKEVSELQRTQL 300

Query: 308 V 308
           +
Sbjct: 301 I 301


>gi|114705049|ref|ZP_01437957.1| hypothetical protein FP2506_08931 [Fulvimarina pelagi HTCC2506]
 gi|114539834|gb|EAU42954.1| hypothetical protein FP2506_08931 [Fulvimarina pelagi HTCC2506]
          Length = 311

 Score =  356 bits (915), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 125/283 (44%), Positives = 176/283 (62%), Gaps = 3/283 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH+SDIHL   P  S  EL+ KR+ G VNWH NR++    +    L+ D+     D
Sbjct: 1   MFRLAHLSDIHLGPLPELSLRELASKRVTGYVNWHRNRRRSMFGDTLTDLVLDMKHQRPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN    +E   +  WL  +G PHD+S+VPGNHDAY+ GA ++S H W DY+ 
Sbjct: 61  HIAVTGDLVNLATKKETVAARIWLEQLGVPHDVSLVPGNHDAYVPGALKRSFHEWHDYLI 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   +     FPYLR+R  IA+ G STA A+ PF A G F + QA A +KLL      G
Sbjct: 121 GDNPLAAIGNSFPYLRVRGKIAIFGVSTAEASAPFFATGSFRRGQALALAKLLESCRSTG 180

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK-KL 245
            FR++++HHPP+   +S + R+ G Q F K+I   GA+L+LHGHTHL++L+W++    + 
Sbjct: 181 HFRVVLIHHPPISGAASWHKRLIGKQFFSKVIRDVGAELVLHGHTHLDTLYWLEGPGHRK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           +PVVG+ SASQ   S KP A YNLF I+ +   W+L  +   +
Sbjct: 241 VPVVGVPSASQSPGSEKPAARYNLFEIDGEPGNWSLTQRERGM 283


>gi|163867927|ref|YP_001609131.1| hypothetical protein Btr_0711 [Bartonella tribocorum CIP 105476]
 gi|161017578|emb|CAK01136.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 296

 Score =  356 bits (914), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 125/289 (43%), Positives = 176/289 (60%), Gaps = 3/289 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P  S FELS KR+ G +NW   RK   +  V   LI+ +     D
Sbjct: 1   MFYLAHISDVHLSPLPKPSLFELSGKRLTGYLNWQKKRKNQITINVLETLIDALNQKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN   ++E   +  WL ++G P DIS+  GNHDAY+ GA +K+   +K +IT
Sbjct: 61  HLVISGDLVNLALDKEFEQAHRWLLNLGQPQDISLTFGNHDAYVRGALQKACTLFKPWIT 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D    +    FPY+RIR ++A+I  S+AIATPPF A+GYFG+ QA     LL +A ++ 
Sbjct: 121 GDVPQKSVFP-FPYMRIRKDVAIIAASSAIATPPFHASGYFGKMQAQMLPHLLNEAAQRN 179

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP    +S + ++   +RF  +I H G +LILHGHTHL +L + +   K I
Sbjct: 180 LFRVVMIHHPPFPKATSWHKKLRDTKRFLNVIKHHGCELILHGHTHLPTLKYTEGPTKKI 239

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           P+VG+ SASQ     KP A +NLF IE     W  + +RY++      I
Sbjct: 240 PIVGVPSASQAFGDKKPPAGFNLFSIEHLRNQWHCQLQRYSIITPQNEI 288


>gi|319781807|ref|YP_004141283.1| metallophosphoesterase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167695|gb|ADV11233.1| metallophosphoesterase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 307

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 128/288 (44%), Positives = 180/288 (62%), Gaps = 3/288 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S+ +L+ KR++G VNW  NR+++    V + ++ DI  +  D
Sbjct: 1   MFRLAHISDVHLGPLPDVSYRDLASKRVLGYVNWQRNRRRHMHDAVIDTIVADIKANTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   + EI  + HWL ++G PHD+S+VPGNHDAY+ GA +K   +W  +++
Sbjct: 61  HLAVTGDLVNLALDGEIEMARHWLETLGPPHDVSVVPGNHDAYVPGAFDKVCRSWAAWMS 120

Query: 127 SDT-TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D       +  FPYLR+R N+ALIG STA AT PF ANG+F + Q     K+L+    +
Sbjct: 121 GDGVNTPVDRNAFPYLRVRGNVALIGVSTARATAPFMANGFFMEGQGDRLGKILQDTAGQ 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR+IM+HHPPV      + R+FGI RF K+I   GADL+LHGH+HL SL +I      
Sbjct: 181 GLFRVIMIHHPPVRGAVPQHKRLFGIARFNKIIRRHGADLVLHGHSHLPSLFFIGGRGVR 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
           IP VG+A+A Q      P A YNLF I+ +   W +   R  L+  S+
Sbjct: 241 IPAVGVAAAGQAPGGKHPAAQYNLFDIDGEKGNWRIRLTRRGLTGPSI 288


>gi|92118726|ref|YP_578455.1| metallophosphoesterase [Nitrobacter hamburgensis X14]
 gi|91801620|gb|ABE63995.1| metallophosphoesterase [Nitrobacter hamburgensis X14]
          Length = 318

 Score =  348 bits (892), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 101/301 (33%), Positives = 156/301 (51%), Gaps = 5/301 (1%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL+  P  +  +L+ KR +G +NW  +R     ++V + L+ D+     DH
Sbjct: 21  FTLAHLSDPHLAPLPAPNLHQLAGKRALGYLNWKRSRHAIHRRDVLDALVADVRAQAPDH 80

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           ++ITGD+VN     E   +  WL S+G P D+++VPGNHDAY+    +K    W  Y+  
Sbjct: 81  IAITGDLVNLALPDEFTRARAWLESVGAPADVTVVPGNHDAYVR-VTKKQTSEWAGYLHG 139

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D   +     FP+LR R  + LIG S+A+ T PF A G  G+ Q  A  +   +      
Sbjct: 140 DGAEAGAPLAFPFLRRRGPLTLIGVSSAVPTAPFMATGTLGRAQLDALDRGFSQLASDPN 199

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L + S Y R+        ++   G DLILHGH H++S  W +     IP
Sbjct: 200 FRVLLVHHP--LSSKSSYKRLTDADALLTILGRHGVDLILHGHDHIHSTMWFEGPHGRIP 257

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTL 307
            VG+ SAS   + + P A+YNLF I +  + W  E +       +     +  ++    L
Sbjct: 258 AVGVPSASAVPYRHYPAAAYNLFSITRDGDAWRCEQRVRGFVNSAEGESAEVRELQRIRL 317

Query: 308 V 308
           +
Sbjct: 318 I 318


>gi|319408922|emb|CBI82579.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 294

 Score =  345 bits (886), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 122/289 (42%), Positives = 190/289 (65%), Gaps = 5/289 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS    PS  EL  KR+ G  NW   RK   +  V + L++ +     +
Sbjct: 1   MFYLAHISDVHLSPLPQPSLSELFGKRLTGYFNWQKKRKSQMTTSVLDTLMHALKKEKPN 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   +  WL + G+P +IS+  GNHDAY+ GA +K+  A++ +IT
Sbjct: 61  HLVISGDLVNLSLDKEFEQACRWLCAQGHPENISLTLGNHDAYVRGAFQKACIAFQPWIT 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   +    +FPY+R+R+N+A+I  S+AIATP F A GYF + QA   S+LL +A  + 
Sbjct: 121 GDIPQN---NVFPYMRVRDNVAIISASSAIATPFFQAAGYFDKMQAQTLSQLLNEAAARD 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FRI+M+HHPP  + +S Y +++GI++F  +I H G +LILHGHTHL +L++I+ + K +
Sbjct: 178 LFRIVMIHHPPFHNATSWYKKLWGIEKFLDVIKHHGCELILHGHTHLPTLNFIEGKMKKV 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           P+VG++SASQ   S KP A++NLF IE+ ++ W  + +R+++   +  I
Sbjct: 238 PIVGVSSASQAFGSKKPPANFNLFAIERSHQQWHCQLQRHSIITQNNEI 286


>gi|304393664|ref|ZP_07375592.1| metallophosphoesterase [Ahrensia sp. R2A130]
 gi|303294671|gb|EFL89043.1| metallophosphoesterase [Ahrensia sp. R2A130]
          Length = 309

 Score =  343 bits (881), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 118/301 (39%), Positives = 163/301 (54%), Gaps = 8/301 (2%)

Query: 9   MFVLAHISDIHLSYSPSFFE--LSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P F    L  KR++G  NW  NRK      V   LI+  L  N D
Sbjct: 1   MFKLAHISDVHLGPLPPFKRSALLSKRVLGYANWRLNRKGDLHSGVLGNLIDHTLATNPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN     EI     WL  +G P DIS++PGNHD Y+ GA  + +  WK ++ 
Sbjct: 61  HLAITGDLVNLALPEEIELIHQWLTGLGAPEDISVIPGNHDTYVPGALRRIIERWKPWMQ 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D         FPY R R  +ALIG ++  AT PF A G +  +Q   TS++L++A   G
Sbjct: 121 GDKP--VAGNPFPYRRDRGAVALIGTNSGRATAPFLATGSWRAQQDSDTSEMLQRAKADG 178

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP  + ++ + R+ G +RF++MI  EGA+LILHGHTH+ S   I      +
Sbjct: 179 QFRVVMIHHPPFPNATAQHKRLIGAKRFRRMIAREGAELILHGHTHIVSDERIDGPDGPV 238

Query: 247 PVVGIASASQKVHS----NKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
           PV+G+ SAS          +P A YNLF I      W    +++        I +   DI
Sbjct: 239 PVIGVPSASHGPRLTPSIGRPGARYNLFEISGNQGAWRCRQQQFGYGDGQQKISELADDI 298

Query: 303 F 303
            
Sbjct: 299 I 299


>gi|90422893|ref|YP_531263.1| metallophosphoesterase [Rhodopseudomonas palustris BisB18]
 gi|90104907|gb|ABD86944.1| metallophosphoesterase [Rhodopseudomonas palustris BisB18]
          Length = 298

 Score =  342 bits (877), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 100/296 (33%), Positives = 158/296 (53%), Gaps = 6/296 (2%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           +F LAH+SD HL   P  +  EL+ KRI+G +NW  NR     ++V + L+ D+  H  D
Sbjct: 3   VFTLAHLSDPHLPPMPVATLRELAGKRILGYLNWTKNRHAIHRRDVLDALMADLRAHRPD 62

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN    +E   +  W+  +G P  +S++PGNHD Y+ G  E+    + DY++
Sbjct: 63  HIAVTGDLVNLALEQEFAPARRWIEQVGPPDRVSVIPGNHDRYVRGTAERFAETFPDYMS 122

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   +    +FP+LR R  + +IG STA+ T P  A G+ G+ Q  A    L   +   
Sbjct: 123 GDDRSNA--VVFPFLRRRGPLVIIGVSTAVPTAPLRATGWLGEAQRAALEAQLASLDGDP 180

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++++HHP  L + + + R+      Q ++   G DL+LHGH H++S  W+   +  I
Sbjct: 181 AFRVLLIHHP--LRSKARHKRLTDSAELQALLGRHGVDLVLHGHDHVHSTIWVDGPRAPI 238

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
           PVVG+ SAS     ++P A+YNLF I +  E W  +             Q     +
Sbjct: 239 PVVGVPSASAGPDGHRPPAAYNLFSIARDGERWRCDHTTRGFGDAPGITQLSAVRL 294


>gi|91978511|ref|YP_571170.1| metallophosphoesterase [Rhodopseudomonas palustris BisB5]
 gi|91684967|gb|ABE41269.1| metallophosphoesterase [Rhodopseudomonas palustris BisB5]
          Length = 292

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 100/298 (33%), Positives = 156/298 (52%), Gaps = 8/298 (2%)

Query: 8   IMFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + F LAH+SD HL   P     +L+ KR++G +NW  NR+    +++ + L+ D+     
Sbjct: 1   MTFTLAHLSDPHLPPLPKPRLADLANKRVLGYLNWTRNRQSIHRRDILDALVADLQAQTP 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGD+VN   + E   +  WL  +G P  +S+VPGNHDAY++    +    + DYI
Sbjct: 61  DHIAVTGDLVNIALDDEFAPARRWLDGVGPPERVSVVPGNHDAYVAATAPRFGETFADYI 120

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D     G   FPYLR R+ IA+IG S+A+ T PF A G+ G  Q      +L+    +
Sbjct: 121 RGDD----GATGFPYLRRRDRIAIIGVSSAVPTAPFMATGWLGDAQRARLETMLQSLASE 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             FR++++HHP  L + S + R+        ++     DL+LHGH H+++   I      
Sbjct: 177 RVFRVLLIHHP--LRSRSRFKRLTDSAELIALLQRHPVDLVLHGHDHVHATIRIDAPSGP 234

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           IPVVG+ SAS     ++P A+YNLF I + N+ W  E +               S + 
Sbjct: 235 IPVVGVPSASAFKDHHRPSAAYNLFAISEGNDGWRCEHRVRGFGATETITDLRDSRVL 292


>gi|85714290|ref|ZP_01045278.1| metallophosphoesterase [Nitrobacter sp. Nb-311A]
 gi|85698737|gb|EAQ36606.1| metallophosphoesterase [Nitrobacter sp. Nb-311A]
          Length = 301

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 96/301 (31%), Positives = 156/301 (51%), Gaps = 5/301 (1%)

Query: 10  FVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
             LAH+SD HL   P     +L+ KR IG +NW   R     ++V + L+ DI   + DH
Sbjct: 4   LTLAHLSDPHLGPLPPLRLHQLAGKRAIGYLNWKRGRHAIHRRDVLDTLVADIKAQSPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD++N     E   +  WL  +G PH++++VPGNHDAY+    +K +  W+DY+  
Sbjct: 64  IAVTGDLINLALPGEFTQARAWLGDVGTPHNVTLVPGNHDAYVR-PTQKQISEWEDYMRG 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D+        FP+LR R  + LIG S+++ T PF A G+ G  Q  A  + L +      
Sbjct: 123 DSAREGAPLSFPFLRRRGPLTLIGVSSSVPTGPFMATGWLGSSQLDALDRGLAQLESDPS 182

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           F ++++HHP  L +   + R+        ++     +LILHGH H++S  W + +   IP
Sbjct: 183 FHVLLIHHP--LSSKDSHKRLTDADALLALLKRRNVNLILHGHDHIHSTMWFEGQHGRIP 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTL 307
            +G+ SAS   H + P A+YNLF I      W  E +    +  +   + + S++    L
Sbjct: 241 AIGVPSASATPHRHYPPAAYNLFSITHDGSSWRCEHRVRGFADQAAIDRGEISELQRTQL 300

Query: 308 V 308
           +
Sbjct: 301 I 301


>gi|110634536|ref|YP_674744.1| metallophosphoesterase [Mesorhizobium sp. BNC1]
 gi|110285520|gb|ABG63579.1| metallophosphoesterase [Chelativorans sp. BNC1]
          Length = 307

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 128/302 (42%), Positives = 180/302 (59%), Gaps = 4/302 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH SDIHL   P  S+ EL  KRI G +NWH  R+      + +L+ NDIL    D
Sbjct: 1   MFRLAHFSDIHLGPLPELSYRELISKRITGYINWHRRRRVNLDNGIIDLISNDILASAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   +REI  +  WL S+G P DIS+VPGNHDAY+  A  K+  AW  Y+T
Sbjct: 61  HIALTGDLVNLALDREIEMAQLWLESLGTPADISVVPGNHDAYVPHALNKACRAWGAYMT 120

Query: 127 SDTTCS-TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           +D     T +  FPY+R+R  +A+IG S+A AT PF A+GYF +EQ     +LL +A  +
Sbjct: 121 ADGAEPITDRHQFPYMRVRGPVAIIGLSSARATAPFLASGYFTEEQESRACELLEEAADR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             FR++++HHPPV   +  + R+FGI RFQ M+   GA+L+LHGHTHL ++H I      
Sbjct: 181 KLFRVLLIHHPPVRGATGQHKRLFGISRFQSMVRKYGAELVLHGHTHLPTVHRIDGSNGA 240

Query: 246 -IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
            +PVVG+A+A Q   +  P A YNLF I      W ++  R  ++     + +  +    
Sbjct: 241 SVPVVGVAAAGQAHGAALPAAHYNLFEIMGAPGTWQVQLIRRGVAEPGGKVVQLSTQWLI 300

Query: 305 DT 306
            T
Sbjct: 301 ST 302


>gi|27377568|ref|NP_769097.1| hypothetical protein bll2457 [Bradyrhizobium japonicum USDA 110]
 gi|27350712|dbj|BAC47722.1| bll2457 [Bradyrhizobium japonicum USDA 110]
          Length = 293

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 104/282 (36%), Positives = 149/282 (52%), Gaps = 8/282 (2%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P     EL+ KR+ G VNW  NR KY  +EV + L+ D+     DH
Sbjct: 4   FTLAHLSDPHLPPLPKPRLIELAGKRVFGYVNWTRNRHKYQRREVLDALVADVKAQAPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN   + E   +  WL  +G P  ++ +PGNHDAY+     +    +  Y+ S
Sbjct: 64  IAVTGDLVNLALDAEFAPARTWLDGVGPPDRVTTIPGNHDAYVRATYHRFGETFAPYLAS 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FP LR R  +ALI  STA+ T P  A G  G+ Q  A  ++L +   +  
Sbjct: 124 DN----GSAGFPALRRRGPLALISLSTAVPTLPLMATGTLGRAQLAALERVLERLATEDV 179

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L + + + RM        ++   G +L+LHGH H++S  W +     IP
Sbjct: 180 FRVLLVHHP--LKSDARHKRMTDAADLLALLKRHGVELVLHGHDHIHSTMWFEGPNGNIP 237

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
            +G+ SAS   H   P A+YNLF IEK N  W  E     L 
Sbjct: 238 AIGVPSASALAHGRYPAAAYNLFTIEKDNAGWRCEQTVRGLG 279


>gi|86751303|ref|YP_487799.1| metallophosphoesterase [Rhodopseudomonas palustris HaA2]
 gi|86574331|gb|ABD08888.1| Metallophosphoesterase [Rhodopseudomonas palustris HaA2]
          Length = 292

 Score =  334 bits (857), Expect = 9e-90,   Method: Composition-based stats.
 Identities = 101/298 (33%), Positives = 157/298 (52%), Gaps = 8/298 (2%)

Query: 8   IMFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + F LAH+SD HL   P     +L+ KR++G +NW  NR     +++ + L+ D+     
Sbjct: 1   MTFTLAHLSDPHLPPLPKPRLADLASKRLLGYLNWTRNRHNIHRRDILDALVADLQAQRP 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGD+VN     E   +  WL S+G P  +S+VPGNHDAY++         + DYI
Sbjct: 61  DHIAVTGDLVNIALAEEFPPARQWLDSVGPPDRVSLVPGNHDAYVAATAPLIAETFADYI 120

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D     G   FPYLR R+ +A+IG STA+ T PF A G+ G  Q      LL++ + +
Sbjct: 121 RGDD----GAAGFPYLRRRDAVAIIGVSTAVPTAPFMATGWLGDAQRARLETLLQRLDSE 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             FR++++HHP  L + S + R+        ++     DL+LHGH H+++   I   +  
Sbjct: 177 RAFRVLLIHHP--LRSRSRHKRLTDSAELIALLQRHPVDLVLHGHDHVHATIRIDTPRGP 234

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           IPVVG+ SAS     ++P A+YNLF I + N+ W  E +               + + 
Sbjct: 235 IPVVGVPSASAFNDHHRPSAAYNLFAISEANDGWRCEHRIRGFGDTETITDLQDARLL 292


>gi|115523419|ref|YP_780330.1| metallophosphoesterase [Rhodopseudomonas palustris BisA53]
 gi|115517366|gb|ABJ05350.1| metallophosphoesterase [Rhodopseudomonas palustris BisA53]
          Length = 299

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 97/295 (32%), Positives = 151/295 (51%), Gaps = 5/295 (1%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD+HL   P     EL+ KR++G +NW  NR     +EV + L+ D+L    D 
Sbjct: 4   FTLAHLSDVHLPPLPAVRPLELANKRVLGYLNWKKNRHTIHRREVLDSLVADMLAQAPDQ 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN    +E      WL S+G P  +++VPGNHDAY+   + +       ++  
Sbjct: 64  IAVTGDLVNLALEQEFSPVAAWLDSVGPPDRVTVVPGNHDAYVRSTQHRFAETLHPFLRG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FP+LR R  +ALIG S+A+ T P  A G  G+ Q  A  +LL +   +  
Sbjct: 124 DDAGE-GVVRFPFLRRRGPLALIGLSSAVPTAPLMAVGRLGEAQLAALEQLLAQLAGEDS 182

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L + S    +        ++   G  L+LHGH H+++  W++     IP
Sbjct: 183 FRVLLVHHP--LTSRSRQKWLADAPELLALLRRCGVHLVLHGHDHVHATVWVEGPTAPIP 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
           V+G+ SAS     + P A YNLF + + N+ W                + D  D+
Sbjct: 241 VIGVPSASAMASGHHPGAGYNLFSVHRDNDAWRCTHTIRGFGESGGMSELDRVDL 295


>gi|148253756|ref|YP_001238341.1| putative metallo-phosphoesterase [Bradyrhizobium sp. BTAi1]
 gi|146405929|gb|ABQ34435.1| putative metallo-phosphoesterase [Bradyrhizobium sp. BTAi1]
          Length = 297

 Score =  331 bits (848), Expect = 1e-88,   Method: Composition-based stats.
 Identities = 99/290 (34%), Positives = 164/290 (56%), Gaps = 6/290 (2%)

Query: 10  FVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL+  P     EL+ KR +G +NW  NR KY  +++ +LL++D+     D 
Sbjct: 5   FTLAHLSDPHLAPLPRPRLAELAGKRALGYLNWTRNRYKYHRRDILDLLVSDLHTQMPDQ 64

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VNF    E   +  WL+++G P  ++ +PGNHDAY+   + +   ++  Y   
Sbjct: 65  IAVTGDLVNFALESEFPLAQAWLKTVGPPDKVTAIPGNHDAYVRSTRLRFAESFAAYFGG 124

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FP LR R  +ALI  S+A+ + PF A G  G  Q  A  +LL+    +  
Sbjct: 125 DAPQE-GPATFPSLRRRGPLALISLSSAVPSGPFMATGRLGSAQLAALEQLLQSIAHEQL 183

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L +++   R+   +    ++   G +LILHGH H++S  WI   ++ IP
Sbjct: 184 FRVLLVHHP--LRSANRMKRLTDAKDLIALLARHGVELILHGHDHVHSTIWIDGPERKIP 241

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
            VG+ SAS   H + P A+YN+F I +   +W  +    +++ D+L +++
Sbjct: 242 TVGVPSASSIAHGHYPAAAYNIFAISRAGNHWRCDMTVRSVN-DALRVRE 290


>gi|154245314|ref|YP_001416272.1| metallophosphoesterase [Xanthobacter autotrophicus Py2]
 gi|154159399|gb|ABS66615.1| metallophosphoesterase [Xanthobacter autotrophicus Py2]
          Length = 301

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 105/300 (35%), Positives = 153/300 (51%), Gaps = 6/300 (2%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           M+VLAH+SD HL   P     EL  KR  G++NW   R++ F       LI D+L    D
Sbjct: 1   MYVLAHLSDPHLGPIPEARISELLGKRFFGMMNWIGARRRNFGAATLAPLITDLLAQAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ +TGD+VN +   E  T   +L S+G P  +S+VPGNHDAY+  A    L  W  ++ 
Sbjct: 61  HICVTGDLVNVSLPAEFDTGATFLASLGAPDKVSVVPGNHDAYVRSAMHYHLEHWAPFLA 120

Query: 127 SD---TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D          + FPY+R R  +A++G STA+ T  F A+G  G+ Q      LL +  
Sbjct: 121 GDNTHPHTPVDVEAFPYVRRRGAVAVVGVSTAVPTAVFLASGEMGRAQRARLKTLLEQLK 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV      +  +    + + ++   GA+L+LHGH H  SL  I+   
Sbjct: 181 AEGLFRVVMIHHPPV-GERPFHRDLRDAAKVRAVLAEAGAELVLHGHDHRASLGQIEAAG 239

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            LIPVVG+ SAS    S +    Y L+ I      W  + +R   + D  S+Q     + 
Sbjct: 240 GLIPVVGVPSASAGPASERGPGGYCLYRISGGPGAWRCDMERRGYAKDVTSVQSLTRQVL 299


>gi|323137673|ref|ZP_08072749.1| metallophosphoesterase [Methylocystis sp. ATCC 49242]
 gi|322396970|gb|EFX99495.1| metallophosphoesterase [Methylocystis sp. ATCC 49242]
          Length = 293

 Score =  329 bits (845), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 102/297 (34%), Positives = 157/297 (52%), Gaps = 6/297 (2%)

Query: 8   IMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + F+LAH+SD H+     P+  EL  KR+ G VNW + R       V + L+ D+     
Sbjct: 1   MTFLLAHLSDAHIGPIPRPNLAELLGKRVTGYVNWLYKRAGQHDMGVLSRLVEDMKAQKP 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV +TGDIVN     EI  +  WL S+G P ++S  PGNHDAY++ A +     +  + 
Sbjct: 61  DHVLMTGDIVNIGLPAEIALARDWLASLGGPEEVSYTPGNHDAYVADATQLVHEVFAPWT 120

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             +T  +     FPYLR R  +ALIG  + + T PF A+G  G+EQ  A   LL +   +
Sbjct: 121 AGETAAAG----FPYLRRRGGVALIGLDSGVPTGPFIASGRLGEEQLSALGALLEQTKTE 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G  R++ +HHPP +  + +   +     F+ +I   GA+L+LHGH H  SL  I      
Sbjct: 177 GLARVVFLHHPPHVGGARILRGLDDAAAFEDVIARHGAELVLHGHNHKPSLAHIAGPLAA 236

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
            PVVG+ASAS +   + P A+YNL+ I ++ +   +  ++  L+     ++    D+
Sbjct: 237 APVVGVASASARPGGHYPAAAYNLYSIGREGDRLRINMRQRGLNEAGEIVEMAAVDL 293


>gi|316935907|ref|YP_004110889.1| metallophosphoesterase [Rhodopseudomonas palustris DX-1]
 gi|315603621|gb|ADU46156.1| metallophosphoesterase [Rhodopseudomonas palustris DX-1]
          Length = 293

 Score =  329 bits (844), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 97/289 (33%), Positives = 152/289 (52%), Gaps = 8/289 (2%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           +F LAH+SD HL   P      L+ KR +G +NW  NR +   +++ + L+ D+     D
Sbjct: 3   VFTLAHLSDPHLPLPPKTGLRHLASKRALGYLNWRRNRHQIHRRDILDRLVADLQAQQPD 62

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD++N     E   +  WL S+G    +S+VPGNHDAY+     +    + DYI+
Sbjct: 63  HIAVTGDLMNIALLNEFAPARQWLESVGPADRVSLVPGNHDAYVRSTAHRFAETFPDYIS 122

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D         FPYLR R  IA+IG S+A+ T P  A G+ G  Q  A   LL+  + + 
Sbjct: 123 GDDAVPG----FPYLRRREGIAIIGVSSAVPTAPLRATGWLGAAQRAALETLLQSLSGER 178

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            F+++++HHP  L + S + R+        ++     DL+LHGH H+++   I+     I
Sbjct: 179 VFKVLLIHHP--LQSRSRHKRLTDSAELIALLQRHPVDLVLHGHDHVHATVRIETPSGAI 236

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           PVVG+ SAS     ++P A+YNLF I + N+ W  E +          +
Sbjct: 237 PVVGVPSASAMNDRHRPSAAYNLFKISEGNDGWRCEHRVRGFQASEQIV 285


>gi|163758543|ref|ZP_02165630.1| hypothetical protein HPDFL43_14007 [Hoeflea phototrophica DFL-43]
 gi|162283833|gb|EDQ34117.1| hypothetical protein HPDFL43_14007 [Hoeflea phototrophica DFL-43]
          Length = 291

 Score =  329 bits (843), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 122/274 (44%), Positives = 165/274 (60%), Gaps = 1/274 (0%)

Query: 22  YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNR 81
              S  EL+ KRI G +NW  NR+K+        L++ +     DHV+ITGD+VN     
Sbjct: 5   PRVSPAELASKRITGYLNWQRNRRKHLFGNTLEQLLDGMRAEAPDHVAITGDLVNLATRT 64

Query: 82  EIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYL 141
           EI  +  WL +  +P + + VPGNHDAY+ GA  +S  AW+ +I SD   S G KLFP  
Sbjct: 65  EIEAARLWLETHFDPANATFVPGNHDAYVPGAFARSTEAWEPWIASDNPASQG-KLFPNC 123

Query: 142 RIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDT 201
           R R  +ALIG STA AT PF A G FG +QA A  KLL +A+  G FR++M+HHPPV   
Sbjct: 124 RRRGPVALIGLSTANATLPFMATGDFGHKQAIAAGKLLDQAHDDGLFRVLMIHHPPVRGA 183

Query: 202 SSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSN 261
           +  + RM G   F KM+   GA+L+LHGHTHL++LH++      +PVVGIASASQ   S+
Sbjct: 184 TRWHKRMRGTGHFSKMLKLHGAELVLHGHTHLDTLHYLAGRHGDVPVVGIASASQGPDSH 243

Query: 262 KPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           +P A +N+F I+   + W L  +R  LS D   +
Sbjct: 244 RPTAGFNMFEIDGDRDTWKLVHRRMKLSGDGAGL 277


>gi|146339005|ref|YP_001204053.1| putative metallo-phosphoesterase [Bradyrhizobium sp. ORS278]
 gi|146191811|emb|CAL75816.1| putative metallo-phosphoesterase [Bradyrhizobium sp. ORS278]
          Length = 295

 Score =  329 bits (843), Expect = 4e-88,   Method: Composition-based stats.
 Identities = 99/296 (33%), Positives = 161/296 (54%), Gaps = 7/296 (2%)

Query: 10  FVLAHISDIHLSYS--PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL+    P   EL+ KR +G +NW  NR KY   ++ +LLI+D+     D 
Sbjct: 5   FTLAHLSDPHLAPQHRPRLSELAGKRALGYLNWTRNRYKYHRLDILDLLISDLHAQMPDQ 64

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VNF    E   +  WLR++G P  ++ +PGNHDAY+   + +   ++  Y   
Sbjct: 65  IAVTGDLVNFALESEFPVAQAWLRTVGPPDKVTAIPGNHDAYVRSTRLRFAESFAAYFGG 124

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D   + G   FP LR R  +ALI  S+A+ + PF A G  G  Q  A  +LL+    +  
Sbjct: 125 D---AEGPATFPSLRRRGPLALISLSSAVPSAPFMATGRIGSAQLAALEQLLQSIAHEPL 181

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP  L +++   R+   +    ++   G +L+LHGH H++S  WI   ++ IP
Sbjct: 182 FRVLLVHHP--LRSANRMKRLIDSKELIALLARHGVELVLHGHDHVHSTIWIDGPERKIP 239

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           VVG+ SAS   H + P A+YN+F I  +  +W  +    +++      +     + 
Sbjct: 240 VVGVPSASSLAHGHTPAAAYNIFAIAAEGNHWRCDMTVRSVNDARRVREIRQIRLL 295


>gi|158422516|ref|YP_001523808.1| putative phosphohydrolase [Azorhizobium caulinodans ORS 571]
 gi|158329405|dbj|BAF86890.1| putative phosphohydrolase [Azorhizobium caulinodans ORS 571]
          Length = 322

 Score =  328 bits (842), Expect = 6e-88,   Method: Composition-based stats.
 Identities = 101/298 (33%), Positives = 148/298 (49%), Gaps = 6/298 (2%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MFVLAH+SD HL   P     EL  KR  G++NW   R++ F       L+ D+     D
Sbjct: 22  MFVLAHLSDPHLGPIPEARLSELLGKRFFGMMNWIGARRRNFGASTLAPLMADLAAQAPD 81

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN +   E  T   +L S+G P  +S++PGNHDAY+  A    L  W  ++ 
Sbjct: 82  HIAVTGDLVNVSLPAEFDTGATFLASLGTPDKVSVIPGNHDAYVRSAMTYHLERWAPFLA 141

Query: 127 SD---TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D          + FPY+R R  IA++G STAI T  F A+G  G+ Q      LLR+  
Sbjct: 142 GDETHPGTPVDTEAFPYVRRRGPIAIVGVSTAIPTAVFLASGKAGKAQLERLRALLRQLK 201

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++++HHPPV +  S +  +      +  +   GA+L+LHGH H  SL  I+   
Sbjct: 202 AEGLFRVVLIHHPPVGERHS-HRDLRDAPAVRAALVEAGAELVLHGHDHRASLGHIEGVA 260

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
             IPVVG+ SAS      +    YNL+ I      W  + +    +     +      
Sbjct: 261 PPIPVVGVPSASAGPEDGRGAGRYNLYRISGGPGAWVCDMESRGYAKGETDVALRDQR 318


>gi|299134628|ref|ZP_07027820.1| metallophosphoesterase [Afipia sp. 1NLS2]
 gi|298590438|gb|EFI50641.1| metallophosphoesterase [Afipia sp. 1NLS2]
          Length = 298

 Score =  328 bits (841), Expect = 7e-88,   Method: Composition-based stats.
 Identities = 98/295 (33%), Positives = 149/295 (50%), Gaps = 6/295 (2%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P     EL  KR IG  NW   R     ++V   L+ D+   N DH
Sbjct: 4   FTLAHLSDPHLGPMPPARLTELLGKRAIGYANWKRRRHMIHRRDVLAQLLADLHAQNPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL SIG+ HD+S+VPGNHDAY   A+ +   +W DY+  
Sbjct: 64  IAVTGDLVNVALPAEFTQARAWLESIGSVHDVSLVPGNHDAYARVARGQFALSWADYMRG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FPYLR R  +ALIG +TA+ + PF A G  G+ Q  A   LL K   +  
Sbjct: 124 DDATEVG---FPYLRRRGPLALIGLTTAVPSAPFMATGRIGRAQLAALDSLLIKLKNEPL 180

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++++HHP          R+        ++   G DL+LHGH H ++  W++ ++    
Sbjct: 181 CRVVLVHHPLRSARGRWSARLTDAPALIDILTRHGVDLVLHGHDHRHATVWLQGQRGRFA 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEY-WTLEGKRYTLSPDSLSIQKDYSD 301
            +G+ SAS     +   A+Y L  I +K++  W +  +       +  + +  ++
Sbjct: 241 SIGVPSASASFGGHHQPAAYQLISIARKDDGTWNISRRVRGFGGTTDGVVELKNE 295


>gi|39937451|ref|NP_949727.1| metallophosphoesterase [Rhodopseudomonas palustris CGA009]
 gi|39651310|emb|CAE29832.1| Metallo-phosphoesterase [Rhodopseudomonas palustris CGA009]
          Length = 293

 Score =  327 bits (839), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 99/296 (33%), Positives = 151/296 (51%), Gaps = 8/296 (2%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P  S   L+ KR +G +NW  NR     +++ + L+ D+     DH
Sbjct: 4   FTLAHLSDPHLPLPPKTSLRHLASKRALGYLNWRRNRHLIHRRDILDTLVADLQAQQPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL S+G    +S+VPGNHDAY+     +    + DYI+ 
Sbjct: 64  IAVTGDLVNIALVNEFAPARQWLESVGPADRVSLVPGNHDAYVRSTAHRFAETFPDYISG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FPYLR R  IA+IG S+A+ T P  A G+ G  Q  A   LL+    +  
Sbjct: 124 DDATPG----FPYLRRREAIAIIGVSSAVPTAPLRATGWLGAPQRAALEALLQSLAGERV 179

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           F+++++HHP  L + S + R+        ++     DL+LHGH H+++   I      IP
Sbjct: 180 FKVLLIHHP--LQSRSRHKRLTDAADLIALLQRHPVDLVLHGHDHVHATVRIDTPFGAIP 237

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           VVG+ SAS     ++P A+YNLF I + N+ W  E +          +     ++ 
Sbjct: 238 VVGVPSASAMNDRHRPSAAYNLFKISEGNDGWRCEHRIRGFQASEQIVDLRAPELL 293


>gi|296445940|ref|ZP_06887891.1| metallophosphoesterase [Methylosinus trichosporium OB3b]
 gi|296256608|gb|EFH03684.1| metallophosphoesterase [Methylosinus trichosporium OB3b]
          Length = 293

 Score =  326 bits (835), Expect = 4e-87,   Method: Composition-based stats.
 Identities = 101/283 (35%), Positives = 148/283 (52%), Gaps = 7/283 (2%)

Query: 8   IMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + FVLAH+SD H+     PS  EL+ KR+ G  NW   R ++   +V   ++ DI     
Sbjct: 1   MAFVLAHLSDAHIGPIPQPSLRELAGKRMTGYANWLSKRAQFHDMDVLARIVADIAAQQP 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV +TGDIVN   + EI  +  WL ++G P  +S  PGNHDAY+  A  +    +  + 
Sbjct: 61  DHVVMTGDIVNIGLDAEIEAARDWLMTLGGPEQVSFTPGNHDAYVRAAVARVAETFAPWT 120

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           +S+         FPYLR R  IALIG  +A+ T PF A+G  G  Q      LL +  ++
Sbjct: 121 SSE-----AGAGFPYLRRRGGIALIGLDSAVPTAPFVASGRLGSAQLGRLGALLEQTREE 175

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G  R++++HHPP    +     +     F+  I   GA+L+LHGH H  S+H +      
Sbjct: 176 GLARVVLLHHPPHQGGAKPLRGLDDAGAFEATIARHGAELVLHGHNHAISVHRLPGRDGS 235

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
            PVVG ASAS K  ++   A+YNL+ IE+      + G+   +
Sbjct: 236 TPVVGTASASAKPGAHYRAAAYNLYSIERGERGVVVTGRSRGV 278


>gi|170744851|ref|YP_001773506.1| metallophosphoesterase [Methylobacterium sp. 4-46]
 gi|168199125|gb|ACA21072.1| metallophosphoesterase [Methylobacterium sp. 4-46]
          Length = 298

 Score =  324 bits (832), Expect = 7e-87,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 145/290 (50%), Gaps = 8/290 (2%)

Query: 9   MFVLAHISDIHLSYS--PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   RK      V   L+ D+     D
Sbjct: 1   MFRLAHLTDPHVGPLSRPRLRQLLSKRATGWVNWSRGRKLTHDMAVLEALVADLRAAAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ TGD+ N     E  T+  +L ++G P  +S VPGNHDAY+ G+ +  L A   +  
Sbjct: 61  HIACTGDLCNIGLPSEWETARMFLEALGGPEAVSFVPGNHDAYVRGSLDGLLDAVGPWTR 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   + G++ FPYLR R  +AL+G S+AI T PF A+G  G  Q  A   LL    ++ 
Sbjct: 121 DD---AGGERAFPYLRRRGPLALVGLSSAIPTAPFVASGRLGTRQIAAAEALLGSLAREP 177

Query: 187 --FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP +  +     +      + MI   GADL+LHGH H+ S+ ++     
Sbjct: 178 EAPCRVVMIHHPPHVGGALPGRNLTDASAVEAMIRRVGADLVLHGHNHVGSVAFVIGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
             +PV+G  SAS +  +    A Y+L+   +    + +      L PD  
Sbjct: 238 RRVPVIGAPSASARGGALSHCAGYHLYEFARTATGYAVTATLRGLLPDDR 287


>gi|209886135|ref|YP_002289992.1| metallophosphoesterase [Oligotropha carboxidovorans OM5]
 gi|209874331|gb|ACI94127.1| metallophosphoesterase [Oligotropha carboxidovorans OM5]
          Length = 300

 Score =  322 bits (826), Expect = 4e-86,   Method: Composition-based stats.
 Identities = 93/286 (32%), Positives = 143/286 (50%), Gaps = 6/286 (2%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P     EL  KR+IG  NW   R     ++V +LL+ D+     DH
Sbjct: 4   FTLAHLSDPHLGPMPPARLIELFGKRVIGYTNWKRRRHAIHRRDVLSLLLADLHAQRPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL ++G+  D+S+VPGNHDAY   A+ +   +W DY+  
Sbjct: 64  IAVTGDLVNVALPAEFTQARAWLETVGSAQDVSLVPGNHDAYARAARGQFALSWADYMRG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FPYLR R  +ALIG +TA+ + PF A G  G+ Q     +LL +   +  
Sbjct: 124 DGETEVH---FPYLRRRGPLALIGLTTAVPSAPFMATGRIGRAQLAGLDRLLARIATEPL 180

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++++HHP          R+        ++   G +L+LHGH H ++  W K  +    
Sbjct: 181 CRVVLIHHPLRSAPGRWSARLTDAPALIALLERHGVNLVLHGHDHRHATVWFKGSRGRFA 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKK-NEYWTLEGKRYTLSPDS 292
            +G+ SAS     +   A+Y L   E+   + WT+  +      D+
Sbjct: 241 SIGVPSASASTGGHHQAAAYQLISFEEDAAKGWTISRRVRGFGSDA 286


>gi|258593791|emb|CBE70132.1| putative metallo-phosphoesterase (modular protein) [NC10 bacterium
           'Dutch sediment']
          Length = 428

 Score =  321 bits (824), Expect = 6e-86,   Method: Composition-based stats.
 Identities = 84/294 (28%), Positives = 149/294 (50%), Gaps = 8/294 (2%)

Query: 4   RYTTIMFVLAHISDIHLS--YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL 61
           R    +F +AH+SD+HL+     +  +L  KR +G ++W   R+      + + L +D+ 
Sbjct: 94  RLMNGVFRVAHLSDLHLTSLVDVTIRDLLNKRALGYLSWRLRRRHEHVPAILDALRHDLS 153

Query: 62  LHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAW 121
               DH+ ITGD+ +     E   +  WL ++G P D++I+PGNHDAY+    + +   W
Sbjct: 154 GLTPDHIVITGDLTHIGLPSEFQQAQQWLETLGAPTDVTIIPGNHDAYVRAPWDDTFALW 213

Query: 122 KDYITSDTTCSTG------KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHAT 175
             Y+TSD    TG      +  FP +R+R ++ LIG ++A  + PF A G  G  Q    
Sbjct: 214 TPYMTSDPGSQTGGQQAPGESFFPSVRVRGHVVLIGATSARPSAPFFATGSLGTAQMARL 273

Query: 176 SKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNS 235
             LL    ++G FRI+++HHPP+        R+        ++   G ++I+HGH H + 
Sbjct: 274 GDLLDLTRRQGLFRILLIHHPPLAAIVQWRKRLTDGAALISLLARHGVEMIIHGHAHRSY 333

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
           +  I +    + V+G+ SAS +  + + +A+Y+++ +   +  W +       S
Sbjct: 334 VGHIPSAHGEMSVIGVPSASARGANPERRAAYHVYEVRPLSHGWEVRTSVRNYS 387


>gi|170747325|ref|YP_001753585.1| metallophosphoesterase [Methylobacterium radiotolerans JCM 2831]
 gi|170653847|gb|ACB22902.1| metallophosphoesterase [Methylobacterium radiotolerans JCM 2831]
          Length = 307

 Score =  320 bits (821), Expect = 1e-85,   Method: Composition-based stats.
 Identities = 102/295 (34%), Positives = 141/295 (47%), Gaps = 12/295 (4%)

Query: 8   IMFVLAHISDIHLSYS--PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + F LAH+SD H+         +L  KR  G  NW   R +     V   L+ D+     
Sbjct: 1   MTFRLAHLSDPHVGPLGRVRLRQLIGKRATGYANWRRGRSRSHDMTVLEALVTDLKAQGA 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
            HV+ TGD+ N     E  T+  +L ++G+P  +S VPGNHDAY+ G+ E  L A   Y 
Sbjct: 61  GHVACTGDLCNIGLPSEWETARTFLEALGSPEAVSFVPGNHDAYVRGSLEGLLAACGRYT 120

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D+        FPYLR R  +AL+G S+AI T PF A G  G  Q  A   LLR    +
Sbjct: 121 GDDSGSWGH---FPYLRRRGPLALVGLSSAIPTKPFVATGRLGASQLAAAETLLRALATE 177

Query: 186 G--FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
               FR++M+HHPP    +S    +     F  M+   GADLILHGH H+ S   I    
Sbjct: 178 PGRPFRVVMIHHPPQPGGASPGRELKDAAAFTAMVGRAGADLILHGHNHVTSTARIAGPD 237

Query: 244 KL-IPVVGIASASQKVHSNK----PQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
              +PV+G  SAS +   +      +ASY LF I +  + + +  +R  L     
Sbjct: 238 GRTVPVIGAPSASARPDGHGAIASRRASYLLFEIGRAEQGYAVTARRRGLDASGT 292


>gi|182680342|ref|YP_001834488.1| metallophosphoesterase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182636225|gb|ACB96999.1| metallophosphoesterase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 306

 Score =  319 bits (817), Expect = 5e-85,   Method: Composition-based stats.
 Identities = 103/299 (34%), Positives = 153/299 (51%), Gaps = 12/299 (4%)

Query: 8   IMFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + F+LAH+SD H+   P     EL  KR+ G +NW   R      E    L+ D+  H+ 
Sbjct: 1   MTFLLAHLSDPHIGPLPVPRRRELLGKRLTGYLNWQRGRSTAHDMETLGRLVADLKSHHP 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGDI+N     E      WL S+G P ++S VPGNHDAY+ GA       +K + 
Sbjct: 61  DHIAVTGDILNLGLAAEFPLGRLWLESLGQPENVSFVPGNHDAYVRGALPDLARTFKPWT 120

Query: 126 TSDTT--------CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSK 177
             +           S    L+PYLR R  +ALIG ++ +  PPF A+G  G++Q      
Sbjct: 121 AGEHPLGESLPFGQSMATALYPYLRRRGPVALIGLASGVPMPPFIASGRLGRQQLAGAET 180

Query: 178 LLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH 237
           LL++A  +   R+IM+HHPP  +       +   + F +MI   GA+LILHGH H  S+ 
Sbjct: 181 LLKEAAAQNCIRVIMLHHPPWAE-GKFGRGLVDARPFAEMIGRVGAELILHGHEHRPSVT 239

Query: 238 WIKNEKK-LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           ++   K   +P+VG+ SAS    S    A+Y+LF IE       ++   + L  D  +I
Sbjct: 240 YLTGPKGRRVPIVGVPSASLVRGSPYRYAAYHLFAIEGTGAEPRIKASAWGLLADGKTI 298


>gi|254562136|ref|YP_003069231.1| metallophosphatase/metallophosphoesterase [Methylobacterium
           extorquens DM4]
 gi|254269414|emb|CAX25380.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens DM4]
          Length = 315

 Score =  318 bits (815), Expect = 7e-85,   Method: Composition-based stats.
 Identities = 101/299 (33%), Positives = 146/299 (48%), Gaps = 8/299 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+   P     +L  KR  G VNW   R ++   ++   LI D+    VD
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQGVD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA--NK 184
           +D       +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR      
Sbjct: 121 ADDGQI---RLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPAQIEAAERVLRDLATAP 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I     
Sbjct: 178 DRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PVVG  SAS +      +ASY L+ +      + +      L       +    DI
Sbjct: 238 RPVPVVGAPSASARTLLTNRRASYYLYTVTPGENGFRIAVTERGLDEAGGIGELSGFDI 296


>gi|240139723|ref|YP_002964200.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens AM1]
 gi|240009697|gb|ACS40923.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens AM1]
          Length = 315

 Score =  317 bits (814), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 101/299 (33%), Positives = 146/299 (48%), Gaps = 8/299 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+   P     +L  KR  G VNW   R ++   ++   LI D+    VD
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQGVD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA--NK 184
           +D       +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR      
Sbjct: 121 ADDGQI---RLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPVQIEAAERMLRDLATAP 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I     
Sbjct: 178 DRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PVVG  SAS +      +ASY L+ +      + +      L       +    DI
Sbjct: 238 RPVPVVGAPSASARTLLTNRRASYYLYTVTPGENGFRIAVTERGLDEAGGIGELSGFDI 296


>gi|163852389|ref|YP_001640432.1| metallophosphoesterase [Methylobacterium extorquens PA1]
 gi|163663994|gb|ABY31361.1| metallophosphoesterase [Methylobacterium extorquens PA1]
          Length = 331

 Score =  317 bits (813), Expect = 1e-84,   Method: Composition-based stats.
 Identities = 101/299 (33%), Positives = 146/299 (48%), Gaps = 8/299 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+   P     +L  KR  G VNW   R ++   ++   LI D+    VD
Sbjct: 17  MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQGVD 76

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 77  HVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 136

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA--NK 184
           +D       +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR      
Sbjct: 137 ADDGQI---RLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPVQIEAAERVLRDLATAP 193

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I     
Sbjct: 194 DRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGPDG 253

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PVVG  SAS +      +ASY L+ +      + +      L       +    DI
Sbjct: 254 RPVPVVGAPSASARTLLTNRRASYYLYTVTPGENGFQIAVTERGLDEAGGIGELSGFDI 312


>gi|217978415|ref|YP_002362562.1| metallophosphoesterase [Methylocella silvestris BL2]
 gi|217503791|gb|ACK51200.1| metallophosphoesterase [Methylocella silvestris BL2]
          Length = 300

 Score =  317 bits (812), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 96/289 (33%), Positives = 152/289 (52%), Gaps = 6/289 (2%)

Query: 7   TIMFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
            ++F LAH++D H+   P     EL  KR+ G +NW   R         + ++ D+   N
Sbjct: 3   PVLFRLAHLTDPHIGPLPRPRRRELLGKRVTGYLNWRRGRHLVHDMATLSHIVADVKAQN 62

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGDI N     E   +  WL ++G   D+S VPGNHDAY+ G+      A+  +
Sbjct: 63  PDHIAMTGDIANIGLPAEFQLARKWLETLGPSEDVSFVPGNHDAYVRGSLPDLARAFAPW 122

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
            T +T        +PYLR+R N+ALIG S+A+ TP F A+G  G+ Q      +L     
Sbjct: 123 TTGETETPA---RYPYLRVRGNVALIGLSSAVPTPFFIASGRLGRRQLEWADAMLADCAT 179

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK-NEK 243
           +   R++M+HHPP +D + L   +   + F++MIW  GA+LILHGH H  S+ ++     
Sbjct: 180 RDLIRVVMLHHPPQVDAAGLARGLIDAREFEEMIWRRGAELILHGHNHKTSVTYLDAGRS 239

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
           +  PVVG  SAS    + + +A Y++F I    + + ++     + P  
Sbjct: 240 RKTPVVGAPSASSARLAARHRAGYHVFEIAGHLQDYEIKAYARGVLPTG 288


>gi|218531148|ref|YP_002421964.1| metallophosphoesterase [Methylobacterium chloromethanicum CM4]
 gi|218523451|gb|ACK84036.1| metallophosphoesterase [Methylobacterium chloromethanicum CM4]
          Length = 315

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 101/299 (33%), Positives = 146/299 (48%), Gaps = 8/299 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+   P     +L  KR  G VNW   R ++   ++   LI D+    VD
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQGVD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA--NK 184
           +D       +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR      
Sbjct: 121 ADDGQI---RLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPVQIEAAERVLRDLATAP 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I     
Sbjct: 178 DRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PVVG  SAS +      +ASY L+ +      + +      L       +    DI
Sbjct: 238 RPVPVVGAPSASARTLLTNRRASYYLYTVTPGENGFRIAVTERGLDEAGGIGELSGFDI 296


>gi|188582396|ref|YP_001925841.1| metallophosphoesterase [Methylobacterium populi BJ001]
 gi|179345894|gb|ACB81306.1| metallophosphoesterase [Methylobacterium populi BJ001]
          Length = 316

 Score =  316 bits (811), Expect = 2e-84,   Method: Composition-based stats.
 Identities = 104/299 (34%), Positives = 147/299 (49%), Gaps = 8/299 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+   P     +L  KR  G VNW   R  +   ++   LI D+     D
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRCHHHDMDLLGALIADLHGQGAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARLFLEALGPGERVSFVPGNHDAYVRGSLEGLLAACGGWTA 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK--ANK 184
           +D   S   +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  +LLR   A  
Sbjct: 121 ADDGQS---RLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGSVQIDAAERLLRDLAAAP 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP    ++    +     F  MI   GADLILHGH H+ S+  I     
Sbjct: 178 DRPCRVVMIHHPPHPGGAAAGRELKDAADFAAMIGRAGADLILHGHNHVGSVAQILGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PVVG  SAS +      +ASY L+ +   +  + +      L       +    DI
Sbjct: 238 RPVPVVGAPSASARTLLTNRRASYYLYTVTPHDSGYRIGVTERGLDEAGGIGELSGFDI 296


>gi|298292489|ref|YP_003694428.1| metallophosphoesterase [Starkeya novella DSM 506]
 gi|296929000|gb|ADH89809.1| metallophosphoesterase [Starkeya novella DSM 506]
          Length = 308

 Score =  313 bits (803), Expect = 2e-83,   Method: Composition-based stats.
 Identities = 101/307 (32%), Positives = 161/307 (52%), Gaps = 8/307 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MFVLAH++D HL   P   F EL+ KR +G++NW   R+  F+    +LL+ DI     D
Sbjct: 1   MFVLAHVTDAHLGPLPRARFAELAGKRALGVINWRRGRQHRFNIATIDLLVADIKAMAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     E  T  ++LRS+G+ HD+++VPGNHDAY+      SL  W DY+ 
Sbjct: 61  HIAVTGDLVNVGLAAEFATGLNFLRSLGDGHDVTVVPGNHDAYVRSTAHHSLLNWGDYMR 120

Query: 127 SDT--TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
            D      T ++ FP++R R+ +ALIG STA+ T PF A G  G+ Q     K+L +   
Sbjct: 121 GDGVNGDVTAEEAFPFVRRRDGVALIGVSTAVPTHPFMATGKVGKAQRARLGKVLDELAA 180

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK- 243
           +G FR++M+HHPP     + + R+   +  +++    GA+LI+ GH H+  +  +     
Sbjct: 181 EGLFRVVMIHHPP-CGWRAGHKRLIDEEAVREVFARHGAELIICGHDHVPMVEMLPGPHS 239

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY--WTLEGKRYTLSPDSLSIQKDYSD 301
            LIPVV   S +           Y+L+ IE+ +    W    +         ++      
Sbjct: 240 GLIPVVEAPSFAAGPDDRHWPGGYHLYRIERIDAAFPWRCTLEARGFQRGEANVATRTVR 299

Query: 302 IFYDTLV 308
           +  + + 
Sbjct: 300 VLTEAIS 306


>gi|220927299|ref|YP_002502601.1| metallophosphoesterase [Methylobacterium nodulans ORS 2060]
 gi|219951906|gb|ACL62298.1| metallophosphoesterase [Methylobacterium nodulans ORS 2060]
          Length = 298

 Score =  311 bits (796), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 99/290 (34%), Positives = 146/290 (50%), Gaps = 8/290 (2%)

Query: 9   MFVLAHISDIHLSYS--PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   R +     V   LI D+L    D
Sbjct: 1   MFRLAHLTDPHVGPLSKPRLRQLLSKRATGWVNWTRGRHRTHDMAVLEALIADLLAAAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ TGD+ N     E  T+  +L ++G P  +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HIACTGDLCNIGLPSEWETARVFLEALGGPEAVSFVPGNHDAYVRGSLEGLLGAVGPWTR 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN--K 184
            D   +  ++ FPYLR R  +AL+G S+AI T PF A+G  G  Q  A   LL       
Sbjct: 121 DD---AGRERAFPYLRRRGPLALVGLSSAIPTAPFVASGRLGSRQLAAAEALLGSLAREP 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +   R++M+HHPP +  +     +     F+ +I   GADL+LHGH H+ S+ ++     
Sbjct: 178 ERPCRVVMIHHPPHVGGALPGRNLTDSSAFEAVIRRVGADLVLHGHNHVGSVAFLIGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
             +PV+G  SAS +  +    A Y+L+  E+    + +      L PD  
Sbjct: 238 RRVPVIGAPSASARGGTLTHCAGYHLYGFERTATGYAVTATLRGLLPDER 287


>gi|301058950|ref|ZP_07199919.1| Ser/Thr phosphatase family protein [delta proteobacterium NaphS2]
 gi|300446946|gb|EFK10742.1| Ser/Thr phosphatase family protein [delta proteobacterium NaphS2]
          Length = 350

 Score =  310 bits (794), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 95/301 (31%), Positives = 151/301 (50%), Gaps = 8/301 (2%)

Query: 10  FVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           FVLAH+SD H++++      +L  KR+ G + W F R     +E+  +L  D+     DH
Sbjct: 28  FVLAHLSDPHMAWAGPVKKRDLLNKRLAGYLKWRFFRNTEHRREILTILKEDLDNTRPDH 87

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           + ITGD+ +     E   +  WL+S+G P  +++VPGNHDAY+    +++   W DY+ S
Sbjct: 88  IVITGDLTHLGLPAEFKKARTWLQSLGTPSQVTVVPGNHDAYVRSDWDRTFACWLDYMRS 147

Query: 128 DTTCSTGKK------LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
           D  C  G +      LFP LR+R  IALIG  +A  + P  A G  G  Q      +L++
Sbjct: 148 DPPCRNGGRVRGLDDLFPTLRVRGRIALIGLCSAHPSAPHLAIGTVGGPQLRKLETVLKQ 207

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
              +G FRI+ +HHPP+    S   R+      + ++   GA+L+LHGH H  +L+ +  
Sbjct: 208 TGDRGLFRIVAIHHPPLSGIVSRRKRLTDAHALRGVVARCGAELMLHGHAHRMALNTLDT 267

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
                PV G  SAS     ++ +A Y++F +        +   R   SPD+     +   
Sbjct: 268 RSGRTPVAGAPSASSSSSDHQRRARYHVFTLTASENACNVHMGRRVYSPDARCFIPEKGT 327

Query: 302 I 302
           +
Sbjct: 328 V 328


>gi|192293234|ref|YP_001993839.1| metallophosphoesterase [Rhodopseudomonas palustris TIE-1]
 gi|192286983|gb|ACF03364.1| metallophosphoesterase [Rhodopseudomonas palustris TIE-1]
          Length = 293

 Score =  306 bits (785), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 98/296 (33%), Positives = 152/296 (51%), Gaps = 8/296 (2%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P  S   L+ KR +G +NW  NR     +++ + L+ D+     DH
Sbjct: 4   FTLAHLSDPHLPLPPKTSLRHLASKRALGYLNWRRNRHLIHRRDILDTLVADLQAQQPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL S+G    +S+VPGNHDAY+     +    + DYI+ 
Sbjct: 64  IAVTGDLVNIALVNEFAPARQWLESVGPADRVSLVPGNHDAYVRSTAHRFAETFPDYISG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FPYLR R  IA+IG S+A+ T P  A G+ G  Q  A   LL+    +  
Sbjct: 124 DDATPG----FPYLRRRETIAIIGVSSAVPTAPLRATGWLGALQLAALEALLQSLAGERV 179

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           F+++++HHP  L + S + R+        ++     DL+LHGH H+++   I+     IP
Sbjct: 180 FKVLLIHHP--LQSRSRHKRLTDAADLIALLQRHPVDLVLHGHDHVHATVRIETPFGTIP 237

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           VVG+ SAS     ++P A+Y+LF I + N+ W  E +          +     ++ 
Sbjct: 238 VVGVPSASAMNDRHRPSAAYSLFKISEGNDGWRCEHRIRGFQASEQIVDLRAPELL 293


>gi|218509337|ref|ZP_03507215.1| putative phosphoesterase protein [Rhizobium etli Brasil 5]
          Length = 237

 Score =  305 bits (782), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 119/237 (50%), Positives = 161/237 (67%), Gaps = 5/237 (2%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR +G+P   S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRELGDPAHTSVVPGNHDAYVPGAYEKSMRAWYDYVR 120

Query: 127 SDTTCS---TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D         + +FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLAPPQWQEDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++
Sbjct: 181 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLR 237


>gi|300023904|ref|YP_003756515.1| metallophosphoesterase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525725|gb|ADJ24194.1| metallophosphoesterase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 301

 Score =  301 bits (772), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 97/301 (32%), Positives = 158/301 (52%), Gaps = 7/301 (2%)

Query: 6   TTIMFVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
            T  F LAH SD+H+S    F     + KR++G +NW   R++     VA+ LI D    
Sbjct: 1   MTETFTLAHFSDVHMSPVVGFGWRYWNAKRVLGYLNWQRKRRRVHVTAVADRLIADAHSL 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH++ITGD+VN     E   +  WLRS+G+P  +++VPGNHD Y S   ++ +  W  
Sbjct: 61  RPDHIAITGDLVNLGLPAEHEAALAWLRSVGSPASVTVVPGNHDIYSSMHGDRGVVRWAA 120

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           Y+  +         FP++R    +AL+G ++A+ TPPF A+G  G  Q     + L + +
Sbjct: 121 YMGGEEDTL----AFPFVRRVGPLALVGLNSAVETPPFFASGSLGSHQLEIAREQLLRLD 176

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G  R++++HHPP+ D ++   R+     F  ++   GA+L+L+GH H  ++ W+ + K
Sbjct: 177 EDGAIRVVLIHHPPLADMTTPRRRLNDAAHFAHLLERTGAELVLYGHNHTPAIDWLPSRK 236

Query: 244 KLIPVVGIASASQKV-HSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
           K IP++G ASAS    H ++P A YNLF   + +    +      L      + K   + 
Sbjct: 237 KPIPLIGAASASAGTEHGDEPLARYNLFTFFRSSSGLRIRHVVRGLETPDGPVTKLSENF 296

Query: 303 F 303
            
Sbjct: 297 L 297


>gi|330994317|ref|ZP_08318245.1| metallophosphoesterase [Gluconacetobacter sp. SXCC-1]
 gi|329758784|gb|EGG75300.1| metallophosphoesterase [Gluconacetobacter sp. SXCC-1]
          Length = 305

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 85/297 (28%), Positives = 143/297 (48%), Gaps = 14/297 (4%)

Query: 10  FVLAHISDIHLS---YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
             +AH+SD HL      P   +   KR+   ++W  +R+     E+   ++ D+    VD
Sbjct: 4   ITIAHLSDPHLPTEMAPPRLADRLNKRMFSHISWRRHRRFIHRPEILARVMADMAATPVD 63

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            +++TGD+ N     E   +  WL  +  P   +++PGNHD  +    ++++  W+ ++ 
Sbjct: 64  MIAVTGDLTNMGLPGECRNALRWLERM--PAPCTVIPGNHDTLVHADWQQTVGLWQPWM- 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                  G   FP++R   ++ALIG S+A+ TP F A G  G  QA     LL +  ++G
Sbjct: 121 -------GALPFPFVRRVGSVALIGVSSAVPTPWFRATGTLGVRQAARLRTLLHETGRQG 173

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
             RI+M+HHPPV   +     +     F   I HEGA+++LHGH H +S+  +   +  +
Sbjct: 174 LCRIVMIHHPPVAGLAVARKALRDPDNFAACIAHEGAEMVLHGHIHTSSISSLPGPQGAV 233

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           PV+GIASAS +       A +N   + + +  + L   R    PD          +F
Sbjct: 234 PVLGIASASARSADPLRAAGWNRITVHRGDTGYALGVTRRCF-PDGGQAVTSQETVF 289


>gi|197105520|ref|YP_002130897.1| hypothetical protein PHZ_c2057 [Phenylobacterium zucineum HLK1]
 gi|196478940|gb|ACG78468.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 303

 Score =  297 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 87/293 (29%), Positives = 150/293 (51%), Gaps = 10/293 (3%)

Query: 9   MFVLAHISDIHLSYS---PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
            F LAH+SD HL          +++ KR +  + W   R +  S  V + LI D+     
Sbjct: 3   TFRLAHLSDPHLPPPARALRLADMASKRALSRLAWRRKRHR-HSPAVLDALIADLRRCAP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH++ITGD+ NF  + E   +  WLR++G+P  +++ PGNHDA ++         W  ++
Sbjct: 62  DHIAITGDLTNFATHEEFAAAAEWLRTLGDPASVTVSPGNHDALVAHRTPDRFAPWAPWL 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                  T +  FP++R+R  +A++   TA+ T    A G  GQ+Q       LR+A  +
Sbjct: 122 -----GDTPQADFPHVRVRGCVAIVNACTAVPTAWRLAQGALGQDQIARLEAALRRAKAE 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G +RI+++HHPP     S    +    RF+ ++   GA+L+LHGH H   LH I   +  
Sbjct: 177 GLYRIVLLHHPPAEGAVSARKALTDAGRFRAVLEAVGAELVLHGHAHDALLHRIPGPQGA 236

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD 298
           IPV+G+ SAS     + P A + L  + +++  ++   +   ++P   ++++ 
Sbjct: 237 IPVLGVPSASAPPGGHDPAAQWRLIEVTRRSGGFSTRIEARGIAP-GNTVERL 288


>gi|85703077|ref|ZP_01034181.1| hypothetical protein ROS217_20087 [Roseovarius sp. 217]
 gi|85672005|gb|EAQ26862.1| hypothetical protein ROS217_20087 [Roseovarius sp. 217]
          Length = 319

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 94/301 (31%), Positives = 149/301 (49%), Gaps = 7/301 (2%)

Query: 6   TTIMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           T     LAH+SD HL       +  +  KR + L++WH  R+ +   E+   LI D+  H
Sbjct: 11  TGAGITLAHLSDPHLPLTGPVPWRAVLNKRALSLLSWHRKRRHHHRPEILAALIADMQRH 70

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +++TGD+ N     E   +  WL S+GNP  + ++PGNHDA I GA E     W  
Sbjct: 71  APDLIAVTGDLTNLGLESEYRAARRWLESLGNPARVMVIPGNHDALIRGAWEAGAAQWHP 130

Query: 124 YITSDTTCSTGK--KLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
           Y   D   +T      FPY+R R  +ALIG S+A+ATPP  A+G  G  Q    + LLR 
Sbjct: 131 YWQGDAAPATAHVSDAFPYMRRRGMLALIGVSSAVATPPAFASGAVGPAQLARLAHLLRA 190

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
           A  +G  R++M+HHPP+  T S    +      ++++  EG +L+LHGH+H      +  
Sbjct: 191 ARDEGLCRVMMIHHPPLDGTVSARKALRDGAALRRVLQAEGVELVLHGHSHRTHHQTLAT 250

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
                 V+G+ SAS         A+Y+L+++   +  W ++      +  +    +  + 
Sbjct: 251 RDGAAAVIGVPSASSLSPE---AAAYHLYHLTPMSGGWVIDVTARHATRAAEMAARHRTQ 307

Query: 302 I 302
           +
Sbjct: 308 L 308


>gi|118581152|ref|YP_902402.1| metallophosphoesterase [Pelobacter propionicus DSM 2379]
 gi|118503862|gb|ABL00345.1| metallophosphoesterase [Pelobacter propionicus DSM 2379]
          Length = 332

 Score =  296 bits (759), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 96/296 (32%), Positives = 152/296 (51%), Gaps = 8/296 (2%)

Query: 10  FVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           FVLAH+SD HLS  P     +L  KR++G  +W+  R+      V + L+ND+     DH
Sbjct: 27  FVLAHLSDPHLSPLPGVHPRDLLNKRLLGYFSWYRRRRHIHCPHVLDALLNDLAQAAPDH 86

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V+ITGD+ N     E   +  WL  +G+P  + +VPGNH+ Y++    ++   W DY+  
Sbjct: 87  VAITGDLTNLGLPDEFRQAARWLERVGSPARVMVVPGNHECYVAAPWRETFGRWADYLAG 146

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D   + G  ++P LR+R  +ALIG STA  + PF A G  G+EQ      LL +  ++G 
Sbjct: 147 DGAVADG--VYPRLRVRGGVALIGLSTARPSLPFMAVGSLGKEQLDRLEDLLEQTGRRGL 204

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++++HHPPV  + +   R+     F  +I  +GA+LILHGH H++    +      +P
Sbjct: 205 LRVVLLHHPPVPGSIAWRKRLTDASGFAAVIGRQGAELILHGHAHVSMEREL--VAGTVP 262

Query: 248 VVGIASASQKVHSNKP--QASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
           V G++S+S     + P   ASY L+   ++ + W +       S            
Sbjct: 263 VFGVSSSSSSSSQSAPLRTASYTLYRFRRRGDVWEVLLSVRIYSHRESRFVLARER 318


>gi|296115282|ref|ZP_06833922.1| putative metallophosphoesterase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978185|gb|EFG84923.1| putative metallophosphoesterase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 303

 Score =  296 bits (757), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 89/288 (30%), Positives = 148/288 (51%), Gaps = 14/288 (4%)

Query: 10  FVLAHISDIHL---SYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
            ++AH SD HL   +      +L  KR++  ++W   R++         ++ DI  HNVD
Sbjct: 4   ILIAHASDPHLAIDTLRIRAGDLLNKRVLSYLSWQR-RRRIHRTAALQRVMEDIAAHNVD 62

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            +++TGD+ N     E   +  WL  +  P  +++VPGNHDA +S     ++  W  ++ 
Sbjct: 63  MLALTGDLTNLGLPDECAQAERWLSRL--PMPVTVVPGNHDALVSSDWHATIGRWSPWM- 119

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                  G   FP++R    +ALIG ++A  TP F+A+G  G  QA   + +L +  ++G
Sbjct: 120 -------GPLPFPFVRRVGPVALIGLNSAHPTPCFNASGDIGAHQAARLAAVLEETGQQG 172

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
             R+IM+HHPP+   +S    +    RF   I   GA+L+LHGHTH+++L  +      +
Sbjct: 173 LCRVIMIHHPPLAHLTSRRKSLRDAGRFGACIAQHGAELVLHGHTHVSTLATLPGRNGPV 232

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLS 294
           PV+G+ASAS         AS+NL ++      + +E  R  + PD  +
Sbjct: 233 PVMGVASASTDTSDPARAASWNLVHVSSFMTGYRMEITRRIMLPDGKA 280


>gi|167645645|ref|YP_001683308.1| metallophosphoesterase [Caulobacter sp. K31]
 gi|167348075|gb|ABZ70810.1| metallophosphoesterase [Caulobacter sp. K31]
          Length = 307

 Score =  294 bits (754), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 80/300 (26%), Positives = 146/300 (48%), Gaps = 11/300 (3%)

Query: 9   MFVLAHISDIHLSYSPS---FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +F LAHISD+HLS       + +L  KR++  + W     +    E+   ++ D++    
Sbjct: 3   IFRLAHISDLHLSPPKGAFGWRDLLSKRLLSRIAWRRK-HREHRPEILARVVADLIAQAP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV+ITGD+ N+    E   +  WL ++G   D+++ PGNHDA +     ++  AW  ++
Sbjct: 62  DHVAITGDLTNYASPAEFEAARLWLETLGPSRDVTVSPGNHDALVDAEGVEAFAAWTPWL 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                   G+  FP +R+R+ +A+    +A+ T P  A G  G+ Q    + LL     +
Sbjct: 122 -----GDAGETRFPQVRVRDGVAVFNLCSAVPTAPHLATGRLGEAQLRRLAALLSDPAYR 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK- 244
             FR++++HHPP+    +    +  +   + ++  +GADLILHGH H   +  +   +  
Sbjct: 177 DDFRVLLIHHPPIPGAVARRKSLEDVDALRAVLAEQGADLILHGHAHDAMVATVPGPRGA 236

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY-WTLEGKRYTLSPDSLSIQKDYSDIF 303
           +IPV+G+ SAS       P A ++   I ++ +    ++     L P +    +    + 
Sbjct: 237 MIPVLGVPSASAMGGRGHPAARWHAVEIAREADGRIEVKVVARGLDPKTGEATELSRYVL 296


>gi|254470109|ref|ZP_05083513.1| metallo-phosphoesterase [Pseudovibrio sp. JE062]
 gi|211960420|gb|EEA95616.1| metallo-phosphoesterase [Pseudovibrio sp. JE062]
          Length = 270

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 94/253 (37%), Positives = 145/253 (57%), Gaps = 5/253 (1%)

Query: 48  FSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD 107
            +    + LI DI     DH+++ GD+VN    +E+  +  WL ++G+P ++S+ PGNHD
Sbjct: 1   MTNSYLDALIRDIHAQQPDHIALCGDLVNIALPKEVAGAKDWLATVGSPENLSLTPGNHD 60

Query: 108 AYISGAKEKSLHAWKDYITSDT-----TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFS 162
           AY+ GA +++  AW+ Y+ SD              FP++R R+N+ +IG STA AT PF 
Sbjct: 61  AYVPGALKQAYGAWRPYMQSDPDLGLTPPLGTDPHFPFVRRRSNVTIIGLSTAKATGPFM 120

Query: 163 ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG 222
           A G+    Q    +  LR A ++G FR++M+HHPPV + +S Y R+ G  RF+ +I   G
Sbjct: 121 ATGHISANQLRELADQLRHAKERGDFRVVMLHHPPVRNATSWYKRLVGSSRFRNIIAEHG 180

Query: 223 ADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           A+LILHGHTH  +   I   +  +PV+ + SAS  + S+KP A YNLF IEK    W+  
Sbjct: 181 AELILHGHTHRATRMEINGPEGPVPVICVPSASNGLSSHKPPARYNLFTIEKDGSGWSCI 240

Query: 283 GKRYTLSPDSLSI 295
            +    +  +  +
Sbjct: 241 MEERGFTTANEGV 253


>gi|149202538|ref|ZP_01879510.1| metallophosphoesterase [Roseovarius sp. TM1035]
 gi|149143820|gb|EDM31854.1| metallophosphoesterase [Roseovarius sp. TM1035]
          Length = 319

 Score =  289 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 93/301 (30%), Positives = 148/301 (49%), Gaps = 7/301 (2%)

Query: 6   TTIMFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           T     LAH+SD HL       +  +  KR + L++WH  R+ +   E+  +LI D+  H
Sbjct: 11  TGAGITLAHLSDPHLPLTGPVPWHSVLNKRALSLLSWHRKRRHHHRPEILAMLIADMRAH 70

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +++TGD+ N     E   +  WL ++G P  + ++PGNH+A I GA +     W  
Sbjct: 71  APDQIAVTGDLTNLGLESEYRAARRWLENLGRPERVMVIPGNHEALIRGAWDAGAAQWLP 130

Query: 124 YITSDTTCSTGK--KLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
           Y   D    T      FPY+R R  +ALIG S+A+ATPP  A+G  G  Q    + +LRK
Sbjct: 131 YWQGDAAPVTVDVSDAFPYMRRRGMLALIGVSSAVATPPAFASGAVGPAQLARLAPMLRK 190

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
           A   G  R++M+HHPP+  T S    +     F+ ++  EG +L+LHGH+H +    ++ 
Sbjct: 191 ARGAGLCRVLMIHHPPLDGTVSARKALRDAAAFRAVLQAEGVELVLHGHSHRHHHQTLET 250

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
                PV+G+ SAS         A+Y+L+ I      W ++      + +        + 
Sbjct: 251 RDGPTPVIGVPSASSLYPE---AAAYHLYQIRPTAAGWEIDVTARHATREQEMATGRCTR 307

Query: 302 I 302
           +
Sbjct: 308 L 308


>gi|209964083|ref|YP_002296998.1| phosphoesterase, putative [Rhodospirillum centenum SW]
 gi|209957549|gb|ACI98185.1| phosphoesterase, putative [Rhodospirillum centenum SW]
          Length = 323

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 86/296 (29%), Positives = 138/296 (46%), Gaps = 12/296 (4%)

Query: 9   MFVL--AHISDIHLSYSPS---FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           MF L  AH +D HL   P+   +  L  KR+ G ++W   R +    EV   L++DI   
Sbjct: 1   MFALRFAHFTDPHLPLPPAGPGWTALLSKRLFGYLSWRRRRHRIHRPEVLAALLDDIRAR 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             DH+  TGD+ N +   E   +  WL +   P D+++VPGNHDA +     + L  W+ 
Sbjct: 61  KPDHLVCTGDLANISLPAEFERARVWLEATAAPRDLTLVPGNHDALVPVPWVRGLGLWEP 120

Query: 124 YITSDTTC-----STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
           ++  D        + G+ LFP LR+R  +A IG S+A+ T P  A G  GQ Q      L
Sbjct: 121 WMRGDPGTGPDGTAGGEGLFPSLRVRGAVAFIGLSSAVPTAPLLATGRVGQTQLRRLEAL 180

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHW 238
           L++    G +R++++HHP    T      +      + ++   GA+L+LHGH H      
Sbjct: 181 LQEQGAAGRYRVVLLHHPLADGTVRARKALTDRAAVRAVLARAGAELVLHGHAHCARFAA 240

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT--LEGKRYTLSPDS 292
           +      IP +   SAS   H     A ++L  + +  + W   +  + +  S  +
Sbjct: 241 LPGPLGPIPSLTAPSASAVAHGRYDAARWSLVEVRRTPDGWRTAVTVRGWEASAGA 296


>gi|295690094|ref|YP_003593787.1| metallophosphoesterase [Caulobacter segnis ATCC 21756]
 gi|295431997|gb|ADG11169.1| metallophosphoesterase [Caulobacter segnis ATCC 21756]
          Length = 302

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 84/274 (30%), Positives = 136/274 (49%), Gaps = 11/274 (4%)

Query: 9   MFVLAHISDIHLSYSPS---FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           ++ +AH+SD HL   P    + ++  KR++  + W   RK     EV + L+ D+     
Sbjct: 3   IYRIAHLSDPHLPPPPGAFGWKDVFTKRLLSRIAWRKKRK-VHRPEVLSALVADLKASAP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV I+GD+ NF  + EI  +  WL S+G P D ++ PGNHDA       +    W  ++
Sbjct: 62  DHVVISGDLTNFASHTEIAAARKWLESLGEPTDFTVSPGNHDALAGAGGPERFAIWAPWL 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D     G+  FP +R+R  +A+    +A+ T P  A G  G+EQ       L      
Sbjct: 122 GDD-----GESRFPQVRLRGPVAIFNLCSAVPTAPHLATGRLGEEQLRKLDAALADPAYD 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           GFF+++++HHPP     S    +      ++++   GADL+LHGH H   L  ++     
Sbjct: 177 GFFKLVVLHHPPHEGAVSKRKSLDDGHALREVLERRGADLVLHGHAHEALLGALRGPDGA 236

Query: 246 -IPVVGIASASQKVHSNKPQASYNLFYIEKKNEY 278
            +PV+G+ SAS + + + P A +N   IE +   
Sbjct: 237 TVPVLGVPSASARPNRHGP-ARWNAIEIEPRAAG 269


>gi|16125410|ref|NP_419974.1| hypothetical protein CC_1158 [Caulobacter crescentus CB15]
 gi|221234153|ref|YP_002516589.1| Icc family phosphohydrolase [Caulobacter crescentus NA1000]
 gi|13422478|gb|AAK23142.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220963325|gb|ACL94681.1| phosphohydrolase, Icc family [Caulobacter crescentus NA1000]
          Length = 305

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 87/295 (29%), Positives = 134/295 (45%), Gaps = 12/295 (4%)

Query: 9   MFVLAHISDIHLSYSPS---FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           ++ +AH+SD HL   P      ++  KR++  + W   RK     EV   L+ D+     
Sbjct: 3   IYRIAHLSDPHLPPPPGAFGLRDVFTKRLLSRIAWRKKRK-VHRPEVLAALVADLQATAP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV I+GD+ NF    EI T+  WL  +G   D ++ PGNHDA       +    W  ++
Sbjct: 62  DHVVISGDLTNFASPVEIATARSWLEGLGAASDHTVSPGNHDALAGVGGPERFAIWSPWL 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                  TG+  FP +R+R  +A+    +A+ T P  A G  GQ+Q       L      
Sbjct: 122 -----GDTGEASFPQVRVRGPVAIFNLCSAVPTAPHLATGRLGQDQIERLDAALSDPAYA 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             FR++++HHPP     S   R+      + ++   GADL+LHGH H   +  +      
Sbjct: 177 SLFRLVVLHHPPHPGAVSKRKRLEDQDALRAVLARHGADLVLHGHAHEALVGSLPGPGGA 236

Query: 246 -IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT-LEGKRYTLSPDSLSIQKD 298
            IPV+G+ SAS K   + P A ++   IE + E    +      LS     I + 
Sbjct: 237 TIPVLGVPSASAKPSRHAP-ARWHQIEIEPRPEGGHAVRVVARGLSETGTEITEL 290


>gi|23008783|ref|ZP_00050080.1| COG1409: Predicted phosphohydrolases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 265

 Score =  281 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 88/240 (36%), Positives = 125/240 (52%), Gaps = 7/240 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+   P     +L  KR  G VNW   R ++   ++   L+ D+    VD
Sbjct: 6   MFRLAHLTDPHIGPLPRPRLRQLLSKRATGYVNWRRGRGRHHDMDLLGALVADLHGQGVD 65

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  T+  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 66  HVACTGDLCNLGLPDEWETARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 125

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR--KANK 184
            D   +   + FPYLR R  +AL+G S+AI T PF+A+G  G  Q  A  +LL    A  
Sbjct: 126 DD---AGQARSFPYLRRRGPLALVGLSSAIPTKPFAASGRLGPAQIEAAERLLHGLGAEA 182

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +   R++M+HHPP    ++    +     F  MI   GADLILHGH H+ S+  I     
Sbjct: 183 ERPCRVVMIHHPPHPGGAAAGRELKDAANFSAMIGRAGADLILHGHNHVGSVGRIAGRTG 242


>gi|58040481|ref|YP_192445.1| hypothetical protein GOX2053 [Gluconobacter oxydans 621H]
 gi|58002895|gb|AAW61789.1| Hypothetical protein GOX2053 [Gluconobacter oxydans 621H]
          Length = 313

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 83/281 (29%), Positives = 136/281 (48%), Gaps = 14/281 (4%)

Query: 9   MFVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
              LAHISD HL   P  + E   KR + L++W  +R+    ++    L+ DI   +VD 
Sbjct: 28  TVTLAHISDPHLPPPPVHWREALNKRALSLLSWKKHRRYVHLEQTCAALVKDIGRSDVDT 87

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           + ++GD+ NF    E   +  WL ++  P    ++PGNHD  +       LH W+ +   
Sbjct: 88  ILVSGDLTNFGTPDEFAAAARWLDAL--PAQALVIPGNHDCMVRQPDSAGLHQWERW--- 142

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                   + +PY+RI+N +A++G ++ I T PF A G     Q      LL++  ++G 
Sbjct: 143 ------SARQYPYVRIQNGVAIVGVNSGIPTAPFMACGRVAHRQRERLEALLQELGREGL 196

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++M+HHPP          +   +    +    GA+++LHGH+H  +L  I      IP
Sbjct: 197 CRVVMIHHPPRRGLVPWRKSLLDHREVAAVFRRAGAEIVLHGHSHDATLTHIAGTD--IP 254

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           ++G+ASAS        QA +N   I    + WT+   R+ L
Sbjct: 255 LLGVASASLTDERPHRQACWNRLSIHPYGKGWTITLARHRL 295


>gi|258542688|ref|YP_003188121.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633766|dbj|BAH99741.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636825|dbj|BAI02794.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639878|dbj|BAI05840.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642934|dbj|BAI08889.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645989|dbj|BAI11937.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649042|dbj|BAI14983.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652029|dbj|BAI17963.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655086|dbj|BAI21013.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-12]
          Length = 316

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 87/283 (30%), Positives = 137/283 (48%), Gaps = 8/283 (2%)

Query: 12  LAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           +AH+SD HL     PS  E+  KRI+ L++W   R+          ++ DI   + D V+
Sbjct: 18  IAHLSDPHLPLVGLPSLKEIRFKRILSLLSWQLRRRHLHKLPALQAVMQDIRHFHPDMVA 77

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ N    +E   +  WL     P    ++PGNHDA I          W +++ + T
Sbjct: 78  LTGDLTNLGLLKEFQNARQWLLQQDLP-PALLIPGNHDALIKENSAVKQALWAEWLHNRT 136

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                +   P L +++++ALIG +TAI T PF A+G  GQ Q    + LLR+    G  R
Sbjct: 137 QS---EPAAPSLLVKDHVALIGINTAIPTLPFLASGKAGQAQLVLLADLLRRTRAMGLCR 193

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           I+++HHPP     S    +   Q FQ ++  EGA+L+L+GH+H   +  I      I  V
Sbjct: 194 IVLLHHPPAPGIVSRRKGLDDFQAFQDVLRAEGAELVLYGHSHRAQITPIPGTD--ILAV 251

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
              SAS      +  A +N   + K+ + W +  +  +L  D 
Sbjct: 252 SSTSASHIADEPEKSAGWNAISVHKQPDIWQITIQHRSLMRDG 294


>gi|329114706|ref|ZP_08243464.1| Metallophosphoesterase [Acetobacter pomorum DM001]
 gi|326695972|gb|EGE47655.1| Metallophosphoesterase [Acetobacter pomorum DM001]
          Length = 320

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 88/283 (31%), Positives = 138/283 (48%), Gaps = 8/283 (2%)

Query: 12  LAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           +AH+SD HL     PSF E+  KRI+ L++W   R+          ++ DI   + D V+
Sbjct: 22  IAHLSDPHLPLVGLPSFKEIRFKRILSLLSWQLRRRHLHKLPALQSIMRDIRHFHPDMVA 81

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ N    +E   +  WL     P    ++PGNHDA I          W +++ S T
Sbjct: 82  LTGDLTNLGLLKEFQHARQWLLQQDLP-PTLLIPGNHDALIKENSATKQALWAEWLHSST 140

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                +   P L ++++IALIG +TA+ T PF A+G  GQ Q    + LLR+    G  R
Sbjct: 141 QP---EPAAPSLLVKDHIALIGVNTAVPTLPFLASGKAGQTQLVLLADLLRRTRVMGLCR 197

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           I+++HHPP     S    +     FQ ++  EGA+L+L+GH+H   +  +      I  V
Sbjct: 198 IVLLHHPPAQGIVSRRKGLDDFLAFQNVLRAEGAELVLYGHSHRAQITTLPGTD--ILAV 255

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
              SAS      +  A +N   + K+ + W +  +  +L PD 
Sbjct: 256 SSTSASHIADEPEKSAGWNAISVHKQPDIWQITIQHRSLMPDG 298


>gi|121595373|ref|YP_987269.1| metallophosphoesterase [Acidovorax sp. JS42]
 gi|120607453|gb|ABM43193.1| metallophosphoesterase [Acidovorax sp. JS42]
          Length = 307

 Score =  265 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 78/282 (27%), Positives = 129/282 (45%), Gaps = 12/282 (4%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
             LAH+SD+HL + P  S  +   KR +   +W   R      ++ + L  D+  H VDH
Sbjct: 4   LTLAHVSDLHLPFEPALSPRQRLSKRQLSAWSWQRRRA-LHRTDILDALAQDLRAHAVDH 62

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           + +TGDI NF+   E   +  WL ++  P  ISIVPGNHDA +     + L  W+ +   
Sbjct: 63  ILVTGDITNFSLPGEFEQAARWLTALAPPERISIVPGNHDALVPVPHAQGLGLWQGWTR- 121

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +  +P++  R+ +ALIG ++A+ T P  A G  G  Q     +LL      G 
Sbjct: 122 ------AEDGWPFVHHRDGVALIGLNSALPTAPLLARGRLGDAQLARLEQLLEAEGAAGR 175

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            RI+M+HHPP          +      + ++   GA+L+LHGH     +  +      IP
Sbjct: 176 TRIVMLHHPPAAGAIGWRKALADAPALRAVLRRAGAELVLHGHARDARMDVVAGPSLPIP 235

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWT--LEGKRYT 287
            + + S+S   +     A ++   +          +E +R++
Sbjct: 236 CLCVPSSSAVPNPKDQGALWHRLRLMDGAGGPRAMVEVRRWS 277


>gi|209545530|ref|YP_002277759.1| metallophosphoesterase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533207|gb|ACI53144.1| metallophosphoesterase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 307

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 82/283 (28%), Positives = 134/283 (47%), Gaps = 10/283 (3%)

Query: 12  LAHISDIHL---SYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           LAH+SD HL           L  KRI+   +W   R+      +   +  D+     D V
Sbjct: 12  LAHLSDPHLAHDGLRLPVGALMNKRIMSQWSWRRRRRFLHVDAILERVAADVRDAAPDAV 71

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD+ N     E   +  WLR    P    +VPGNHD  +  +   S+  W  ++   
Sbjct: 72  ALTGDLTNLGLPVECRHAAAWLRK-NMPEPTFVVPGNHDMLVRESWPDSVGQWAAWM--- 127

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              +     FPY+R   ++ALIG ++A   P F+A G  G  QA   + +L +  + G F
Sbjct: 128 ---AAAPDDFPYVRHVGSVALIGVNSARPMPWFTAAGRIGAAQADRLADILHETGRAGAF 184

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++M+HHPPV         +     F+ +I   GA+++LHGH HL+++  +      +PV
Sbjct: 185 RVVMIHHPPVDGMVPRRKALLDSGLFRSVIGRAGAEMVLHGHAHLSAVSTLPGPAISVPV 244

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
           +GIASAS + H  +  A+++   +   +  +  E  R  +  D
Sbjct: 245 LGIASASMRAHRQERMAAWHHIRVTATDRGFHAEIHRRIVGFD 287


>gi|218662697|ref|ZP_03518627.1| putative phosphoesterase protein [Rhizobium etli IE4771]
          Length = 247

 Score =  263 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 105/213 (49%), Positives = 148/213 (69%), Gaps = 3/213 (1%)

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCS---TGKKLFPYLRIRNNIALI 150
           G+P + S+VPGNHDAY+ GA EKS+ AW DY+  D   +     + +FPYLR+R  +A++
Sbjct: 34  GDPAETSVVPGNHDAYVPGAYEKSMRAWYDYVRGDLAPAQWQEDRHIFPYLRVRGKVAIV 93

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
           GCSTA+ATPPF+A+G+FG  QA  T  +LR A + G FR++M+HHPP+   ++ Y RM G
Sbjct: 94  GCSTAVATPPFAASGFFGARQARDTVNMLRAAGEAGLFRVVMIHHPPIRGATTFYKRMIG 153

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
           I+RF  +I   GA+L+LHGHTHLN+LHW++ + + +PVVGIASASQ   S KP A+YNLF
Sbjct: 154 IRRFAAVISTGGAELVLHGHTHLNTLHWLRGQVQPVPVVGIASASQGPGSIKPAAAYNLF 213

Query: 271 YIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            I+     W L G+R++L+    ++     DIF
Sbjct: 214 SIDGSPGAWELSGERFSLNRAGDAVISGSVDIF 246


>gi|162148703|ref|YP_001603164.1| metallophosphoesterase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787280|emb|CAP56874.1| putative metallophosphoesterase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 316

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 82/283 (28%), Positives = 134/283 (47%), Gaps = 10/283 (3%)

Query: 12  LAHISDIHL---SYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           LAH+SD HL           L  KRI+   +W   R+      +   +  D+     D V
Sbjct: 21  LAHLSDPHLAHDGLRLPVGALMNKRIMSQWSWRRRRRFLHVDAILERVAADVRDAAPDAV 80

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD+ N     E   +  WLR    P    +VPGNHD  +  +   S+  W  ++   
Sbjct: 81  ALTGDLTNLGLPVECRHAAAWLRK-NMPEPTFVVPGNHDMLVRESWPDSVGQWAAWM--- 136

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              +     FPY+R   ++ALIG ++A   P F+A G  G  QA   + +L +  + G F
Sbjct: 137 ---AAAPDDFPYVRHVGSVALIGVNSARPMPWFTAAGRIGAAQADRLADILHETGRAGAF 193

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++M+HHPPV         +     F+ +I   GA+++LHGH HL+++  +      +PV
Sbjct: 194 RVVMIHHPPVDGMVPRRKALLDSGLFRSVIGRAGAEMVLHGHAHLSAVSTLPGPAISVPV 253

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
           +GIASAS + H  +  A+++   +   +  +  E  R  +  D
Sbjct: 254 LGIASASMRAHRQERMAAWHHIRVTATDRGFHAEIHRRIVGFD 296


>gi|261883775|ref|ZP_06007814.1| metallophosphoesterase [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 213

 Score =  255 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 87/201 (43%), Positives = 127/201 (63%), Gaps = 1/201 (0%)

Query: 27  FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTS 86
            EL+ KRI G +NW  +RK      V + LI D+L    DH+++TGD+VN   N EI  +
Sbjct: 13  SELASKRITGYINWLRSRKSAMHGTVLDSLIADMLAQTPDHIAVTGDLVNLALNLEIDIA 72

Query: 87  THWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKL-FPYLRIRN 145
             WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++      + G++  FPY+R R 
Sbjct: 73  HDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMRGAGVDNKGRRPQFPYMRERG 132

Query: 146 NIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLY 205
            +ALIG S+A AT PF A+G F   Q    + +L KA  +G FR++M+HHPPV   +S +
Sbjct: 133 PVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDKAGARGLFRVVMIHHPPVHGATSAH 192

Query: 206 NRMFGIQRFQKMIWHEGADLI 226
            R++GI+RFQK+I    A+L+
Sbjct: 193 KRLYGIRRFQKIIREHEAELV 213


>gi|262198837|ref|YP_003270046.1| metallophosphoesterase [Haliangium ochraceum DSM 14365]
 gi|262082184|gb|ACY18153.1| metallophosphoesterase [Haliangium ochraceum DSM 14365]
          Length = 326

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 72/261 (27%), Positives = 120/261 (45%), Gaps = 9/261 (3%)

Query: 25  SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIF 84
              E   KR IG +N    R ++    V   ++ DI    +DHV  +GD+ N     E  
Sbjct: 22  RLLEFINKRWIGGLNLLAKRSRHHHTHVFEAMVEDINAQGIDHVVCSGDVTNLGLKSEFR 81

Query: 85  TSTHWLRSIG-NPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT------CSTGKKL 137
            +      +   P +++++PGNHD Y+S A+    H + DY  +DT        +     
Sbjct: 82  FARSCFDGLALGPENVTVIPGNHDVYVSEARGHFDHFFADYHRTDTPWRVTGSEAPAGTA 141

Query: 138 FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPP 197
           +P +R+R  +A++G S+ + TP F+A G     Q      +L         R++ +HHPP
Sbjct: 142 WPTVRVRGPVAVVGVSSCVPTPWFTAYGRVDHRQLERLRAVLSSPELADKLRVVAIHHPP 201

Query: 198 VLDTSSLYNR-MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL-IPVVGIASAS 255
               +    R + G ++F K++   GA+L+LHGH H +  H +       IPV+GI S S
Sbjct: 202 AGRYARHQTRGLRGWRKFAKLLAETGAELVLHGHEHRDLRHELPGPGGAYIPVLGIQSGS 261

Query: 256 QKVHSNKPQASYNLFYIEKKN 276
                 +  A Y +F + +  
Sbjct: 262 YHGLRAERTARYRIFDVSRDG 282


>gi|149917880|ref|ZP_01906375.1| metallophosphoesterase [Plesiocystis pacifica SIR-1]
 gi|149821400|gb|EDM80802.1| metallophosphoesterase [Plesiocystis pacifica SIR-1]
          Length = 292

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 83/288 (28%), Positives = 131/288 (45%), Gaps = 14/288 (4%)

Query: 8   IMFVLAHISDIHLSYS--PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +     H SDIHL             KR+ G VN    R K+  + + + +        V
Sbjct: 1   MGLRFLHCSDIHLLSLRGVGPHRFLNKRLTGGVNLMLKRGKHHDEALFDRMCEHARDRAV 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE-KSLHAWKDY 124
           D V ITGD+ N    +E       LR+IG P  ++++PGNHDAY  G+   +      D 
Sbjct: 61  DRVVITGDLSNLALEQEFEHIRTKLRAIGVP--VTVIPGNHDAYTRGSVRNRRFEQMLDE 118

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
             +      G   +P+++   ++AL+G STA A+ P  A G  G EQ      +L +   
Sbjct: 119 FMAGERSEGGD--YPFVQRYGDVALVGVSTAQASLPMYAVGTVGPEQLERLDGVLERLGA 176

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK- 243
           +G  RI+++HHP V   S   + +  I  F ++I   GA+LILHGH H      +     
Sbjct: 177 EGLGRIVLIHHPVVPGVSKKRHDLLDIDAFGEVIARRGAELILHGHEHTLLEGTLAGPDS 236

Query: 244 -KLIPVVGIASASQKVHSNKPQASYNLF-----YIEKKNEYWTLEGKR 285
            + +PV GI+S +        +A++ ++      IE++   W  E  R
Sbjct: 237 ERPVPVHGISSGTNISQHEGRRAAFAIYQVSAASIERELHVWDGEDFR 284


>gi|218461019|ref|ZP_03501110.1| putative phosphoesterase protein [Rhizobium etli Kim 5]
          Length = 191

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 94/191 (49%), Positives = 130/191 (68%), Gaps = 5/191 (2%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G+P + S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRALGDPAETSVVPGNHDAYVPGAYEKSMRAWYDYVR 120

Query: 127 SDTTCS---TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   +     + +FPYLR+R+ +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLAPAQWQEDRHIFPYLRVRDKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMH 194
           + G FR++M+H
Sbjct: 181 EAGLFRVVMIH 191


>gi|86157416|ref|YP_464201.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773927|gb|ABC80764.1| Metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 307

 Score =  233 bits (594), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 79/301 (26%), Positives = 137/301 (45%), Gaps = 16/301 (5%)

Query: 9   MFVLAHISDIHLSYSPSFFE----LSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           M  +AH+SD+H+  SP   E    L  KRI G VN    R + + +E    ++     H 
Sbjct: 1   MLRIAHLSDLHV-LSPRGTEWRRILFNKRITGYVNLVRQRGRVYRREYLAAVLAAAAAHA 59

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE--KSLHAWK 122
             HV +TGDI N    RE+  +   L  +    ++++VPGNHD Y+   ++  +  H + 
Sbjct: 60  D-HVVVTGDITNLALERELEEARALLDGVARAVEVTVVPGNHDVYLPSIQDGRRFPHHFG 118

Query: 123 DYITSDTT---CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
            ++  D            FP +++R   A+IG S+A+  PPF A+G  G+ Q  A   +L
Sbjct: 119 PFLRGDLPDLARDLAAGPFPCVKLRGPAAIIGLSSAVPRPPFVASGRLGEAQLEALEAVL 178

Query: 180 RKANKKGFFRIIMMHHPPVLDTSS---LYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL 236
                     ++++HHPPV        L + +    R + ++   G  L+L GH H    
Sbjct: 179 AHPEVARRTPVVLVHHPPVDGRIRALQLRDGLVDADRLRAVLSRLGRGLVLFGHLHARVR 238

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
             +      + VVG + A+      + +A +N + +        +E   + L+PD  S++
Sbjct: 239 WRLPTATGALQVVGASGAALDHPHPRVRAGFNAYELRDDGSLAAVEA--HVLAPDGRSVE 296

Query: 297 K 297
           +
Sbjct: 297 R 297


>gi|45657478|ref|YP_001564.1| hypothetical protein LIC11606 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45600717|gb|AAS70201.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 292

 Score =  232 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 68/293 (23%), Positives = 136/293 (46%), Gaps = 14/293 (4%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + H+SD+H   S  FF+L  K  +G +N++F RK  + K+V + ++  I   N D + +
Sbjct: 2   KILHLSDLHFPTSLPFFQLKGKMFVGYLNYNFRRKNKYPKKVWDSILTFIQEINPDAIVV 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GDI N +   E   +   L  +     +  +PGNHD Y+  +  ++    K +      
Sbjct: 62  SGDITNVSHEEEFKKARKMLSELPL-EKVFYIPGNHDRYVKQSSGENALYEKYFSEFSGE 120

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             +  K +  ++   N+  +G  + I     +A+G    E    T + L +  KK    I
Sbjct: 121 PISHNKNYIRIKKIQNLHFVGWDSNIPLSILNAHGRIHPEIVIQTKRFLSE--KKITNYI 178

Query: 191 IMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           ++ HHP   P+    ++++++   +    ++  +   + LHGH H N   W+K   + +P
Sbjct: 179 LVCHHPIWNPLDKQETVHHKLLNREEVASLLKEQPPLVYLHGHVHTN---WVKFPGEELP 235

Query: 248 VVGIASASQ-KVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
              I SAS  ++   K ++ ++L  I+K+     ++ +RYT + +     +  
Sbjct: 236 YYVINSASSTRLPDAKHKSGFHLIEIQKQK----IKIQRYTYNLERSKFTEAS 284


>gi|24215038|ref|NP_712519.1| putative phosphohydrolase [Leptospira interrogans serovar Lai str.
           56601]
 gi|24196088|gb|AAN49537.1| predicted phosphohydrolase [Leptospira interrogans serovar Lai str.
           56601]
          Length = 292

 Score =  232 bits (593), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 68/293 (23%), Positives = 136/293 (46%), Gaps = 14/293 (4%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + H+SD+H   S  FF+L  K  +G +N++F RK  + K+V + ++  I   N D + +
Sbjct: 2   KILHLSDLHFPTSLPFFQLKGKMFVGYLNYNFRRKNKYPKKVWDSILTFIQEINPDAIVV 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GDI N +   E   +   L  +     +  +PGNHD Y+  +  ++    K +      
Sbjct: 62  SGDITNVSHEEEFKKARKILSELPL-EKVFYIPGNHDRYVKQSSGENALYEKYFSEFSGE 120

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             +  K +  ++   N+  +G  + I     +A+G    E    T + L +  KK    I
Sbjct: 121 PISHNKNYIRIKKIQNLHFVGWDSNIPLSILNAHGRIHPEIVIQTKRFLSE--KKITNYI 178

Query: 191 IMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           ++ HHP   P+    ++++++   +    ++  +   + LHGH H N   W+K   + +P
Sbjct: 179 LVCHHPIWNPLDKQETVHHKLLNREEVASLLKEQPPLVYLHGHVHTN---WVKFPGEELP 235

Query: 248 VVGIASASQ-KVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
              I SAS  ++   K ++ ++L  I+K+     ++ +RYT + +     +  
Sbjct: 236 YYVINSASSTRLPDAKHKSGFHLIEIQKQK----IKIQRYTYNLERSKFTEAS 284


>gi|116328189|ref|YP_797909.1| phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116330913|ref|YP_800631.1| phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116120933|gb|ABJ78976.1| Phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116124602|gb|ABJ75873.1| Phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 292

 Score =  231 bits (590), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 69/293 (23%), Positives = 137/293 (46%), Gaps = 18/293 (6%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + H+SD+H   S  FF+L  K  +G +N++  R+K + K + N ++N I   N D + +
Sbjct: 2   KILHLSDLHFPTSVPFFQLKGKMFVGYLNYNLRRRKKYPKNIWNSILNFIRETNPDAIVV 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GDI N +   E   +   L  +     +  +PGNHD Y+  +  +  +A+ +   S  +
Sbjct: 62  SGDITNVSHEEEFKAALKMLSELPQ-EKVFYIPGNHDRYVKQSVGE--NAFYEKYFSKLS 118

Query: 131 CSTGKKLFPYLRIR--NNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
             +      Y+RI+   ++  +G  + I     +A G    E    T K L +  +K   
Sbjct: 119 GESISHNAHYIRIKKIQDLHFVGWDSNIPLSILNAYGRIRPEVVVQTKKTLSE--RKIRN 176

Query: 189 RIIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
            +++ HHP   P     ++++++   +    ++  +   + LHGH H N   W+K     
Sbjct: 177 YVLVCHHPIWNPTNKQETIHHKLLNREEIASLLKEQPPLVYLHGHVHTN---WVKFPGDE 233

Query: 246 IPVVGIASASQ-KVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
           +P   + SAS  ++     ++ ++L  I+K+N    +E +RYT + +     +
Sbjct: 234 LPYYVVNSASSTRLSDTTHESGFHLLEIQKQN----VEIQRYTYNLEKSKFTE 282


>gi|162452080|ref|YP_001614447.1| putative metallo-phosphoesterase [Sorangium cellulosum 'So ce 56']
 gi|161162662|emb|CAN93967.1| putative Metallo-Phosphoesterase [Sorangium cellulosum 'So ce 56']
          Length = 314

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 82/296 (27%), Positives = 123/296 (41%), Gaps = 20/296 (6%)

Query: 26  FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFT 85
            F L  KR+ G +N  F R         +    +I    VDHV ITGD+ N    RE   
Sbjct: 19  PFRLLNKRLTGYLNLRFRRHAIHKPHAVHAAAREIRRLGVDHVVITGDVSNLALEREFVL 78

Query: 86  STHWLRS-IG-NPHDISIVPGNHDAYISGA--KEKSLHAWKDYITSDT------------ 129
              +L+S +G  P  +SIVPGNHDAY  GA   ++    +  Y+ SD             
Sbjct: 79  VRDFLQSGLGLPPERVSIVPGNHDAYTKGAHRSQRFSRYFAPYLRSDLVLDAPGKSDDGG 138

Query: 130 -TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
            T   G   FP++ +R  +A+IG STA   PP  A+G  G  Q  A  + L     +   
Sbjct: 139 ATRDGGDSAFPFVHLRGPVAIIGLSTAWPRPPLVASGRLGPVQLRALERALEHPEVRRRT 198

Query: 189 RIIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
            +++ HHP   P     +L   +       +++      L+LHGH H      +  E+  
Sbjct: 199 PVVLQHHPFHNPASRAKTLLEGLGDAAAEGRLLRQVRRGLLLHGHLHRRIHRKLHTERGH 258

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
           I  VG  SAS    S++  A +N++ I+       +   R+    D+         
Sbjct: 259 IDAVGATSASLLHDSDERMAGFNVYEIDDAGTIGGITSHRFVPGQDAFREVPVPER 314


>gi|301336319|ref|ZP_07224521.1| hypothetical protein CmurM_00750 [Chlamydia muridarum MopnTet14]
          Length = 290

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 70/308 (22%), Positives = 119/308 (38%), Gaps = 24/308 (7%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLIND 59
           M K+ +T +F L H SDIH    P + F+   KR  GL+        + +  +       
Sbjct: 1   MPKKPST-IFRLIHCSDIHFCVFPKNPFQCFNKRFKGLLRQLIGGVSFRALAIFQRFPQL 59

Query: 60  ILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
           I     D V +TGD+     + E   +  +L  I     + IVPGNHD Y   + +K   
Sbjct: 60  IEQLEADGVCVTGDVTITALDSEFRLAKEFLSRIETIAPVYIVPGNHDVYTYRSLKK--Q 117

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
            +  Y   +    T +  F  L     + L+ CS       ++ANG     Q     + L
Sbjct: 118 TFYSY-FPNKELQTHRIAFQRLTSTWWLVLLDCSCFNGW--YAANGEVTSSQLLDLERFL 174

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH-EGADLILHGHTHLNSLHW 238
                     +I+ +H P+  T+   + +      + ++ H     L LHGH H   L  
Sbjct: 175 SSLPPSD--HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMHFPSVRLYLHGHDHYVELDH 232

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY----WTLEGKRYTLSPDSLS 294
           +       P + + S S  + SN   A +++  +  +  Y      +     T SP  +S
Sbjct: 233 L-------PPLVVNSGSLTLPSN---ARFHIVDLHPEGGYQISTAAITNLTETASPLKIS 282

Query: 295 IQKDYSDI 302
           I++    +
Sbjct: 283 IEETTISL 290


>gi|15834755|ref|NP_296514.1| icc-related protein [Chlamydia muridarum Nigg]
 gi|270284922|ref|ZP_06194316.1| icc-related protein [Chlamydia muridarum Nigg]
 gi|270288949|ref|ZP_06195251.1| icc-related protein [Chlamydia muridarum Weiss]
 gi|7190171|gb|AAF39013.1| icc-related protein [Chlamydia muridarum Nigg]
          Length = 290

 Score =  227 bits (578), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 69/308 (22%), Positives = 123/308 (39%), Gaps = 24/308 (7%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLIND 59
           M ++ +T+ F L H SDIH    P + F+   KR  GL+        + +  ++      
Sbjct: 1   MQEKPSTV-FRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLVGGVSFRAPAISQRFPQL 59

Query: 60  ILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
           +     + V +TGD+     + E   +  +L  I +   + IVPGNHD Y   A +K   
Sbjct: 60  VAQLEANGVCVTGDVTITALDSEFRLAKEFLSRIESIAPVYIVPGNHDVYTYRALKK--Q 117

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
            +  Y   +    T +  F  L     + L+ CS        +ANG     Q  A  + L
Sbjct: 118 TFYSY-FPNKELQTHRIAFQKLTPNWWLVLLDCSCFNGW--CAANGEVTDSQIVALEQFL 174

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHW 238
                     +I+ +H P+  T+   + +      + ++ +     + LHGH H      
Sbjct: 175 ASLPS--LEHVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRMYLHGHDH------ 226

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYW----TLEGKRYTLSPDSLS 294
              E   +P + + S S  + SN   A +++  +  + EY     +L     T SP  +S
Sbjct: 227 -HVEIDHLPPLVVNSGSLTLPSN---ARFHIIDLYPEGEYRISTASLTNLTETDSPLKIS 282

Query: 295 IQKDYSDI 302
           I++    +
Sbjct: 283 IEETSISL 290


>gi|220916163|ref|YP_002491467.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219954017|gb|ACL64401.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 309

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 73/301 (24%), Positives = 137/301 (45%), Gaps = 16/301 (5%)

Query: 9   MFVLAHISDIHLSYSPSFFE----LSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           +  +AH+SD+H+  SP   E    L  KRI G  N    R + + +E    ++       
Sbjct: 3   VLRIAHLSDLHVR-SPRGAEWRRILFNKRITGYANLIRQRGRVYRREYLAAVLAAAAARA 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE--KSLHAWK 122
             HV +TGD+ N    RE+  +   L ++    ++++VPGNHD Y++  ++  +  H + 
Sbjct: 62  D-HVVVTGDVTNLALERELEEARSLLDAMARRVEVTVVPGNHDVYLASIQDGRRFPHHFG 120

Query: 123 DYITSDTTC---STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
            ++  D            FP +++R   A+IG S+A+  PPF A+G  G+ Q  A   +L
Sbjct: 121 AFLRGDLPDLALDLAAGPFPCVKLRGPAAIIGLSSAVPRPPFVASGRLGEAQLEALEAVL 180

Query: 180 RKANKKGFFRIIMMHHPPVLDTSS---LYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL 236
                     ++++HHPPV        L + +    R + ++   G  L+L GH H    
Sbjct: 181 AHPEVARRTPVVLLHHPPVDGRIRALQLRDGLVDADRLRAVLCRLGRGLVLFGHLHARVR 240

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
             +      + V+G + A+      + +A +N + +        +E   + ++PD  S++
Sbjct: 241 WRLPTAAGALQVIGASGAALDHPHPRVRAGFNSYDLRDDGSLAAVEA--HVVAPDGRSVE 298

Query: 297 K 297
           +
Sbjct: 299 R 299


>gi|218682884|ref|ZP_03530485.1| putative phosphoesterase protein [Rhizobium etli CIAT 894]
          Length = 212

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 88/173 (50%), Positives = 120/173 (69%), Gaps = 3/173 (1%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGD+VN     EI  +  WLR +G+P D S+VPGNHDAY+ GA EKS+ AW DY+
Sbjct: 1   DHLAVTGDLVNLASGIEIRAAAAWLRELGDPADTSVVPGNHDAYVPGAYEKSMRAWYDYV 60

Query: 126 TSDTTCS---TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
             D         + +FPYLRIR  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A
Sbjct: 61  RGDLAPPQWQEDRHIFPYLRIRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAA 120

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNS 235
            + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHL  
Sbjct: 121 GEAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLKH 173


>gi|197121459|ref|YP_002133410.1| metallophosphoesterase [Anaeromyxobacter sp. K]
 gi|196171308|gb|ACG72281.1| metallophosphoesterase [Anaeromyxobacter sp. K]
          Length = 307

 Score =  223 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 73/302 (24%), Positives = 136/302 (45%), Gaps = 16/302 (5%)

Query: 8   IMFVLAHISDIHLSYSPSFFE----LSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
            +  +AH+SD+H+  SP   E    L  KRI G VN    R +   +E    ++      
Sbjct: 2   PVLRIAHLSDLHVR-SPRGTEWRRILFNKRITGYVNLIRQRGRVHRREYLAAVLAAAAAR 60

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE--KSLHAW 121
              HV +TGD+ N    RE+  +   L ++    ++++VPGNHD Y++  ++  +  H +
Sbjct: 61  AD-HVVVTGDVTNLALERELEEARSLLDAMARRVEVTVVPGNHDVYLASIQDGRRFPHHF 119

Query: 122 KDYITSDTT---CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
             ++  D            FP +++R   A+IG S+A+  PPF A+G  G+ Q  A   +
Sbjct: 120 GAFLRGDLPDLARDLAAGPFPCVKLRGPAAIIGLSSAVPRPPFVASGRLGEAQLEALEAV 179

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSS---LYNRMFGIQRFQKMIWHEGADLILHGHTHLNS 235
           L          ++++HHPPV        L + +    R + ++   G  L+L GH H   
Sbjct: 180 LAHPEVARRTPVVLLHHPPVDGRIRALQLRDGLVDADRLRAVLCRLGRGLVLFGHLHARV 239

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
              +      + V+G + A+      + +A +N + +        +E   + ++ D  S+
Sbjct: 240 RWRLPTAAGALQVIGASGAALDHPHPRVRAGFNSYELRDDGSLAAVEA--HVIAADGRSV 297

Query: 296 QK 297
           ++
Sbjct: 298 ER 299


>gi|255349151|ref|ZP_05381158.1| hypothetical protein Ctra70_04070 [Chlamydia trachomatis 70]
 gi|255503688|ref|ZP_05382078.1| hypothetical protein Ctra7_04065 [Chlamydia trachomatis 70s]
 gi|255507368|ref|ZP_05383007.1| hypothetical protein CtraD_04050 [Chlamydia trachomatis D(s)2923]
 gi|296439093|gb|ADH21246.1| hypothetical protein E11023_03990 [Chlamydia trachomatis E/11023]
          Length = 290

 Score =  223 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 67/308 (21%), Positives = 121/308 (39%), Gaps = 24/308 (7%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLIND 59
           M  + +   F L H SDIH    P + F+   KR  GL+        + +  ++      
Sbjct: 1   MPNKPSHA-FRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLIGGVSFQAFAISQRFPQL 59

Query: 60  ILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
           +     D V +TGD+     + E   +  +L  + +   + IVPGNHD Y   A +K   
Sbjct: 60  VKQLEADSVCVTGDMTITALDTEFRFAKEFLSRVESVAPVYIVPGNHDVYTHRALKK--Q 117

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
            +  Y   +    T +  F  L     + L+ CS       ++ANG     Q  A  + L
Sbjct: 118 TFYSY-FPNKELQTHRIAFKKLTPTWWLVLLDCSCFNGW--YTANGEVTDSQLLALEQFL 174

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHW 238
                     +I+ +H P+  T+   + +      + ++ +     L LHGH H   L  
Sbjct: 175 SSLPASE--HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRLYLHGHDHYVELDH 232

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY----WTLEGKRYTLSPDSLS 294
           +       P + + S S  + SN   A +++  +  +  Y      L   + T +P ++S
Sbjct: 233 L-------PPLVVNSGSLTLPSN---ARFHIIDLHPEGGYQITTAALTNLKETSTPLTIS 282

Query: 295 IQKDYSDI 302
           I++    +
Sbjct: 283 IEETTISL 290


>gi|15605487|ref|NP_220273.1| phosphohydrolase [Chlamydia trachomatis D/UW-3/CX]
 gi|76789496|ref|YP_328582.1| Icc family phosphohydrolase [Chlamydia trachomatis A/HAR-13]
 gi|166154096|ref|YP_001654214.1| hypothetical protein CTL0123 [Chlamydia trachomatis 434/Bu]
 gi|166154971|ref|YP_001653226.1| hypothetical protein CTLon_0123 [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|237803184|ref|YP_002888378.1| hypothetical protein JALI_7591 [Chlamydia trachomatis B/Jali20/OT]
 gi|237805105|ref|YP_002889259.1| hypothetical protein CTB_7591 [Chlamydia trachomatis B/TZ1A828/OT]
 gi|255311588|ref|ZP_05354158.1| hypothetical protein Ctra62_04000 [Chlamydia trachomatis 6276]
 gi|255317889|ref|ZP_05359135.1| hypothetical protein Ctra6_03995 [Chlamydia trachomatis 6276s]
 gi|301335334|ref|ZP_07223578.1| hypothetical protein CtraL_00820 [Chlamydia trachomatis L2tet1]
 gi|3329215|gb|AAC68349.1| phosphohydrolase [Chlamydia trachomatis D/UW-3/CX]
 gi|76168026|gb|AAX51034.1| phosphohydrolase, Icc family [Chlamydia trachomatis A/HAR-13]
 gi|165930084|emb|CAP03567.1| conserved hypothetical protein [Chlamydia trachomatis 434/Bu]
 gi|165930959|emb|CAP06521.1| conserved hypothetical protein [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|231273405|emb|CAX10320.1| conserved hypothetical protein [Chlamydia trachomatis B/TZ1A828/OT]
 gi|231274418|emb|CAX11213.1| conserved hypothetical protein [Chlamydia trachomatis B/Jali20/OT]
 gi|296436303|gb|ADH18477.1| hypothetical protein G9768_04000 [Chlamydia trachomatis G/9768]
 gi|296437232|gb|ADH19402.1| hypothetical protein G11222_04020 [Chlamydia trachomatis G/11222]
 gi|296438162|gb|ADH20323.1| hypothetical protein G11074_03995 [Chlamydia trachomatis G/11074]
 gi|297140663|gb|ADH97421.1| hypothetical protein CTG9301_04010 [Chlamydia trachomatis G/9301]
 gi|297748884|gb|ADI51430.1| Phosphohydrolase, Icc family [Chlamydia trachomatis D-EC]
 gi|297749764|gb|ADI52442.1| Phosphohydrolase, Icc family [Chlamydia trachomatis D-LC]
          Length = 290

 Score =  223 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 67/308 (21%), Positives = 121/308 (39%), Gaps = 24/308 (7%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLIND 59
           M  + +   F L H SDIH    P + F+   KR  GL+        + +  ++      
Sbjct: 1   MPNKPSHA-FRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLIGGVSFQAFAISQRFPQL 59

Query: 60  ILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
           +     D V +TGD+     + E   +  +L  + +   + IVPGNHD Y   A +K   
Sbjct: 60  VKQLEADSVCVTGDMTITALDTEFRFAKEFLSRVESVAPVYIVPGNHDVYTHRALKK--Q 117

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
            +  Y   +    T +  F  L     + L+ CS       ++ANG     Q  A  + L
Sbjct: 118 TFYSY-FPNKELQTHRIAFKKLTPTWWLVLLDCSCFNGW--YTANGEVTDSQLLALEQFL 174

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHW 238
                     +I+ +H P+  T+   + +      + ++ +     L LHGH H   L  
Sbjct: 175 SSLPASE--HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRLYLHGHDHYVELDH 232

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY----WTLEGKRYTLSPDSLS 294
           +       P + + S S  + SN   A +++  +  +  Y      L   + T +P ++S
Sbjct: 233 L-------PPLVVNSGSLTLPSN---ARFHIIDLHPEGGYQIATAALTNLKETSTPLTIS 282

Query: 295 IQKDYSDI 302
           I++    +
Sbjct: 283 IEETTISL 290


>gi|289525798|emb|CBJ15279.1| conserved hypothetical protein [Chlamydia trachomatis Sweden2]
 gi|296435376|gb|ADH17554.1| hypothetical protein E150_04025 [Chlamydia trachomatis E/150]
          Length = 290

 Score =  223 bits (568), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 67/308 (21%), Positives = 121/308 (39%), Gaps = 24/308 (7%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLIND 59
           M  + +   F L H SDIH    P + F+   KR  GL+        + +  ++      
Sbjct: 1   MPNKPSHA-FRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLIGGISFQAFAISQRFPQL 59

Query: 60  ILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
           +     D V +TGD+     + E   +  +L  + +   + IVPGNHD Y   A +K   
Sbjct: 60  VKQLEADSVCVTGDMTITALDTEFRFAKEFLSRVESVAPVYIVPGNHDVYTHRALKK--Q 117

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
            +  Y   +    T +  F  L     + L+ CS       ++ANG     Q  A  + L
Sbjct: 118 TFYSY-FPNKELQTHRIAFKKLTPTWWLVLLDCSCFNGW--YTANGEVTDSQLLALEQFL 174

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHW 238
                     +I+ +H P+  T+   + +      + ++ +     L LHGH H   L  
Sbjct: 175 SSLPASE--HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRLYLHGHDHYVELDH 232

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY----WTLEGKRYTLSPDSLS 294
           +       P + + S S  + SN   A +++  +  +  Y      L   + T +P ++S
Sbjct: 233 L-------PPLVVNSGSLTLPSN---ARFHIIDLHPEGGYQITTAALTNLKETSTPLTIS 282

Query: 295 IQKDYSDI 302
           I++    +
Sbjct: 283 IEETTISL 290


>gi|183221721|ref|YP_001839717.1| putative metallo-dependent phosphatase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189911796|ref|YP_001963351.1| phosphohydrolase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167776472|gb|ABZ94773.1| Phosphohydrolase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167780143|gb|ABZ98441.1| Putative metallo-dependent phosphatase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 287

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 73/280 (26%), Positives = 118/280 (42%), Gaps = 27/280 (9%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H     S F L  K I+G +N+H  RK      +   +++ I     D + I
Sbjct: 2   KILHISDLHFPKKLSLFSLRGKAIVGYLNYHVRRKSKHPVVLIAAMVDTIQNLEYDALVI 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGA------KEKSLHAWKDY 124
           +GD+ N +   E   +   L+ I       ++PGNHD Y   A       EK+   W   
Sbjct: 62  SGDLTNVSHPSEFQNAKEILKPILT-DKTFLIPGNHDRYQKRAMGPNPLFEKAFEEWMG- 119

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
            + D       K     RI   +  +G  + +A P  +ANGY  +E    T  L  +   
Sbjct: 120 ESKDPNFYLRTK-----RIAGKL-FVGWDSNLAIPRITANGYVAKEVVEKTVGLANEP-- 171

Query: 185 KGFFRIIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
                +++ HHP   P  +  S  +R+   +     +     +L LHGHTH N   W+K 
Sbjct: 172 ----YVLVGHHPLWNPNAEVESASHRLSNRKEVVNGLQTNPPELYLHGHTHTN---WVKL 224

Query: 242 EKKLIPVVGIASASQ-KVHSNKPQASYNLFYIEKKNEYWT 280
             K  P   + SAS  ++  +K +  ++L  + K+  Y  
Sbjct: 225 PGKETPFTIVNSASSTRLSDSKHECGFHLIELGKQTHYRR 264


>gi|329943207|ref|ZP_08291981.1| calcineurin-like phosphoesterase family protein [Chlamydophila
           psittaci Cal10]
 gi|332287787|ref|YP_004422688.1| putative phosphohydrolase [Chlamydophila psittaci 6BC]
 gi|313848359|emb|CBY17363.1| conserved hypothetical protein [Chlamydophila psittaci RD1]
 gi|325506738|gb|ADZ18376.1| putative phosphohydrolase [Chlamydophila psittaci 6BC]
 gi|328814754|gb|EGF84744.1| calcineurin-like phosphoesterase family protein [Chlamydophila
           psittaci Cal10]
 gi|328915045|gb|AEB55878.1| Ser/Thr protein phosphatase family protein family [Chlamydophila
           psittaci 6BC]
          Length = 293

 Score =  198 bits (504), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 57/295 (19%), Positives = 113/295 (38%), Gaps = 18/295 (6%)

Query: 11  VLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            + HISD+H    P        KR  G++   F    + S  +A    +  +    D + 
Sbjct: 10  RIIHISDVHFCVFPRNPLTCFNKRFKGVLRQVFGGVTFQSSTIAKRFPDLAVKLQADSIC 69

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD      ++E   +  ++ ++     + ++PGNHD Y   A ++    + +Y     
Sbjct: 70  ITGDFSLTALDKEFLLAQDFVHTLAQNASVYVLPGNHDVYTQQALDQ--KTFYNYF---P 124

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   + ++ ++  L+    +     FSANG     Q       +     +    
Sbjct: 125 NIQLQNEQISFNKLMDHWWLVLLDCSCLNGWFSANGMIKSSQISILENFILSLPPQE--N 182

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPV 248
           II+ +H P+L T    + +      Q ++       L LHGH H  +++  K      P 
Sbjct: 183 IIIANHYPLLPTKDPSHDLINHLLLQHVLKKYPNVRLYLHGHNHQAAVYNFK---DHAPN 239

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEY---WTLEGKRYTLSPDSLSIQKDYS 300
           + + S S  + SN   A +++  +  +  +     +     T  P  +SI+ +  
Sbjct: 240 MILNSGSVSLPSN---ARFHIIDLYPQGYHVYTAAITNLLNTQEPLEISIEANLE 291


>gi|312136711|ref|YP_004004048.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
 gi|311224430|gb|ADP77286.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
          Length = 273

 Score =  197 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 61/285 (21%), Positives = 114/285 (40%), Gaps = 28/285 (9%)

Query: 26  FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFT 85
             +   K II L + HF  K  FS E+   L + I   N D + + GD+       E   
Sbjct: 10  LGDFMDKTIIHLSDIHFGDK-TFSSELKRNLTSGIENINPDIIVVAGDVTTNGYKYEYEL 68

Query: 86  STHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRN 145
           ++ ++  + +  D  +VPGNHDA   G                     G + F ++    
Sbjct: 69  ASEFIEELNDIADTYVVPGNHDARNVGLVH-------------FEKLIGHRKFLHIDKSG 115

Query: 146 NIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSS 203
             A+IG  +   + P   +G  G +Q       L++    GF +I+  HH   P+  T  
Sbjct: 116 EFAIIGLDS---SQPDIDDGQIGIDQMEWAHDKLKRI-PNGFIKIVTFHHHLLPIPQTGR 171

Query: 204 LYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKP 263
             N +       K++   G D +L+GH H+ ++  I+     +  +   +A+ +    + 
Sbjct: 172 ERNILLDCGDVLKLLIDCGVDFVLNGHKHVPNVWMIE----KMATINSGTATTRRLRGES 227

Query: 264 QASYNLFYIEKKNEYWTLEGK----RYTLSPDSLSIQKDYSDIFY 304
             SYN   I  +  +  L       + T++   +S +++   ++Y
Sbjct: 228 FPSYNELTITDEKIHVNLINTENNVKKTIAQYGISKEEEAEIVYY 272


>gi|62185440|ref|YP_220225.1| hypothetical protein CAB837 [Chlamydophila abortus S26/3]
 gi|62148507|emb|CAH64278.1| conserved hypothetical protein [Chlamydophila abortus S26/3]
          Length = 293

 Score =  195 bits (497), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 58/295 (19%), Positives = 110/295 (37%), Gaps = 18/295 (6%)

Query: 11  VLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            + HISD+H    P +      KR  G +   F    + S  +A    +  +    D + 
Sbjct: 10  RIIHISDVHFCVFPKNPLTCFNKRFKGALRQVFGGVTFQSSTIAKRFPDLAVQLQADSIC 69

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD      + E   +  ++ ++     + ++PGNHD Y   A  +    +  Y     
Sbjct: 70  ITGDFSLTALDAEFLLAQDFVNTLAQNASVYVLPGNHDVYTQQALNQ--QTFYHYF---P 124

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   + ++ ++  L+    +     FSANG     Q       +     K    
Sbjct: 125 NVQLQNEQISFNKLIDHWWLVLLDCSCLNGWFSANGMIKSSQISVLENFILSLPPKE--N 182

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPV 248
           II+ +H P+L T    + +      Q ++       L LHGH H  +++  K      P 
Sbjct: 183 IIIANHYPLLPTKDPSHDLINHLLLQHVLKKYPNVRLYLHGHNHQAAVYNFK---DHAPN 239

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEY---WTLEGKRYTLSPDSLSIQKDYS 300
           + + S S  + SN   A +++  +  +  +     +     T  P  +SI+ +  
Sbjct: 240 MILNSGSVSLPSN---ARFHIIDLYPQGYHVYTAAITNLLNTQEPLKISIEANLE 291


>gi|330443879|ref|YP_004376865.1| Calcineurin-like phosphoesterase [Chlamydophila pecorum E58]
 gi|328806989|gb|AEB41162.1| Calcineurin-like phosphoesterase [Chlamydophila pecorum E58]
          Length = 302

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 63/270 (23%), Positives = 109/270 (40%), Gaps = 17/270 (6%)

Query: 10  FVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           F L HISD+H    P + F    KR    +   F    +    + N   + I   + + V
Sbjct: 9   FRLVHISDVHCRVFPKNLFYCFNKRFKSFLRQVFCSVDFQDVTICNRFPDLIRSLHTNSV 68

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAK-EKSLHAWKDYITS 127
            +TGD+     + E   + H++  +     I +VPGNHD Y   +  E++ + +   +  
Sbjct: 69  CLTGDLTLTALHAEFSLARHFIDHLAQYAKIHLVPGNHDVYTKTSYQEQTFYHYFPNVRL 128

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                   +L P      +  +I    +     FSANG     Q  A   LLR   +   
Sbjct: 129 QKNKVAKYRLTP------DWWIILLDCSCLNGWFSANGKVFLSQIAALESLLRSIPQSE- 181

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH-EGADLILHGHTHLNSLHWIKNEKKLI 246
             II+ +H P+L +   ++ +      Q+ +       L LHGH H  +L+     K L 
Sbjct: 182 -NIIIANHYPLLTSKKKFHTLLNNSLLQETLRDFPNIRLYLHGHDHQATLY---ANKDLS 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           P + + S S  + SN   A + +  +  ++
Sbjct: 238 PGLILNSGSISLPSN---ARFYIIDLYPQD 264


>gi|269302686|gb|ACZ32786.1| Ser/Thr protein phosphatase family protein [Chlamydophila
           pneumoniae LPCoLN]
          Length = 295

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 53/277 (19%), Positives = 109/277 (39%), Gaps = 16/277 (5%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLIND 59
           M ++   +   + HISD+H    P +      KR+ GL+   F    + +  +       
Sbjct: 1   MQEKPRHV-HRIIHISDVHFHVLPVNPVHCFNKRLKGLLRKVFGLVHFQATTIGQRFPKV 59

Query: 60  ILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
           +     D V ITGD      + E   + H++ ++     + ++PGNHD Y   +  +   
Sbjct: 60  VRSLGADSVCITGDFSLTAMDGEFLLAKHFVETLAKHSSVYLLPGNHDVYTPKSLAQ--- 116

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
             + + T        +    + +I ++  LI    +     FSANG     Q  A    L
Sbjct: 117 --QTFYTHFPNDQLQQNKVSFHKITDHWWLILLDCSCLNGWFSANGVVHLAQISAIETFL 174

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHW 238
              + +    +I+ +H P+L + +  + +      Q ++       L LHGH H  +++ 
Sbjct: 175 LSLSPEE--NVIIANHYPLLSSQNPSHDLINNTHLQNVLKKYPKVRLYLHGHEHQAAVYN 232

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKK 275
             +     P   + S S  + +N   + +++  +  +
Sbjct: 233 CADTS---PSYILNSGSISLPTN---SRFHVIDLYPE 263


>gi|311104652|ref|YP_003977505.1| calcineurin-like phosphoesterase family protein 2 [Achromobacter
           xylosoxidans A8]
 gi|310759341|gb|ADP14790.1| calcineurin-like phosphoesterase family protein 2 [Achromobacter
           xylosoxidans A8]
          Length = 261

 Score =  192 bits (488), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 58/273 (21%), Positives = 108/273 (39%), Gaps = 21/273 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+   + HF  ++     V    ++       D V ++GDI       +   +  ++  
Sbjct: 3   RILHFSDTHFGTERKP---VVEAALDLACTLAPDLVVLSGDITQRARRGQFAAARKFIER 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     ++L+ + +Y       + G  L P       +A IG 
Sbjct: 60  LSLP--VLTVPGNHDIPLFNVFARALNPYGNY-----KRALGPVLEPVFENAGLLA-IGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSS-LYNRMFGI 211
           +T         +G     Q    ++ LR+A   G  RI++ HHP      S L N + G 
Sbjct: 112 NTTRPR--RRKDGEISGSQIARVAERLRQAKP-GQLRIVVAHHPVRAKVESDLSNLLIGR 168

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWI--KNEKKLIPVVGIASASQKVHSNKPQASYNL 269
           +R  +     G DL+L GH HL  +  +   +      V    + S++V  N P  S N+
Sbjct: 169 ERALEAWAQAGVDLVLGGHIHLPYVLPLNPASASGGWVVQAGTTCSRRVRGNVP-NSVNV 227

Query: 270 FYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
              + + +    + +R+  +  + +       +
Sbjct: 228 ITSDGRGD---CQIERWDYAAGAHAFAPVDKTL 257


>gi|29840628|ref|NP_829734.1| hypothetical protein CCA00871 [Chlamydophila caviae GPIC]
 gi|29834978|gb|AAP05612.1| conserved hypothetical protein [Chlamydophila caviae GPIC]
          Length = 293

 Score =  191 bits (486), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 54/268 (20%), Positives = 101/268 (37%), Gaps = 15/268 (5%)

Query: 11  VLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            + HISD+H    P +      KR  G +   F    + S  +A    +  +    D + 
Sbjct: 10  RIIHISDVHFCVFPKNPLTCLNKRFKGALRQVFGGVTFQSSTIAERFPDLAVKLQADSIC 69

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD      + E   +  ++ ++     + ++PGNHD Y   A       +  Y     
Sbjct: 70  ITGDFSLTALDAEFLLAQDFVNNLARNASVYVLPGNHDVYTQKALNH--QTFYQYF---P 124

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   + ++ ++  L+    +     FSANG     Q       +     +    
Sbjct: 125 NTQLQNEQISFNKLVDHWWLVLLDCSCLNGWFSANGMIKSSQISILENFILSLPPQE--N 182

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH-EGADLILHGHTHLNSLHWIKNEKKLIPV 248
           II+ +H P+L T    + +      Q ++       L LHGH H  +++   N K   P 
Sbjct: 183 IIIANHYPLLPTKDPSHDLINYLLLQHVLKKYSNVRLYLHGHHHQAAVY---NCKDHAPN 239

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKN 276
           + + S S  + SN   A +++  +  + 
Sbjct: 240 MILNSGSISLPSN---ARFHIIDLYPQG 264


>gi|15618806|ref|NP_225092.1| phosphohydrolase [Chlamydophila pneumoniae CWL029]
 gi|15836430|ref|NP_300954.1| phosphohydrolase [Chlamydophila pneumoniae J138]
 gi|16752139|ref|NP_445506.1| hypothetical protein CP0969 [Chlamydophila pneumoniae AR39]
 gi|33242259|ref|NP_877200.1| 3,5'-cyclic-nucleotide phosphodiesterase [Chlamydophila pneumoniae
           TW-183]
 gi|4377217|gb|AAD19035.1| predicted phosphohydrolase [Chlamydophila pneumoniae CWL029]
 gi|7189882|gb|AAF38749.1| conserved hypothetical protein [Chlamydophila pneumoniae AR39]
 gi|8979271|dbj|BAA99105.1| phosphohydrolase [Chlamydophila pneumoniae J138]
 gi|33236770|gb|AAP98857.1| 3,5'-cyclic-nucleotide phosphodiesterase [Chlamydophila pneumoniae
           TW-183]
          Length = 295

 Score =  191 bits (486), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 53/277 (19%), Positives = 109/277 (39%), Gaps = 16/277 (5%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLIND 59
           M ++   +   + HISD+H    P +      KR+ GL+   F    + +  +       
Sbjct: 1   MQEKPRHV-HRIIHISDVHFHVLPVNPVHCFNKRLKGLLRKVFGLVHFQATTIGQRFPKV 59

Query: 60  ILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
           +     D V ITGD      + E   + H++ ++     + ++PGNHD Y   +  +   
Sbjct: 60  VRSLGADSVCITGDFSLTAMDGEFLLAKHFVETLAKHSSVYLLPGNHDVYTLKSLAQ--- 116

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
             + + T        +    + +I ++  LI    +     FSANG     Q  A    L
Sbjct: 117 --QTFYTHFPNDQLQQNKVSFHKITDHWWLILLDCSCLNGWFSANGVVHLAQISAIETFL 174

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHW 238
              + +    +I+ +H P+L + +  + +      Q ++       L LHGH H  +++ 
Sbjct: 175 LSLSPEE--NVIIANHYPLLSSQNPSHDLINNTHLQNVLKKYPKVRLYLHGHEHQAAVYN 232

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKK 275
             +     P   + S S  + +N   + +++  +  +
Sbjct: 233 CADTS---PSYILNSGSISLPTN---SRFHVIDLYPE 263


>gi|317402018|gb|EFV82617.1| DNA repair exonuclease [Achromobacter xylosoxidans C54]
          Length = 255

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 58/266 (21%), Positives = 102/266 (38%), Gaps = 17/266 (6%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+   + HF  ++     V    ++     + + V I+GDI       +   +  ++  
Sbjct: 3   RILQFSDTHFGTERKP---VVEAALDLARSLSPELVVISGDITQRARRGQFAAARKFIER 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     ++L+ + +Y       + G  L P       +A IG 
Sbjct: 60  LSLP--VLAVPGNHDIPLFNLFARALNPYGNY-----KRALGAVLEPVYESDGLLA-IGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLY-NRMFGI 211
           +T         +G     Q    ++ LR+A   G  R+++ HHP      S + N + G 
Sbjct: 112 NTTRPR--RRKDGEISDAQIARVAQRLRQARP-GQLRVVVAHHPMRAKVESDHSNLLIGR 168

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP--VVGIASASQKVHSNKPQASYNL 269
           QR        G DLIL GH HL  +     +  +    VV   +A  +        S NL
Sbjct: 169 QRALAAWAQAGIDLILGGHIHLPYVLPASVDPAVAAGWVVQAGTACSRRVRGNIPNSVNL 228

Query: 270 FYIEKKNEYWTLEGKRYTLSPDSLSI 295
              E   +      +R+  +  + + 
Sbjct: 229 ISCETTGDTRVCHVERWDYAAGAHAF 254


>gi|89897952|ref|YP_515062.1| phosphohydrolase [Chlamydophila felis Fe/C-56]
 gi|89331324|dbj|BAE80917.1| phosphohydrolase [Chlamydophila felis Fe/C-56]
          Length = 293

 Score =  189 bits (481), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 59/295 (20%), Positives = 107/295 (36%), Gaps = 18/295 (6%)

Query: 11  VLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            + HISD+H    P        KR  G +   F    + S  +A            D + 
Sbjct: 10  RIIHISDVHFCVFPRNPLTCLNKRFKGALRQIFGGVTFQSSTIAERFPELATRLQADSIC 69

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD      + E   +  ++ ++     +  +PGNHD Y   A  +    +  Y     
Sbjct: 70  ITGDFSLTALDAEFLLAQDFVNNLSQNASVYALPGNHDVYTQKALNQ--QTFYQYF---P 124

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   + ++ ++  L+    +     FSANG     Q       +     K    
Sbjct: 125 NVQLQNERISFNKLMDHWWLVLLDCSCLNGWFSANGMIQSSQTSVLENFILSLPPKE--N 182

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPV 248
           II+ +H P+L T    + +      Q ++       L LHGH H  +++   N K   P 
Sbjct: 183 IIIANHYPLLPTKDPSHDLINHLLLQHVLKKYPNVRLYLHGHNHQAAVY---NCKDHAPN 239

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEY---WTLEGKRYTLSPDSLSIQKDYS 300
           + + S S  + SN   A +++  +  +  +     +     T  P  +SI+ +  
Sbjct: 240 MILNSGSVSLPSN---ARFHIIDLYPQGYHVYTAEITNLLNTKEPLEISIEANLE 291


>gi|209964654|ref|YP_002297569.1| 3',5'-cyclic-nucleotide phosphodiesterase, putative [Rhodospirillum
           centenum SW]
 gi|209958120|gb|ACI98756.1| 3',5'-cyclic-nucleotide phosphodiesterase, putative [Rhodospirillum
           centenum SW]
          Length = 286

 Score =  189 bits (481), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 61/263 (23%), Positives = 110/263 (41%), Gaps = 21/263 (7%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +RI  + + HF R       V   L +D+     D + ++GD+       +   +  +L 
Sbjct: 2   RRIAHISDLHFGR---IDPAVVAALRDDLAAQAPDLIVVSGDLTQRARPSQFRAARAFLA 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  PH   +VPGNHD        + +   ++Y          + L P+L +  N+A++G
Sbjct: 59  DLPAPH--MVVPGNHDLPAFNLLARLVDPLRNYRR-----YIAEDLDPFLNL-GNLAVLG 110

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG- 210
            +T+ +     A G   Q Q       LR+   +  F+++  HHP +        R+ G 
Sbjct: 111 LNTSRSLILDFAEGRVNQRQMDRILGCLRELGPE-VFKVVFTHHPFLPPPDHPGRRLVGR 169

Query: 211 IQRFQKMIWHEGADLILHGHTHLNS----LHWIKNEKKLIPVVGIASASQKVHSNKPQAS 266
             R  + +   G DL+L GH H       +    + ++ I V   ++A+     N+P A 
Sbjct: 170 ATRALRALEAAGVDLLLAGHLHRAYSGDVMSHHAHVERSILVAQASTATSTRLRNEPNA- 228

Query: 267 YNLFYIEKKN---EYWTLEGKRY 286
           +NL  I   +      T EG+R+
Sbjct: 229 WNLIEIAPPSLVLRLRTWEGERF 251


>gi|152992897|ref|YP_001358618.1| metallophosphoesterase [Sulfurovum sp. NBC37-1]
 gi|151424758|dbj|BAF72261.1| metallophosphoesterase [Sulfurovum sp. NBC37-1]
          Length = 294

 Score =  186 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 60/265 (22%), Positives = 106/265 (40%), Gaps = 15/265 (5%)

Query: 10  FVLAHISDIHLSYSPS---FFELSPKRIIGLVNWHFNRKKYFS--KEVANLLINDILLHN 64
             + H SDIH++       + +   KR IG +N    R  YF   ++    L+     ++
Sbjct: 5   LRILHFSDIHVNIQIRHMHWKKWFSKRAIGAINLLRGRASYFDDTEKKLAALVRFKEEND 64

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIG-NPHDISIVPGNHDAYIS--GAKEKSLHAW 121
           +D V  TGD        E+  +   L  +   P +   VPGNHD Y+    +  +    +
Sbjct: 65  IDIVINTGDYTALGLRSELILARQLLDPLMTPPQNYITVPGNHDIYVHEGNSHYRFSEQF 124

Query: 122 KDYITSDTTCSTGKKLFPYLRI-RNNIALIGCSTAIATP-PFSANGYFGQEQAHATSKLL 179
              + +D         +P +R+  ++ A+I   +A   P P+ ++G    EQ  A  ++L
Sbjct: 125 CSVLQNDLPEYCRGGHWPLIRLLGDDAAVIAIDSARPNPVPWKSSGEIPPEQLQALEEIL 184

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GAD--LILHGHTHLNSL 236
           +    KG F  +M H+ P L       ++ G+      +    G +   IL GH H    
Sbjct: 185 KDERVKGRFLFVMTHYAPRLSNGEPDKKLHGLINADDFLETCKGIENGAILFGHIHKTYR 244

Query: 237 HWIKNEKKLIPVVGIASASQKVHSN 261
             +   K  +      SA+ + H  
Sbjct: 245 LHVPGVKSEL--FCAGSATMQGHEG 267


>gi|304314392|ref|YP_003849539.1| phosphohydrolase [Methanothermobacter marburgensis str. Marburg]
 gi|302587851|gb|ADL58226.1| predicted phosphohydrolase [Methanothermobacter marburgensis str.
           Marburg]
          Length = 245

 Score =  185 bits (471), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 69/291 (23%), Positives = 115/291 (39%), Gaps = 52/291 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++AHISD+H+   P+F E                      ++    I  I     D  
Sbjct: 1   MVLIAHISDLHVGA-PNFKE----------------------DILLEAIRQINELKPDAT 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD+ +     E   +  +L  +  PH    VPGNHDA   G        ++D     
Sbjct: 38  VITGDLTDNGYYLEFLQAAEYLSDLKGPH--IFVPGNHDARHVGN-----ETFEDVFRYR 90

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                         + +++ +IG  +   + P    G  G+ Q     + L +A+++G F
Sbjct: 91  KGT----------FVMDDLTIIGLDS---SEPDLDYGKIGRSQQIWMEEELERASERGHF 137

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           R+I +HH   PV  T    N +         I  +GADL++ GH H+  +  +++     
Sbjct: 138 RVIALHHHIIPVPKTGRERNVLADAGDILYSIIRKGADLVISGHKHVPHVWRVEDTF--- 194

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYW---TLEGKRYTLSPDSLS 294
             V   + S      K   SYN +YI + +       ++G+R  L+  SL 
Sbjct: 195 -FVTAGTVSSLKLRGKDINSYNTYYITEDSIRIVLNQVQGERIELASHSLR 244


>gi|294507999|ref|YP_003572057.1| phosphohydrolases [Salinibacter ruber M8]
 gi|294344327|emb|CBH25105.1| Putative phosphohydrolases [Salinibacter ruber M8]
          Length = 267

 Score =  185 bits (469), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 63/303 (20%), Positives = 114/303 (37%), Gaps = 51/303 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +AHISD+H                          +     V   L+++I    +D V++
Sbjct: 2   TIAHISDLHFG------------------------RIADSGVVEALLDEINAAGIDLVAV 37

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA----WKDYIT 126
           +GD+       E   + + L ++G P    +V GNHD Y      K L      +K +IT
Sbjct: 38  SGDLTQRARPAEYRAARNLLDALGPP--TLVVAGNHDVYPWWRPLKRLRTPLERYKQFIT 95

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   +              +A +G ++A    P    G  G     A            
Sbjct: 96  EDLAPTFEA---------GGVAALGLTSAYG--PSIKGGRIGPADRAAMRAFFSGTGDDR 144

Query: 187 FFRIIMMH--HPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK---- 240
           F  +++ H  HP  +   S +      Q+   +    G DLIL GH H++++  ++    
Sbjct: 145 FKVLVVHHQLHPTAIGPISPHPVARQAQQTLAVAGEVGIDLILCGHLHISAIQPLEIIPG 204

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
             + ++   G A++++      P   YN+  +E +   +++E +RY   PD     +D  
Sbjct: 205 TPRIVVASAGTATSNRWREPTGPINFYNVVSVEPE--AFSVEERRYV--PDEGRFVRDGV 260

Query: 301 DIF 303
             F
Sbjct: 261 TRF 263


>gi|33602822|ref|NP_890382.1| DNA repair exonuclease [Bordetella bronchiseptica RB50]
 gi|33577264|emb|CAE35821.1| probable DNA repair exonuclease [Bordetella bronchiseptica RB50]
          Length = 271

 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 58/277 (20%), Positives = 106/277 (38%), Gaps = 21/277 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ + + HF  ++       + L + +     D V + GDI       +   +  ++++
Sbjct: 3   RVLHISDTHFGTEREPVVHALHALADTLR---PDLVVLGGDITQRARRGQFAAARRFIQA 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     +    + +Y       + G  L P       +A IG 
Sbjct: 60  LQRP--VLAVPGNHDIPLFNLAARLFDPYGNYRR-----ALGAVLEPVYEDDRLLA-IGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++  A      NG   + QA   ++ LR A   G  R++ +HHP      S    +   +
Sbjct: 112 NSTRAA--RRKNGEVSRAQAQRVAQRLRDARP-GQLRVVALHHPVHAMVESDQRNLLIGR 168

Query: 213 RFQKMIW-HEGADLILHGHTHLNSLHWIKNE-----KKLIPVVGIASASQKVHSNKPQAS 266
            F    W   G DLIL GH HL  +  +  +     ++   V    + S++V    P  S
Sbjct: 169 EFAVPAWVDAGVDLILGGHIHLPYVAPLHGKAGAAGRRAWTVQAGTAVSRRVRGRVP-NS 227

Query: 267 YNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            NL     + +      +R+    DS +       + 
Sbjct: 228 VNLIDYAAQADSPACTVQRWDFQTDSGAFVLFGQQVL 264


>gi|83815871|ref|YP_446078.1| transcriptional regulator, Icc related protein [Salinibacter ruber
           DSM 13855]
 gi|83757265|gb|ABC45378.1| transcriptional regulator, Icc related protein [Salinibacter ruber
           DSM 13855]
          Length = 267

 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 62/303 (20%), Positives = 114/303 (37%), Gaps = 51/303 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +AHISD+H                          +     V   L+++I    +D V++
Sbjct: 2   TIAHISDLHFG------------------------RIADSGVVEALLDEINAAGIDLVAV 37

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA----WKDYIT 126
           +GD+       E   + + L ++G P    +V GNHD Y      K L      ++ +IT
Sbjct: 38  SGDLTQRARPAEYRAARNLLDALGPP--TLVVAGNHDVYPWWRPLKRLRTPLERYRQFIT 95

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   +              +A +G ++A    P    G  G     A            
Sbjct: 96  EDLAPTFEA---------GGVAALGLTSAYG--PSIKGGRIGPADRAAMRAFFSGTGDDR 144

Query: 187 FFRIIMMH--HPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK---- 240
           F  +++ H  HP  +   S +      Q+   +    G DLIL GH H++++  ++    
Sbjct: 145 FKVLVVHHQLHPTAIGPISPHPVARQAQQTLAVAGEVGIDLILCGHLHISAIQPLEIIPG 204

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
             + ++   G A++++      P   YN+  +E +   +++E +RY   PD     +D  
Sbjct: 205 TPRIVVASAGTATSNRWREPTGPINFYNVVSVEPE--AFSVEERRYV--PDEGRFVRDGV 260

Query: 301 DIF 303
             F
Sbjct: 261 TRF 263


>gi|319956240|ref|YP_004167503.1| metallophosphoesterase [Nitratifractor salsuginis DSM 16511]
 gi|319418644|gb|ADV45754.1| metallophosphoesterase [Nitratifractor salsuginis DSM 16511]
          Length = 295

 Score =  183 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 62/265 (23%), Positives = 105/265 (39%), Gaps = 17/265 (6%)

Query: 11  VLAHISDIHLSYSPS---FFELSPKRIIGLVNWHFNRKKYFSK--EVANLLINDILLHNV 65
            + H SD H   S     + +L  KR IG +N    R +YF +  E    L      + V
Sbjct: 2   RILHCSDPHFDLSLRSIPWKKLFGKRAIGALNLLGGRGRYFDEAEEKIAALARFKERYGV 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHD-ISIVPGNHDAYISG--AKEKSLHAWK 122
           D V  TGD+       E+  +   L  +  P     I+PGNHD Y +     +   + + 
Sbjct: 62  DLVLCTGDVTALGLTAELENAAELLAPLAQPPKHFIIIPGNHDVYSADVIRGDHFHYYFG 121

Query: 123 DYITSDTTCSTGKKLFPYLRI-RNNIALIGCSTAIATP-PFSANGYFGQEQAHATSKLLR 180
            Y+ +D         +P +R+   +IA++  ++A   P P+ ++GY    Q  A  K+L+
Sbjct: 122 QYMHTDWPQYAVDGPWPIVRLFSEDIAVVAVNSAKPNPLPWRSDGYIPPAQLEALEKILQ 181

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYN---RMFGIQRFQKM--IWHEGADLILHGHTHLNS 235
               K  +  +M H+   L           +     F  +  +  +GA  IL+GH H   
Sbjct: 182 DHRIKDRWIFVMTHYAARLANGRPDKPNHGLRNADEFLNVCRLIQKGA--ILNGHVHRCY 239

Query: 236 LHWIKNEKKLIPVVGIASASQKVHS 260
              + +E   I      S + +   
Sbjct: 240 RTSLADEGLNIDEYCAGSVTMEGRE 264


>gi|33592001|ref|NP_879645.1| DNA repair exonuclease [Bordetella pertussis Tohama I]
 gi|33571645|emb|CAE41137.1| probable DNA repair exonuclease [Bordetella pertussis Tohama I]
 gi|332381417|gb|AEE66264.1| DNA repair exonuclease [Bordetella pertussis CS]
          Length = 271

 Score =  183 bits (465), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 58/277 (20%), Positives = 106/277 (38%), Gaps = 21/277 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ + + HF  ++       + L + +     D V + GDI       +   +  ++++
Sbjct: 3   RVLHISDTHFGTEREPVVHALHALADTLR---PDLVVLGGDITQRARRGQFAAARRFIQA 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     +    + +Y       + G  L P       +A IG 
Sbjct: 60  LQRP--VLAVPGNHDIPLFNLAARLFDPYGNYRR-----ALGAVLEPVYEDDRLLA-IGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++  A      NG   + QA   ++ LR A   G  R++ +HHP      S    +   +
Sbjct: 112 NSTRAA--RRKNGEVSRTQAQRVAQRLRDARP-GQLRVVALHHPVHAMVESDQRNLLIGR 168

Query: 213 RFQKMIW-HEGADLILHGHTHLNSLHWIKNE-----KKLIPVVGIASASQKVHSNKPQAS 266
            F    W   G DLIL GH HL  +  +  +     ++   V    + S++V    P  S
Sbjct: 169 EFAVPAWVDAGVDLILGGHIHLPYVAPLHGKAGEAGRRAWTVQAGTAVSRRVRGRVP-NS 227

Query: 267 YNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            NL     + +      +R+    DS +       + 
Sbjct: 228 VNLIDYAAQADSPACTVQRWDFQTDSGAFVLFGQQVL 264


>gi|33597917|ref|NP_885560.1| DNA repair exonuclease [Bordetella parapertussis 12822]
 gi|33574346|emb|CAE38682.1| probable DNA repair exonuclease [Bordetella parapertussis]
          Length = 271

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 58/277 (20%), Positives = 106/277 (38%), Gaps = 21/277 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ + + HF  ++       + L + +     D V + GDI       +   +  ++++
Sbjct: 3   RVLHISDTHFGTEREPVVHALHALADTLR---PDLVVLGGDITQRARRGQFAAARRFIQA 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     +    + +Y       + G  L P       +A IG 
Sbjct: 60  LQRP--VLAVPGNHDIPLFNLAARLFDPYGNYRR-----ALGAVLEPVYEDDRLLA-IGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++  A      NG   + QA   ++ LR A   G  R++ +HHP      S    +   +
Sbjct: 112 NSTRAA--RRKNGEVSRTQAQRVAQRLRDARP-GQLRVVALHHPVHAMVESDQRNLLIGR 168

Query: 213 RFQKMIW-HEGADLILHGHTHLNSLHWIKNE-----KKLIPVVGIASASQKVHSNKPQAS 266
            F    W   G DLIL GH HL  +  +  +     ++   V    + S++V    P  S
Sbjct: 169 EFAVPAWVDAGVDLILGGHIHLPYVAPLHGKAGEAGRRAWAVQAGTAVSRRVPGRVP-NS 227

Query: 267 YNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            NL     + +      +R+    DS +       + 
Sbjct: 228 VNLIDYAAQADSPACTVQRWDFQTDSGAFVLFGQQVL 264


>gi|325959395|ref|YP_004290861.1| metallophosphoesterase [Methanobacterium sp. AL-21]
 gi|325330827|gb|ADZ09889.1| metallophosphoesterase [Methanobacterium sp. AL-21]
          Length = 265

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 57/248 (22%), Positives = 102/248 (41%), Gaps = 22/248 (8%)

Query: 29  LSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTH 88
           +  K++I + + HF   K F +++ N L   I   N D + + GDI       +   +  
Sbjct: 1   MMDKKLIHISDLHFGEYK-FDEKLKNNLKFQIEYENPDLIVVAGDITALGYLEDYNLARE 59

Query: 89  WLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIA 148
           +L  + N  +  +VPGNHD+   G                     G++ F       +I 
Sbjct: 60  FLYELNNIAETYVVPGNHDSCNVGLVH-------------FRKLIGERRFVATDKNEDIV 106

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH-PPVLDTSSLYNR 207
           LIG  +   + P   +G  G +Q    + +L K  +  F  +   HH  P+  T    N 
Sbjct: 107 LIGLDS---SEPDIHDGKIGFDQIEWLNDVLNKIPRDRFTAVTFHHHLLPIPQTGRERNI 163

Query: 208 MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASY 267
           +       K++   G +L+L+GH H+++   I     +I   G A+ ++    N P  SY
Sbjct: 164 LLDSGDVLKLLVSHGVNLVLNGHKHVSNAWKID--DMVILNSGTATTNRLYGDNSP--SY 219

Query: 268 NLFYIEKK 275
           N   ++ +
Sbjct: 220 NKVLVDDE 227


>gi|315230213|ref|YP_004070649.1| lacZ expression regulatory protein [Thermococcus barophilus MP]
 gi|315183241|gb|ADT83426.1| lacZ expression regulatory protein [Thermococcus barophilus MP]
          Length = 507

 Score =  179 bits (455), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 59/279 (21%), Positives = 112/279 (40%), Gaps = 50/279 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++  P+F   +                       +L++N++   + D V
Sbjct: 1   MIRIAHISDTHITQDPAFKSYA----------------------YDLIVNEVNRSDFDLV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ N     E   +++ +R I  P  + ++PGNHDA   G        ++ YI   
Sbjct: 39  IHTGDVTNQGLKEEYEHASYLIRKIEKP--LIVLPGNHDARNVG-----YELFEKYIGPL 91

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +  R+++ +I   +   T P  ++G  G  +     + L + + K  F
Sbjct: 92  YG----------VYERDDLVIIWIDS---TIPDLSDGRVGGYKFRWLKEKLEEYSHK-KF 137

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +I+  HH   P+ DT    N ++       ++     +L L GH H+ +++ I++    +
Sbjct: 138 KIVAAHHHLVPLPDTGRERNVLYNAGDVLDLLLRHEVNLYLCGHKHVPNVYSIED----L 193

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKR 285
            VV     S +        SYN+  +        +  +R
Sbjct: 194 VVVNAGCTSCRKTRKGDVNSYNIIKLNGDGR-IDVTIRR 231



 Score = 95.7 bits (237), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 58/260 (22%), Positives = 92/260 (35%), Gaps = 32/260 (12%)

Query: 21  SYSPSFFELSPK---RIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHVSITGDIVN 76
           S  P  F    K   RI+ +   + + + YF K V    I  I      D V   GDIV+
Sbjct: 243 SVKPKLFIPKGKHLLRIVQMSESNVSDRIYFRKRVLENAIRAINEKYKPDLVIHCGDIVD 302

Query: 77  FTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKK 136
               R    +  +   I    +  IVPG++D    G        +K+Y            
Sbjct: 303 VGIERYYEAAAGYYEKIK--AEKMIVPGHNDITYLG-----YDLFKEYFG---------- 345

Query: 137 LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP 196
             P ++   +   I   TA    P    G  GQ        LL +  +K  F  ++MHH 
Sbjct: 346 -EPEIKEFGDFVFIPLLTAQYETPIGVVGRMGQ---RLLKSLLEEHKEK--FTAVVMHHN 399

Query: 197 PVL-DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASAS 255
            +    S     +       K++  E  +L++ GH        I+      P+V   S S
Sbjct: 400 LIPIPRSRELGFLEDAGNVLKILTEERTELVMTGHGGNAFGVRIE----RTPIVNAGSVS 455

Query: 256 QKVHSNKPQASYNLFYIEKK 275
            ++  +    S+NL  I + 
Sbjct: 456 WELQRDPFGNSFNLIDIYED 475


>gi|149197703|ref|ZP_01874753.1| hypothetical protein LNTAR_20758 [Lentisphaera araneosa HTCC2155]
 gi|149139273|gb|EDM27676.1| hypothetical protein LNTAR_20758 [Lentisphaera araneosa HTCC2155]
          Length = 264

 Score =  178 bits (452), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 68/280 (24%), Positives = 108/280 (38%), Gaps = 25/280 (8%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + H SDIH    P+      KR+ G  N+ F RKK  +    + L   +     D+  I
Sbjct: 2   KIIHFSDIHEGAFPAPSSFFSKRLFGGSNYVFRRKKTVNWSRLDKLTEYVEQEGFDYAII 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +GD  +    RE       L  +       I  VPGNHD YI  +  KS  A +D+IT  
Sbjct: 62  SGDFTSTGSVREFEMVKKRLEKLHAIEGLKILAVPGNHDNYIDCS--KSYKALEDFITWL 119

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCST-AIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           T      K FP LRI     +   S  A+  P   ++G+  +E      +L+  ++K   
Sbjct: 120 TKGLV--KNFP-LRIEEGEVVFYLSNHAVPRPVQLSSGFVNEE---THERLVEWSSKDEQ 173

Query: 188 FRIIMMHHPPVLDTSS----LYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
              I + H P+L+        +  +   ++  K++     D+ L GH H   L       
Sbjct: 174 KTKIAIGHYPLLNGEGNSLPEHKLLVDGEKVHKLLQSGAIDINLCGHIHHAFLREETGGS 233

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
           K I      S +    +       N+  I+ +    T + 
Sbjct: 234 KEI---CAGSLTMGRKA-------NILEIDGRRIEQTWKI 263


>gi|268316953|ref|YP_003290672.1| metallophosphoesterase [Rhodothermus marinus DSM 4252]
 gi|262334487|gb|ACY48284.1| metallophosphoesterase [Rhodothermus marinus DSM 4252]
          Length = 273

 Score =  178 bits (452), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 53/270 (19%), Positives = 103/270 (38%), Gaps = 27/270 (10%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ L + HF R    S  V   L+ ++     D V ++GD+      R+   +  +L ++
Sbjct: 3   IVHLSDLHFGR--LASGAVVEDLLVEVRRQRPDLVVVSGDLTQRARPRQFRAARAFLEAL 60

Query: 94  GNPHDISIVPGNHDAYISGA----KEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIAL 149
             P    +VPGNHD Y          + L  ++ Y+T D   +          + + +A+
Sbjct: 61  --PAPTLVVPGNHDVYPWWRPLSRLVRPLARYRRYLTDDLRPA---------FVHDAVAV 109

Query: 150 IGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
           +G +TA         G    E                   +++ HH   L     ++   
Sbjct: 110 LGLNTAHGAT--VKGGRLSAEDLAYLQTFFATVPPSAVRVLVIHHHLVQLQAVGPHDVAR 167

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWI----KNEKKLIPVVGIASASQKVHSNKPQA 265
           G +R  ++I   G + IL GH H+  +  +       + +I   G A++S+    ++ + 
Sbjct: 168 GARRALEVIARAGIEFILCGHLHVAHVEPVVVQPDGHRVVIVSAGTATSSRGRGPHRNRN 227

Query: 266 SYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
            YN+  IE       ++ +     P   + 
Sbjct: 228 FYNVLRIEAD----AVQVEERCYEPARRAF 253


>gi|288958245|ref|YP_003448586.1| 3',5'-cyclic-nucleotide phosphodiesterase [Azospirillum sp. B510]
 gi|288910553|dbj|BAI72042.1| 3',5'-cyclic-nucleotide phosphodiesterase [Azospirillum sp. B510]
          Length = 291

 Score =  176 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 54/256 (21%), Positives = 99/256 (38%), Gaps = 18/256 (7%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           KR+  + + HF R       V + L++D+     D + I+GD V     R    +  +LR
Sbjct: 2   KRLAHISDLHFGR---IDPRVVDGLLSDLTAQAPDLIVISGDFVQRAKPRHFEEARAFLR 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  P     VPGNHD  +     +    +  Y T  T   +       L I + +A++G
Sbjct: 59  KLPFP--YMAVPGNHDIPVYNVFRRFTDPFGHYRTYITNDLSP------LHIDDELAVLG 110

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI 211
            +TA       + G   + Q     ++      +  F+++  HHP +        ++ G 
Sbjct: 111 INTARPVIMDFSEGRMNRRQITRVREVF-CGMPETVFKVLFTHHPFLPPPDLPRTQLVGR 169

Query: 212 QRF-QKMIWHEGADLILHGHTHLNSLHWIKNEK----KLIPVVGIASASQKVHSNKPQAS 266
            +     +   G DL+L GH H      I +      + I V   ++A+     N+   +
Sbjct: 170 HKLVLPALESCGVDLLLAGHLHKAYSGDIMSFHTQVARSILVAQASTATSTRLRNE-ANA 228

Query: 267 YNLFYIEKKNEYWTLE 282
           YNL  +      + + 
Sbjct: 229 YNLITVAHPTVTFEVR 244


>gi|163855981|ref|YP_001630279.1| DNA repair exonuclease [Bordetella petrii DSM 12804]
 gi|163259709|emb|CAP42010.1| probable DNA repair exonuclease [Bordetella petrii]
          Length = 270

 Score =  176 bits (446), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 58/277 (20%), Positives = 102/277 (36%), Gaps = 21/277 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + HF  ++   + V   L+        D V + GDI       +   +  ++++
Sbjct: 3   RILHLSDTHFGTER---EPVVQALLALSDALQPDLVLLGGDITQRARRSQFAAARRFVQA 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     +    +  Y       + G  L P +     +A IG 
Sbjct: 60  LQRP--VLAVPGNHDIPLFNLAARLFDPYGGYRR-----ALGAVLEPVVETDGLLA-IGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLY-NRMFGI 211
           ++         NG     Q    ++ LR+A   G  R++++HHP      S + N + G 
Sbjct: 112 NSTRPG--RHKNGQVSAAQVVRVAQRLREAGP-GRLRVVLLHHPVRAAVESDHANLLIGR 168

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP-----VVGIASASQKVHSNKPQAS 266
                     G D+IL GH HL  +  I       P     V    + S +V       S
Sbjct: 169 DLAVPAWVDAGVDIILGGHIHLPYILPIHGAAGPAPRQAWTVQAGTAVSHRVRGGI-SNS 227

Query: 267 YNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            N+      NE      +R+    ++   +   + + 
Sbjct: 228 VNVIDHMPDNERHRCSVQRWDYQAEAGEFRAQGTQML 264


>gi|325958231|ref|YP_004289697.1| metallophosphoesterase [Methanobacterium sp. AL-21]
 gi|325329663|gb|ADZ08725.1| metallophosphoesterase [Methanobacterium sp. AL-21]
          Length = 249

 Score =  176 bits (446), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 87/229 (37%), Gaps = 23/229 (10%)

Query: 50  KEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAY 109
            E+ N L+  +   N D + ++GD+     + E   +  ++  + +  ++ +VPGNHDA 
Sbjct: 1   MELKNNLLRQVTDENPDLIIVSGDLTTEGYSHEYDDAAEFVDELNSISEVHVVPGNHDAR 60

Query: 110 ISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQ 169
             G                     G++ F ++       + G  +   + P   +G  G 
Sbjct: 61  NVGLIH-------------FEKQIGERKFIHIDKSGGFVIAGLDS---SEPDINDGQIGY 104

Query: 170 EQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLIL 227
           +Q       L K  K    +I+  HH   P+  T    N +       ++    G D +L
Sbjct: 105 DQLAWLKSELEKVPKD-MCKIVTFHHHLLPIPQTGRERNILLDSGDLLRLFIDSGVDFVL 163

Query: 228 HGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           +GH H+ ++  I+     +  +   +A+ +        SYN   I+   
Sbjct: 164 NGHKHVPNVWMIE----KMVTLNSGTATTRKLRGNTYPSYNELLIDDGG 208


>gi|220917334|ref|YP_002492638.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955188|gb|ACL65572.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 304

 Score =  175 bits (444), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 57/278 (20%), Positives = 105/278 (37%), Gaps = 21/278 (7%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           +  L HISD+H++    +         G       R    S  +A  L++ +    VDH+
Sbjct: 26  ILRLGHISDLHVADRSRYPR------NGFTARDCER---HSTRLAKGLLDALREIGVDHL 76

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE--KSLHAWKDYIT 126
            +TGD+      RE   +   LR       +++VPGNHD +   + E  + L A      
Sbjct: 77  VVTGDLTFSGEPREFERAAELLRPFAEAGKLTVVPGNHDVWTEESVETGRFLRALGP--D 134

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAI-ATPPFSANGYFGQEQAHATSKLLRKANKK 185
                         + + +   L+   +A     P++  G  G EQ  A  +L R+  + 
Sbjct: 135 GKGMKKAAPSYPHVVPLGDEAVLVALDSARYGDDPWTTPGRLGGEQLRAARELAREHARL 194

Query: 186 GFFRIIMMHH-----PPVLDTSSLYNR--MFGIQRFQKMIWHEGADLILHGHTHLNSLHW 238
           G   ++  HH     P  + + +   R  +    +  +++       +LHGH H      
Sbjct: 195 GRAVLLAFHHHVVLPPERVPSDAHVCRMPLADADQVVRLVAEVPVAAVLHGHRHTAFRVD 254

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           +       PV+   SAS+       +A   L+ +++  
Sbjct: 255 LPGAAGPTPVLCAGSASRTADEPVRRARAYLYEVDRTG 292


>gi|168704282|ref|ZP_02736559.1| putative phosphohydrolase [Gemmata obscuriglobus UQM 2246]
          Length = 296

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 64/296 (21%), Positives = 111/296 (37%), Gaps = 34/296 (11%)

Query: 9   MFVLAHISDIHLSYSP---SFFELSPKRIIGLVNWHF---NRKKYFSKEVANLLINDILL 62
           M  LAH SDIHL+  P      +   KR +G VN  F     +  ++ +VA +L  +   
Sbjct: 1   MVRLAHFSDIHLTAQPLGWRVRDTFNKRSVGWVNVRFLGRGARFRYASDVAAVLRREFAT 60

Query: 63  HNVDHVSITGDIVNFTCNREIFTSTHWL----RSIGNPHDISIVPGNHDAYISGAKEKSL 118
              D +  +GD        E+  +   +     S+        VPGNHD Y   A     
Sbjct: 61  RGFDQLVFSGDASTMGFAAELREAATRIGVGDDSLPPG---LAVPGNHDLYTGRAIRDRY 117

Query: 119 --HAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIAT-PPFSANGYFGQEQAHAT 175
              A+  +         G +++P+ R   ++ LI  ++A      + A G  G  Q    
Sbjct: 118 FEDAFAPWQHG---QRVGNEVYPFARKVGHVWLIALNSAKPNFLFWDATGRVGHAQLDRF 174

Query: 176 SKLLRKANKKGFFRIIMMHHPPVLDTSS---LYNRMFGIQRFQKMIWHEGADLILHGHTH 232
            +L +  +     RI++ H+P + +  +    ++R+      +      G  L LHGH H
Sbjct: 175 RRLCKSLDDGP--RIVVSHYPLLKEGHTVEPRWHRLHDWHAARDAAAECGVSLWLHGHRH 232

Query: 233 LNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
              +  +       P +   S++Q          Y+ + I    +   L G R   
Sbjct: 233 HWYVLPVA-PNLPFPTICTGSSTQTKR-----WGYHDYTI----DGRRLTGARRVY 278


>gi|325958717|ref|YP_004290183.1| metallophosphoesterase [Methanobacterium sp. AL-21]
 gi|325330149|gb|ADZ09211.1| metallophosphoesterase [Methanobacterium sp. AL-21]
          Length = 250

 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 62/269 (23%), Positives = 103/269 (38%), Gaps = 47/269 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +A ISD+H+                           F + + +  I++I   + D  
Sbjct: 1   MPFIAQISDLHVGSL-----------------------NFQENLLDKAIDEINSVDPDVT 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGDI       E      +L  I +P  I +VPGNHDA   G        ++D I + 
Sbjct: 38  IVTGDITENGYYLEYERVVPFLDRIKSP--ILVVPGNHDARHVGD-----ECFEDLIKNR 90

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 KK        + + +IG  +   + P    G  G+ Q       LR A+++  +
Sbjct: 91  YGTLEDKK--------HGLKVIGLDS---SEPDLDYGRIGRSQQSWMENELRIADEENLY 139

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +II +HH   PV  T    N +       + +    ADL+L GH H+  +  +++     
Sbjct: 140 KIIALHHHIIPVPKTGRERNVLSDAGDILQSLMKGKADLVLSGHKHMPHVWMMEDTT--- 196

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKK 275
             +   + S      K  +SYN   IE +
Sbjct: 197 -FITAGTVSSLRLRGKALSSYNTIDIEDE 224


>gi|148642443|ref|YP_001272956.1| phosphohydrolase calcineurin-like superfamily [Methanobrevibacter
           smithii ATCC 35061]
 gi|222446058|ref|ZP_03608573.1| hypothetical protein METSMIALI_01707 [Methanobrevibacter smithii
           DSM 2375]
 gi|261349403|ref|ZP_05974820.1| LacZ expression regulatory protein [Methanobrevibacter smithii DSM
           2374]
 gi|148551460|gb|ABQ86588.1| predicted phosphohydrolase, calcineurin-like superfamily
           [Methanobrevibacter smithii ATCC 35061]
 gi|222435623|gb|EEE42788.1| hypothetical protein METSMIALI_01707 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861766|gb|EFC94064.1| LacZ expression regulatory protein [Methanobrevibacter smithii DSM
           2374]
          Length = 247

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 61/286 (21%), Positives = 106/286 (37%), Gaps = 51/286 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++ HISD+H+S                          F ++V    + +I   N D +
Sbjct: 1   MPLIVHISDLHISELG-----------------------FEEDVFIKAVAEINAINPDMI 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ N     E   +T +L     P  +  VPGNHDA   G        +++ I   
Sbjct: 38  ILTGDLTNNGYYSEFIQATKYLEMFDAP--LFAVPGNHDARNLG-----YETFEELIGEC 90

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           +   T           +   +IG  +   + P  ++G  G+ Q       L +   +  F
Sbjct: 91  SWKLT---------KDDEFVVIGLDS---SSPDISSGNVGRPQHLWMEHQLDQCVIEELF 138

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            I+ +HH   P+  T    N +       K +     DL+L GH H+ ++  + N     
Sbjct: 139 SIVALHHHVIPIPKTGRERNVLTDAGDVLKTLTDHEVDLVLAGHKHVPNIWKMNNTL--- 195

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYW---TLEGKRYTLS 289
             V   S S        + SYN++ I +         ++G+R+   
Sbjct: 196 -FVNAGSLSSNKLRGDDKNSYNVYEITEDTIRIFLNKVDGERFLFG 240


>gi|187477535|ref|YP_785559.1| metallo-phosphoesterase [Bordetella avium 197N]
 gi|115422121|emb|CAJ48645.1| putative metallo-phosphoesterase [Bordetella avium 197N]
          Length = 260

 Score =  170 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 52/271 (19%), Positives = 103/271 (38%), Gaps = 19/271 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ + + HF R+     +   +L   I   + D V ++GDI       +   +  +++ 
Sbjct: 3   RVLHISDTHFGRQVVPVVQALEVL---IQRLDPDLVLLSGDITQRARRGQFAAARQFVQG 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     +  + + +Y       + G  L P      ++ ++G 
Sbjct: 60  LRRP--VLTVPGNHDMPLFNLAARLFNPYGNYRR-----AMGVNLEPVFD-GEHLLVVGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPV-LDTSSLYNRMFGI 211
           +++  +     +G    EQ    +  LR A + G  RI+M+HHP          N +   
Sbjct: 112 NSSRPS--RRKHGEVSPEQIERVASRLR-AARPGQLRIVMLHHPVRGPKAGDSANLLIRR 168

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFY 271
           +         GAD I  GH HL  +  +   +    +    + S ++    P  S NL  
Sbjct: 169 ELAVPAWVDAGADFIAAGHAHLPYMLPLGGSRCAWCLQAGTAVSSRLRGGMP-NSVNLIE 227

Query: 272 IEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                 +     +R+  +  S   +     +
Sbjct: 228 ---HGGHDVCLVQRWDFNAASGFQETVVQTL 255


>gi|259417953|ref|ZP_05741872.1| metallophosphoesterase [Silicibacter sp. TrichCH4B]
 gi|259346859|gb|EEW58673.1| metallophosphoesterase [Silicibacter sp. TrichCH4B]
          Length = 267

 Score =  170 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 53/264 (20%), Positives = 95/264 (35%), Gaps = 23/264 (8%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           KR++ L + HF R +    E+ + LI  I     D V+I+GD+     + +   +   + 
Sbjct: 2   KRLLHLSDLHFGRDR---PELLDPLIEQINGLAPDLVAISGDLTQRARDWQFMRAREMID 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            I  P    +VPGNHD  +    E++L  W+ Y            L P +   +  +++G
Sbjct: 59  RIKAP--CLVVPGNHDTPLDNLFERALMPWRRYRKW-----ISCDLEPQIHDVD-WSVVG 110

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI 211
            ++          G F             +   +  +RI++ HHP             G 
Sbjct: 111 VNSVNPLGW--QRGRFSLGDIRRVQTCFAQT-PEDAYRIVVAHHPLEHQPGETKRLTRGA 167

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV----GIASASQKVHSNKPQASY 267
           Q  +  +   G D+IL GH H              P V       S S ++   +    +
Sbjct: 168 QHARAELSRIGTDIILSGHLHSWYADTFAMVPDQTPAVLQIHVGTSLSDRLRGEE--NDF 225

Query: 268 NLFYIEKKN---EYWTLEGKRYTL 288
           NL  +++     + +     R   
Sbjct: 226 NLLTLKRSAVRVDRYACRADRSGY 249


>gi|304314070|ref|YP_003849217.1| phosphohydrolase [Methanothermobacter marburgensis str. Marburg]
 gi|302587529|gb|ADL57904.1| predicted phosphohydrolase [Methanothermobacter marburgensis str.
           Marburg]
          Length = 265

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 49/247 (19%), Positives = 99/247 (40%), Gaps = 26/247 (10%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           K+I  + + HF  K  FS ++   L+  +   N D + ++GD+       E   +  +  
Sbjct: 3   KKIAQISDIHFGEKN-FSSKLRENLLGQLQDENPDLIVVSGDLTTEGYAHEYELAAEFAD 61

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            + +     I+PGNHDA   G                     GK+ F  +   +  A+IG
Sbjct: 62  ELRSITATYIIPGNHDARNVGLVH-------------FEKMIGKRKF--VHHDSEFAVIG 106

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMF 209
             +   + P   +G  G +Q    ++ L +       +I+  HH   P+ +T    N + 
Sbjct: 107 LDS---SEPDINDGQIGMDQLEWLARELERVPDH-LCKIVTFHHHLLPIPNTGRERNILL 162

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
                 +++   G D +L+GH H+ ++  I+     +  +   +A+ +    +   S+N 
Sbjct: 163 DSGDLLRLLNSYGVDFVLNGHKHVPNVWMIEG----MVTLNSGTATTRKLRGETFPSHNQ 218

Query: 270 FYIEKKN 276
             I++  
Sbjct: 219 LRIDEDR 225


>gi|212223890|ref|YP_002307126.1| metallophosphoesterase [Thermococcus onnurineus NA1]
 gi|212008847|gb|ACJ16229.1| metallophosphoesterase [Thermococcus onnurineus NA1]
          Length = 503

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 56/279 (20%), Positives = 107/279 (38%), Gaps = 50/279 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   ++         G                 +L++N+I   N D V
Sbjct: 1   MIRIAHISDTHITSESAYK--------GY--------------AYDLIVNEINRGNFDFV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ N     E   +++ L+ I  P  + ++PGNHD    G        ++ +I   
Sbjct: 39  IHTGDVTNQGLREEYERASYELKKIQKP--LIVIPGNHDVRNVG-----YELFEKFIGPL 91

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                          R+ + ++   +   T P  ++G  G  +     K L + + +  F
Sbjct: 92  NG---------VFEFRDGV-IVWVDS---TIPDLSDGRIGGYKFKWLKKRLEEYSDR-KF 137

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +I+  HH   P+ DT    N +F       ++   G +L   GH H+ +++ +++    +
Sbjct: 138 KIVASHHHIVPLPDTGRERNVLFNAGDVLDLLLRHGVNLYTCGHKHVPNVYRVED----M 193

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKR 285
            V      S +        SYN+  +        +  +R
Sbjct: 194 VVANAGCTSCRKTRKGDVNSYNIITLHDDGR-IEVTIRR 231



 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 54/261 (20%), Positives = 98/261 (37%), Gaps = 34/261 (13%)

Query: 21  SYSPSFFELSPKR---IIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHVSITGDIVN 76
              P  F    KR   I+ +   + + + YF ++V   +I  I      D V   GD+V+
Sbjct: 243 PVRPKIFVPRGKRLLRIVQMSESNVSDRIYFRRKVLENVIRTINERLKPDIVIHCGDVVD 302

Query: 77  FTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKK 136
               R    +  +   IG   +  +VPG++D    G        +K+Y         GK 
Sbjct: 303 MGIERYYEKAYEFYEKIG--AEKLVVPGHNDITYLG-----YDLFKEYFGKPKILELGKF 355

Query: 137 LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP 196
            F           I   +A    P    G  GQ++     +   ++     F +++MHH 
Sbjct: 356 TF-----------IPVISAQYETPIGVVGRIGQKKLARHLEDYSES-----FTVVVMHHN 399

Query: 197 --PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASA 254
             P+  +      +       K++  E A+L+L GH      +    + +  P+V   S 
Sbjct: 400 IVPIPKS-REVGFLEDAGDVLKVLTREKANLVLTGH----GGNSFGVKVEKTPLVNAGSV 454

Query: 255 SQKVHSNKPQASYNLFYIEKK 275
           S ++H N    ++NL  + + 
Sbjct: 455 SWELHRNPYGNTFNLIDVYRD 475


>gi|293603913|ref|ZP_06686328.1| metallophosphoesterase [Achromobacter piechaudii ATCC 43553]
 gi|292817750|gb|EFF76816.1| metallophosphoesterase [Achromobacter piechaudii ATCC 43553]
          Length = 267

 Score =  170 bits (431), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 58/261 (22%), Positives = 103/261 (39%), Gaps = 20/261 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + HF  ++     V    ++     N D V ++GDI       +   +  ++  
Sbjct: 3   RILQLSDTHFGTERKP---VVEAALDLARSLNPDLVVVSGDITQRARRAQFAAARKFIER 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD  +     ++L+ + +Y       + G  L P       +A IG 
Sbjct: 60  LSLP--VLTVPGNHDIPLINLFARALNPYGNY-----KRALGAVLEPVFENPGLLA-IGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSS-LYNRMFGI 211
           +T         +G     Q    ++ LR+A   G  R+++ HHP      S L N + G 
Sbjct: 112 NTTRPR--RHKDGEISDAQIARVAQRLRQARP-GQLRVVVAHHPVRAKVESDLSNLLNGR 168

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP---VVGIASASQKVHSNKPQASYN 268
           +R        G DL+L GH HL  +  +      +P   +V   +A  +        S N
Sbjct: 169 ERALAAWAQAGIDLVLGGHIHLPYVLPLS--AGGLPAGWIVQAGTACSRRVRGSVPNSVN 226

Query: 269 LFYIEKKNEYWTLEGKRYTLS 289
           +   E + +      +R+  +
Sbjct: 227 VITREGEGDQQICHVERWDYA 247


>gi|89067405|ref|ZP_01154918.1| possible phospodiesterase [Oceanicola granulosus HTCC2516]
 gi|89046974|gb|EAR53028.1| possible phospodiesterase [Oceanicola granulosus HTCC2516]
          Length = 263

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 57/261 (21%), Positives = 95/261 (36%), Gaps = 21/261 (8%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + HF R +    E+   L+  +     D V+I+GD        +   +  +L  
Sbjct: 3   RILHLSDLHFGRDRA---ELEAPLLRSVDKLAPDLVAISGDFTQRARVGQFERARRFLEK 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           IG P     VPGNHD  +     ++   WK Y       +    L P      N+ + G 
Sbjct: 60  IGQP--WLAVPGNHDTPLDNLLVRAFAPWKRYRE-----AISDDLEPNFE-NENVVVAGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           +T          G+  +   +        AN +   RI+M+HHP           M G  
Sbjct: 112 NTVNPFSW--QRGHISRRTVNRVCAAF--ANIERRVRIVMLHHPLQHGPEVDKRLMRGAN 167

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYI 272
                +   GAD++L GH H   +   +    L+ V    S S ++       ++NL  +
Sbjct: 168 EALARLEECGADIVLSGHLHNTIVRPFRAAPGLLFVQAGTSLSDRLRGE--PNTFNLLDV 225

Query: 273 EKKNEYWTLEGKRYTLSPDSL 293
                   +    Y+   D+ 
Sbjct: 226 AHG----EVAITSYSAGDDAE 242


>gi|253699990|ref|YP_003021179.1| metallophosphoesterase [Geobacter sp. M21]
 gi|251774840|gb|ACT17421.1| metallophosphoesterase [Geobacter sp. M21]
          Length = 266

 Score =  170 bits (430), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 54/285 (18%), Positives = 101/285 (35%), Gaps = 41/285 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD H                             +  V   L+        D +
Sbjct: 1   MSTILHISDTHFGTE-------------------------TPAVIEALLQLAGDQRPDLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+       +   +  +L  +  PH + ++PGNHD  +     +    + ++  S 
Sbjct: 36  VLSGDVTQRARAAQFKAAVEFLERMPVPH-LLVLPGNHDLPLFNILGRVFSPYGNFQRS- 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G+ + P       + ++G +T         +G     Q    S+ LR    +   
Sbjct: 94  ----FGRDMEPVFE-SQELLVVGVNTTRPW--RHKHGEVSPRQIETVSRRLRSGRAEQL- 145

Query: 189 RIIMMHHPPVLDTSSL-YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN----EK 243
           R+++ H P      S   N +   +         GADL+L GH HL  +  +K      +
Sbjct: 146 RVVVAHQPVRATRESDVRNLLRNHRSAIHAWAEAGADLVLGGHVHLPHVRPLKEVHEIPR 205

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
            +  V+   + S++V    P  S NL    K++E  +   +R+  
Sbjct: 206 AVWSVLAGTAVSRRVRGEIP-NSVNLIRYRKEDEPRSCLVERWDY 249


>gi|296532717|ref|ZP_06895403.1| metallophosphoesterase [Roseomonas cervicalis ATCC 49957]
 gi|296266955|gb|EFH12894.1| metallophosphoesterase [Roseomonas cervicalis ATCC 49957]
          Length = 282

 Score =  168 bits (427), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 60/269 (22%), Positives = 106/269 (39%), Gaps = 28/269 (10%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +RI  + + HF R     + VA  LI+ +     D V I+GD+     +RE   +  ++ 
Sbjct: 4   RRIDHISDLHFGRV---DERVAAALIDTLNAEPADLVVISGDLTMRARSREYRAACAFMS 60

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           ++  P    +VPGNHD       E+ L  +  +         G +  P+ R  +++A+IG
Sbjct: 61  ALKAPQ--IVVPGNHDITNYWPWERFLDPFGRWHR-----FVGGETEPFWR-DDHLAVIG 112

Query: 152 CSTAIATPPFSA--NGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRM- 208
            +T +   P  A   G   +           +    G FRI++ HHP +    +    + 
Sbjct: 113 LNTVVRAAPHLAWEEGRV-KRHRLQRLLRRLEELPPGLFRIVVAHHPFLAPEDAPDTPLA 171

Query: 209 FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN----------EKKLIPVVGIASASQKV 258
                  +++   G  LIL GH H   +   +            +  + VV   SA    
Sbjct: 172 HRAAPALEVLQRAGVRLILSGHLHRGYVRLHRGTGTAETASGHTRPELLVVQAGSAISTR 231

Query: 259 HSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
              +P A YN   I  ++    +E +R+ 
Sbjct: 232 LRGEPNA-YNRITI--QDGQARIEPRRWD 257


>gi|15679714|ref|NP_276832.1| transcriptional regulator Icc related protein [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|2622852|gb|AAB86192.1| transcriptional regulator Icc related protein [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 262

 Score =  168 bits (427), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 49/247 (19%), Positives = 97/247 (39%), Gaps = 26/247 (10%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           K+I  + + HF  K  FS ++   L++ +   N D + ++GD+     + E   +  ++ 
Sbjct: 3   KKIAQISDVHFGEKN-FSDQLRKNLLHQLENENPDLIIVSGDLTTEGYSHEYELAAAFVD 61

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +        +PGNHDA   G                     G++ F  +   +  A+IG
Sbjct: 62  ELRTITSTYTIPGNHDARNVGLIH-------------FEKLIGRRKF--VHHDSEFAVIG 106

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMF 209
             +   + P   +G  G +Q     K L +       +I+  HH   P+ +T    N + 
Sbjct: 107 LDS---SEPDINDGQIGMDQLDWLRKELERVPDH-LCKIVTFHHHLLPIPNTGRERNILL 162

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
                 K++   G D +L+GH H+ ++  I+     +  +   +A+ +    +   S+N 
Sbjct: 163 DSGDLLKLLKEYGVDFVLNGHKHVPNVWMIEG----MVTLNSGTATTRKLRGETFPSHNQ 218

Query: 270 FYIEKKN 276
             I    
Sbjct: 219 LRINDDR 225


>gi|108760865|ref|YP_629529.1| serine/threonine protein phosphatase family protein [Myxococcus
           xanthus DK 1622]
 gi|108464745|gb|ABF89930.1| Ser/Thr protein phosphatase family protein [Myxococcus xanthus DK
           1622]
          Length = 290

 Score =  168 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 54/266 (20%), Positives = 110/266 (41%), Gaps = 17/266 (6%)

Query: 11  VLAHISDIHLSYS---PSFFELSPKRIIGLVNWHFN---RKKYFSKEVANLLINDILLHN 64
            +AH SD+H++          L  +R + L         R+   + +    +  D     
Sbjct: 8   RIAHCSDVHITEDYFALPLHRLGWRRWMALAELTVGGRARRYARAPQALAAIARDAQAAQ 67

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIG-NPHDISIVPGNHDAYISGAKE--KSLHAW 121
           VDH  ++GD+  +  + E   +   L ++  +P   +++PGNHD +  G+    +    +
Sbjct: 68  VDHFILSGDLTAYALDAEFSGARQSLGALAEDPRRCTVIPGNHDVFTPGSHRTGRFAKYF 127

Query: 122 KDYITSDTTCSTGKKLFPYLRIRN-NIALIGCSTA-IATPPFSANGYFGQEQAHATSKLL 179
              + SD      +  FP++R+     A++G  +A +   P  + G  G+ Q    + LL
Sbjct: 128 GHLLESDLPEYRREGAFPFVRLLGTEAAVVGLLSARVPRTPGLSYGVIGEAQLGGLAALL 187

Query: 180 RKANKKGFFRIIMMHHPPVLD---TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL 236
           + A  +G   ++++HH P+         ++ +       K++       +LHGH H    
Sbjct: 188 KDARLEGRAILVVVHHAPLNPHGRPDRWHHGLRDADALLKLLP-GPRYAVLHGHIHRRYH 246

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNK 262
           H    ++    V G  S+++  H   
Sbjct: 247 HPATADRPH--VFGAGSSTESGHEGY 270


>gi|197122549|ref|YP_002134500.1| metallophosphoesterase [Anaeromyxobacter sp. K]
 gi|196172398|gb|ACG73371.1| metallophosphoesterase [Anaeromyxobacter sp. K]
          Length = 268

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 94/240 (39%), Gaps = 14/240 (5%)

Query: 48  FSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD 107
            S  +A  L++ +    VDH+ +TGD+      RE   +   LR       +++VPGNHD
Sbjct: 20  HSTRLAKGLLDALREIGVDHLVVTGDLTFSGEPREFERAAELLRPFAEAGKLTVVPGNHD 79

Query: 108 AYISGAKE--KSLHAWKDYITSDTTCSTGKKLFP-YLRIRNNIALIGCSTAI-ATPPFSA 163
            +   + E  + L A                 +P  + + +   L+   +A     P++ 
Sbjct: 80  VWTEESVETGRFLRALGP---DGKGMKKAAPSYPHVVPLGDEAVLVALDSARYGDDPWTT 136

Query: 164 NGYFGQEQAHATSKLLRKANKKGFFRIIMMHH-----PPVLDTSSLYNR--MFGIQRFQK 216
            G  G EQ  A  +L R+  + G   ++  HH     P  + + +   R  +    +  +
Sbjct: 137 PGRLGGEQLRAARELAREHARLGRAVLLAFHHHVVLPPERVPSDAHVCRMPLADADQVVR 196

Query: 217 MIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           ++       +LHGH H      +       PV+   SAS+       +A   L+ +++  
Sbjct: 197 LVAEVPVAAVLHGHRHTAFRVDLPGAAGPTPVLCAGSASRTADEPVRRARAYLYEVDRTG 256


>gi|108802988|ref|YP_642925.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
 gi|108764231|gb|ABG03113.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
          Length = 311

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 60/286 (20%), Positives = 114/286 (39%), Gaps = 23/286 (8%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ + + HF +   +  E    L   +       V+++GD+     NRE   ++ +LR 
Sbjct: 3   RIVHISDLHFGKPAVY--ERLEALRALLSGMRPAAVAVSGDLTQRCANREFEQASSYLRE 60

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSL-------HAWKDYITSDTTCSTGKKLFPYLRIRN 145
           +       +VPGNHD    GA  ++L           ++  S       ++L P+L +  
Sbjct: 61  LERTAPCIVVPGNHDIRWLGAVARNLGLAGLFRRKAHEFKYSRYRRHICEELNPFLEVPG 120

Query: 146 NIALIGCSTAIA------TPPFSANGYFGQEQAHATSKLLR--KANKKGFFRIIMMHHPP 197
            + + G +TA        T      G  G  +     ++ R  +    G  RI+M+HH P
Sbjct: 121 AV-IAGLNTAHGISRGSLTRRLRDLGVIGHVRRQDVERVRRRFEQAPPGAARIVMIHHNP 179

Query: 198 VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQK 257
           +    S  + +       + +   G +LIL GH H  ++H  +     + +    + S +
Sbjct: 180 IKGQLSGRHGLSNTGWALETLAALGTELILCGHDHQEAIHATERTSPGLVISTAGTISNR 239

Query: 258 VHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           V   +  +S+NL  I ++    +L    YT +  +         +F
Sbjct: 240 VRPGR-SSSFNLVDIGEE----SLRIVTYTWNNTAKDFLPSTERLF 280


>gi|86158130|ref|YP_464915.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774641|gb|ABC81478.1| Metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 268

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 94/240 (39%), Gaps = 14/240 (5%)

Query: 48  FSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD 107
            S  +A  L++ +    VDH+ +TGD+      RE   +   LR       +++VPGNHD
Sbjct: 20  HSARLAKGLLDALREIGVDHLVVTGDLTFSGEPREFERAAELLRPFAEAGKLTVVPGNHD 79

Query: 108 AYISGAKE--KSLHAWKDYITSDTTCSTGKKLFP-YLRIRNNIALIGCSTAI-ATPPFSA 163
            +   + E  + L A                 +P  + + +   L+   +A     P++ 
Sbjct: 80  VWTEESVETGRFLRAIGP---DGKGMKKAAPSYPQVVPLGDEAVLVALDSARYGDDPWTT 136

Query: 164 NGYFGQEQAHATSKLLRKANKKGFFRIIMMHH-----PPVLDTSSLYNR--MFGIQRFQK 216
            G  G EQ  A  +L R+  + G   ++  HH     P  + + +   R  +    +  +
Sbjct: 137 PGRLGGEQLRAARELAREHARLGRAVLLAFHHHVVLPPERVPSDAHVCRMPLADADQVVR 196

Query: 217 MIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           ++       +LHGH H      +       PV+   SAS+       +A   L+ +++  
Sbjct: 197 LVAEVPIAAVLHGHRHTAFRVDLPGAAGPTPVLCAGSASRTADEPVRRARAYLYEVDRTG 256


>gi|148654842|ref|YP_001275047.1| metallophosphoesterase [Roseiflexus sp. RS-1]
 gi|148566952|gb|ABQ89097.1| metallophosphoesterase [Roseiflexus sp. RS-1]
          Length = 274

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 53/254 (20%), Positives = 96/254 (37%), Gaps = 22/254 (8%)

Query: 36  GLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFT-CNREIFTSTHWLRSIG 94
            + + H  R   F  +VA  L  +      D V ++GD+V       +      +L+ + 
Sbjct: 2   HISDLHAGR--TFHPQVAEQLAREAHDLRPDLVIVSGDLVQRADFTSQWEQIVQYLQRLP 59

Query: 95  NPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCST 154
            P    I+PGNHD  +    E+       Y            L P    R  + ++G ++
Sbjct: 60  EPR--LIIPGNHDVPLFHLFERFFRPLDRYRR-----YISSDLNPVFE-RPGLVVVGGNS 111

Query: 155 AIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH----PPVLDTSSLYNRMFG 210
           A         GY   +Q  A  +   +       +I ++HH    PP  +  S+      
Sbjct: 112 AYGWT--IDGGYVDPDQQQAMERRFARYPDD-VCKIAVLHHGVVRPPGCEQRSIVR---N 165

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVH-SNKPQASYNL 269
                +M+   G D++L GH H+  +      +K I      SAS+++    + + +YN+
Sbjct: 166 ADEVTQMLERSGVDVLLCGHHHVAYVDVAGTARKFIVCQSGTSASRRIREGTRGKNAYNV 225

Query: 270 FYIEKKNEYWTLEG 283
             IE    + +  G
Sbjct: 226 LIIEDSTIHISQRG 239


>gi|197119224|ref|YP_002139651.1| metallophosphoesterase [Geobacter bemidjiensis Bem]
 gi|197088584|gb|ACH39855.1| metallophosphoesterase [Geobacter bemidjiensis Bem]
          Length = 266

 Score =  165 bits (418), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 54/260 (20%), Positives = 103/260 (39%), Gaps = 19/260 (7%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ + + HF  +      VA  L+      + D + ++GD+       +   +  +L  +
Sbjct: 4   ILHISDTHFGTE---IPAVAEALLQLAGDLHPDLLVLSGDVTQRARGWQFKAAVDFLERM 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
             PH + ++PGNHD  +     +    + ++  S      G+ L P       + ++G +
Sbjct: 61  PVPH-LLVIPGNHDLPLFNILGRVFSPYGNFQRS-----FGRNLEPVFE-SQELLVVGAN 113

Query: 154 TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNR-MFGIQ 212
           T   +     +G     Q    S+ L+ A      R+++ H P      S     +   Q
Sbjct: 114 TTRPS--RHKHGEVSPRQIETVSRRLQ-AGSPRQLRVVVAHQPVRATRQSDVKNLLRNHQ 170

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKN----EKKLIPVVGIASASQKVHSNKPQASYN 268
                    GADLIL GH HL  +  +K      + +  V+   + S++V  + P  S N
Sbjct: 171 SAIHAWAEAGADLILGGHVHLPHVRLLKEVHGIPRAVWSVLAGTAVSRRVRGDIP-NSVN 229

Query: 269 LFYIEKKNEYWTLEGKRYTL 288
           L    K++E  +   +R+  
Sbjct: 230 LIRYRKEDEPRSCLVERWDY 249


>gi|51244721|ref|YP_064605.1| hypothetical protein DP0869 [Desulfotalea psychrophila LSv54]
 gi|50875758|emb|CAG35598.1| hypothetical protein DP0869 [Desulfotalea psychrophila LSv54]
          Length = 1076

 Score =  165 bits (418), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 67/331 (20%), Positives = 117/331 (35%), Gaps = 64/331 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL------LH 63
             + H+SD+    +  FF+          N   + + +    +   L  D+         
Sbjct: 7   LTILHLSDLQFGKNHRFFQ---------SNI--SEENFNFSTLQARLQTDLKIVKSKYDL 55

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGN-----PHDISIVPGNHD-------AYIS 111
             D + ITGD+V +    E   +  +   + +       ++ IVPGNHD       AY +
Sbjct: 56  EPDLIVITGDLVEYGQQSEFDQAKVFFNELASFLNVHISNVLIVPGNHDINRKACEAYFA 115

Query: 112 G----------AKEKSLHAWKDYITS---------DTTCSTGKKLFPYLRIRNNIALIGC 152
                        +     +K++  S         D     G   +P L+    +A+   
Sbjct: 116 ECEADEKKPTLPYKPKWRHFKNFYNSFYSDISRKFDLETPFGCTEYPELK----VAVANL 171

Query: 153 STAI--ATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
           ++ +  +       G  G+ QA   ++ L K   +G+F I  +HH  V       + +  
Sbjct: 172 NSTVQESHQEKDHYGLIGENQAQKIAEQLAKRKDEGWFNIAAVHHNVVRGAIEDDDNLRD 231

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASAS--QKVHSNKPQASYN 268
            +  Q++I     DLILHGHTH   +HW       +PV+G  SAS  +    ++    Y 
Sbjct: 232 SEMLQRVIGDH-IDLILHGHTHRGKMHWW---SPQLPVIGTGSASVEKSARPDEVPNQYQ 287

Query: 269 LFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
           L                   +PD      D 
Sbjct: 288 LLKFTGLGFTRYC----RAFAPDEAKWIPDS 314


>gi|242398150|ref|YP_002993574.1| Predicted phosphohydrolase [Thermococcus sibiricus MM 739]
 gi|242264543|gb|ACS89225.1| Predicted phosphohydrolase [Thermococcus sibiricus MM 739]
          Length = 504

 Score =  165 bits (417), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 64/297 (21%), Positives = 112/297 (37%), Gaps = 50/297 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   ++         G                 +L+ N+I   + + V
Sbjct: 1   MIKIAHISDTHITSGEAYK--------GY--------------AYDLIANEINTLDYNLV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ N     E   +++ L+ I  P  + ++PGNHDA   G        ++ YI   
Sbjct: 39  IHTGDVTNDGLREEYERASYELKKIQKP--LIVLPGNHDARNVG-----YELFQKYIGPL 91

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 K          ++ +I   +   T P   +G  G  +     + L + + K  F
Sbjct: 92  NGIYEWK----------DLVIIWTDS---TIPDLNDGRIGGYKFRWLKEKLEEYSHK-KF 137

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +I+  HH   P+ DT    N +F      +++     +L L GH H+ +++ ++     +
Sbjct: 138 KIVASHHHLVPLPDTGRERNVLFNAGDVLELLLKHEVNLYLCGHKHVPNIYSVEG----L 193

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            V      S +        SYN+  I K N   ++  KR T              IF
Sbjct: 194 VVANSGCTSCRKTRKGDVNSYNMIKI-KDNGKISVTIKRVTEDIHKRDFTVKKQRIF 249



 Score = 93.0 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 58/255 (22%), Positives = 93/255 (36%), Gaps = 33/255 (12%)

Query: 24  PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHVSITGDIVNFTCNRE 82
           P    L   RII +   + + + YF ++V    I  I      D V   GDIV     R 
Sbjct: 251 PRKKRLF--RIIQISESNVSDRIYFREKVLKNAIKAINERYKPDLVVHCGDIVEVGIERY 308

Query: 83  IFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLR 142
              +      I       IVPG++D    G        +++Y              P + 
Sbjct: 309 YKKAYALWEKIKG--KKIIVPGHNDITYLG-----YELFREYFG-----------EPEII 350

Query: 143 IRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--PVLD 200
              N   I   +A    P    G  GQ+      K       +  FR+I+MHH   P+  
Sbjct: 351 ENENFTFIPIISAQYETPIGVVGRIGQKILREHLK-----KYEDTFRVIIMHHNITPIPK 405

Query: 201 TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHS 260
           +  +   +       K++  E A+L+L GH      + +  + +  P+V   S S ++H 
Sbjct: 406 SREIG-FLEDGGNVLKILTDEKANLVLTGH----GGNSLGMKIEQTPIVNAGSISWELHR 460

Query: 261 NKPQASYNLFYIEKK 275
           N    S+NL  I + 
Sbjct: 461 NPFGNSFNLIDIYED 475


>gi|20094867|ref|NP_614714.1| calcineurin superfamily phosphohydrolase [Methanopyrus kandleri
           AV19]
 gi|19888094|gb|AAM02644.1| Predicted calcineurin superfamily phosphohydrolase [Methanopyrus
           kandleri AV19]
          Length = 270

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 59/279 (21%), Positives = 98/279 (35%), Gaps = 48/279 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H+S                       +K +S EV    I  I     D V +
Sbjct: 4   KIVHISDLHISPY---------------------RKSWSPEVFYRGIEQINDLRPDVVIV 42

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ +    RE    +  L  I  P  +  VPGNHDA   G           ++T    
Sbjct: 43  TGDLTDNGLVREYEEVSSLLEKIEAP--VVPVPGNHDARNLG-----------WMT---F 86

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                  +   R+  ++ ++G  +   + P    G  G+E+     + LR+        I
Sbjct: 87  EDVFGDRYRVERVSADLYVVGLDS---SEPDVDYGQLGRERQEWLEETLRRIPGGACKCI 143

Query: 191 IMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            M HH  PV       N +        +    G DL+L GH H+     +++      VV
Sbjct: 144 AMHHHLLPVPGAGRERNVLVDAGEMINLCIKYGVDLVLCGHRHVPFAAKVED----TVVV 199

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKN---EYWTLEGKR 285
              + S        + S+N+    +       + +  +R
Sbjct: 200 NAGTFSATKLRGYSRNSFNVIEFSESTVSVNLYEITTER 238


>gi|57640972|ref|YP_183450.1| calcineurin superfamily metallophosphoesterase [Thermococcus
           kodakarensis KOD1]
 gi|57159296|dbj|BAD85226.1| metallophosphoesterase, calcineurin superfamily [Thermococcus
           kodakarensis KOD1]
          Length = 502

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 58/280 (20%), Positives = 105/280 (37%), Gaps = 50/280 (17%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
            M  +AHISD H++   +F         G                 +L++ +I   N D 
Sbjct: 2   GMIRIAHISDTHITNEGAFK--------GY--------------AFDLIVEEINRGNFDF 39

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V  TGDI N     E   + + L+ I  P  + ++PGNHD    G        ++D+I  
Sbjct: 40  VIHTGDITNQGLREEYEQAAYQLKKIQKP--LVVLPGNHDVRNVG-----YKLFEDFIGP 92

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                           R+ + +I   +   T P  ++G  G  +     + L + + +  
Sbjct: 93  LNG---------VYEFRDGV-VIWVDS---TIPDLSDGRIGGHKFRWLKERLEEYSDR-R 138

Query: 188 FRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           F+I+  HH   P+ DT    N +F       ++   G  L   GH H+ +++ +++    
Sbjct: 139 FKIVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLRHGVTLYTCGHKHVPNVYRVED---- 194

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKR 285
           + +      S K        SYN+  +        +  +R
Sbjct: 195 LIIDNAGCTSCKKTRKGDVNSYNIIELYDDGRV-RVTIRR 233



 Score = 89.6 bits (221), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 59/251 (23%), Positives = 99/251 (39%), Gaps = 31/251 (12%)

Query: 24  PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHVSITGDIVNFTCNRE 82
           PS   L   RI+ +   + + + YF ++    ++  I      D V   GD+V+    R 
Sbjct: 253 PSGRRLF--RIVQMSESNVSDRVYFRRKTLENVVRMINERLRPDLVVHNGDMVDAGIER- 309

Query: 83  IFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLR 142
            +   +    +  P  I +VPG++D    G        +++Y              P + 
Sbjct: 310 YYERAYEYYKLVKPQKI-LVPGHNDITYLGH-----ELFQEYFG-----------EPEVL 352

Query: 143 IRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVL-DT 201
              +I +I   +A    P    G  GQ+        LR+   +G FRI++MHH  +    
Sbjct: 353 ELGDIVIIPVLSAQYETPIGVVGRMGQK---KLRNTLREY--EGKFRIVVMHHNVIPVPK 407

Query: 202 SSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSN 261
           S     +       K++  EG +L+L GH        I+N     P+V   S S ++H N
Sbjct: 408 SREIGFLEDAGDVLKVLTDEGTELVLTGHGGNAFGVKIEN----TPIVNAGSVSWELHRN 463

Query: 262 KPQASYNLFYI 272
               S+NL  I
Sbjct: 464 PFGNSFNLVDI 474


>gi|312137489|ref|YP_004004826.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
 gi|311225208|gb|ADP78064.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
          Length = 247

 Score =  163 bits (412), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 59/277 (21%), Positives = 100/277 (36%), Gaps = 48/277 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +AH+SD H+                        +  F +++    +N +     D V ++
Sbjct: 3   IAHLSDFHVG-----------------------EFKFKEKLLKKALNQVKNIRPDVVIVS 39

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GDI N    +E   +  +L  I        VPGNHDA   G        +++ I   +  
Sbjct: 40  GDITNNGYYQEFIEAKKYLDEISEIIPTITVPGNHDARHVG-----YEVFEEVIGPRSGV 94

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
              K             +IG  +   + P    G  G+EQ     K L+KA  K  F+I+
Sbjct: 95  LKNKNK--------KFVVIGLDS---SEPDLDCGKIGREQQKWLEKELKKA--KNKFKIV 141

Query: 192 MMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            +HH   PV  T    N +       + +     DL++ GH H+     ++         
Sbjct: 142 ALHHHIIPVPKTGRERNVLLDAGDILESLVKYDVDLVVCGHRHVPYSWNLEG----CVFA 197

Query: 250 GIASASQKVHSNKPQASYNLFYI-EKKNEYWTLEGKR 285
              + S      K   SYN++ + EK+ +    E + 
Sbjct: 198 TAGTVSSPSLRAKNPNSYNVYLVNEKEIKVKLCEVEG 234


>gi|319796022|ref|YP_004157662.1| metallophosphoesterase [Variovorax paradoxus EPS]
 gi|315598485|gb|ADU39551.1| metallophosphoesterase [Variovorax paradoxus EPS]
          Length = 275

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 49/270 (18%), Positives = 97/270 (35%), Gaps = 22/270 (8%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           ++ + + HF  ++    EV   L           V ++GDI       +   +  ++  +
Sbjct: 5   LLQISDPHFGTEQ---PEVLRALERFAEALAPQVVVMSGDITQRATRVQFAAARAFVDRL 61

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
             P    +VPGNHD  +     +    +  Y       + G  L P     + + +    
Sbjct: 62  AAPAK-LVVPGNHDIPLFQLAARCFSPYGRYRE-----AFGDDLEPAFESEDWLVV---- 111

Query: 154 TAIATPPFSAN-GYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSS-LYNRMFGI 211
           T   T  +  + G     Q    ++ L  A+     R+++ H P ++     L NR+ G 
Sbjct: 112 TVNTTRWYRHSDGVVSPAQVERVAQRLAAASPSQL-RVVVTHQPVMVTREEDLSNRLHGR 170

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNE-----KKLIPVVGIASASQKVHSNKPQAS 266
           +R        G DLIL GH HL  +  + +      +    V    + S +V +     S
Sbjct: 171 ERAVARWSEAGVDLILGGHIHLPYVRSLHDAFSGCKRTAFAVQAGTAVSHRVRAGF-ANS 229

Query: 267 YNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
            N+  +    +      +R+  +    + +
Sbjct: 230 VNVVRLAMSGDTRACRVERWDYAAAGKAFE 259


>gi|239817707|ref|YP_002946617.1| metallophosphoesterase [Variovorax paradoxus S110]
 gi|239804284|gb|ACS21351.1| metallophosphoesterase [Variovorax paradoxus S110]
          Length = 274

 Score =  161 bits (408), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 49/269 (18%), Positives = 97/269 (36%), Gaps = 20/269 (7%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           ++ + + HF  ++    +V   L           V ++GDI      R+   +  ++  +
Sbjct: 4   LLQISDTHFGTEQ---PDVMAALERLAQTLAPQVVVLSGDITQRATRRQFAAARAFVDRL 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
             P  +  +PGNHD  +     +    +  Y       + G  L P     + + ++  +
Sbjct: 61  AAPA-VVAIPGNHDIPLFQLGARLFSPYGRY-----AGAFGTDLEPVFESADWL-VVAVN 113

Query: 154 TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVL-DTSSLYNRMFGIQ 212
           T        A+G     Q    +  L  A      R+++ H P ++     + NR+ G +
Sbjct: 114 TTRWW--RHADGEVSPAQIERVAARLAGALPSQL-RVVVTHQPVMVTRQEDMQNRLHGRE 170

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKN-----EKKLIPVVGIASASQKVHSNKPQASY 267
                    GADLIL GH HL  +  +        +    V    + S +V +  P  S 
Sbjct: 171 AAVARWCAAGADLILGGHIHLPFVRSLHGAYAGCPRTAWAVQAGTAVSSRVRAGHP-NSV 229

Query: 268 NLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
           N+  +    +    + +R+  S    +  
Sbjct: 230 NVLRLGAPEDGRVCQAERWDHSAADKAFV 258


>gi|124266912|ref|YP_001020916.1| putative DNA repair exonuclease [Methylibium petroleiphilum PM1]
 gi|124259687|gb|ABM94681.1| putative DNA repair exonuclease [Methylibium petroleiphilum PM1]
          Length = 265

 Score =  161 bits (407), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 52/265 (19%), Positives = 98/265 (36%), Gaps = 17/265 (6%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           ++ + + HF  ++     V   L         D V ++GDI       +   +  ++  +
Sbjct: 4   LLQISDTHFGTEQ---GAVVEALGTLAHQQRPDVVVLSGDITQRARPAQFRAARSFVDRL 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
           G P  +  VPGNHD  +     +    +  Y     + + G  L P  R    + +    
Sbjct: 61  GAP--VLAVPGNHDIPLFDLWARLRSPYGRY-----SAAFGIDLEPVHRSPELLVV---C 110

Query: 154 TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMFGIQ 212
                P    +G     Q    ++L+  A+     R++++H P  V       NR+ G  
Sbjct: 111 VNTTRPWRHKDGEVSALQIDRVARLVEHADPAQL-RVVVVHQPIAVTRAEEEPNRLRGHA 169

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASA-SQKVHSNKPQASYNLFY 271
              +     GADL++ GH HL  +  ++   + + VV   +A S +V    P  S NL  
Sbjct: 170 AALQPWAEAGADLVMGGHIHLPYVMPLQGLARSLWVVQAGTAVSSRVRDGMP-NSVNLLR 228

Query: 272 IEKKNEYWTLEGKRYTLSPDSLSIQ 296
                       +++    D  + +
Sbjct: 229 WGADAAPGCCRIEQWDYKGDDRAFR 253


>gi|14590054|ref|NP_142118.1| hypothetical protein PH0104 [Pyrococcus horikoshii OT3]
 gi|3256490|dbj|BAA29173.1| 505aa long hypothetical protein [Pyrococcus horikoshii OT3]
          Length = 505

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 57/267 (21%), Positives = 102/267 (38%), Gaps = 47/267 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           ++AHISD H++   +F   +                       +L++N+I     D V  
Sbjct: 5   LIAHISDTHITNEVAFKSYA----------------------YDLIVNEINTKPFDLVVH 42

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ N     E   +++ ++ I  P  + +VPGNHDA   G        ++ YI     
Sbjct: 43  TGDVTNNGLREEYEHASYLIKKIEKP--LVVVPGNHDARNVG-----YELFEKYIG---- 91

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                 L+      N + +I   +   T P  ++G  G  +     + L   + K    +
Sbjct: 92  -----PLYGVYEFDNGV-IIWLDS---TIPDLSDGRVGGYKFKWLKEKLEAYSHKKIKIV 142

Query: 191 IMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
              HH  P+ DT    N +F       ++      L + GH H+ +++ +++    + V 
Sbjct: 143 AAHHHLVPLPDTGRERNVLFNAGDVLDLLLTHEVTLYMCGHKHVPNVYRVED----LVVD 198

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKN 276
               AS +        SYN+  I  K 
Sbjct: 199 NAGCASCRKTRKGDVNSYNIVKITDKG 225



 Score = 80.3 bits (197), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 49/262 (18%), Positives = 87/262 (33%), Gaps = 32/262 (12%)

Query: 19  HLSYSPSFFELSPKR---IIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHVSITGDI 74
           H    P  F    +R   I+ +   + + + YF K      I  I      D V   GD+
Sbjct: 242 HNPIRPKIFIPRGRRLLRIVQISESNVSDRVYFRKRTLENAIKAINEKYKPDIVIHCGDV 301

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
           V     R    +  +   +    +  IVPG++D    G        +++Y          
Sbjct: 302 VEKGIERYYEKAMEYYEKVKG--EKIIVPGHNDISYLG-----YELFREYFG-------- 346

Query: 135 KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR-IIMM 193
               P +    +   I   +A         G  GQ+      +  R+      FR +IM 
Sbjct: 347 ---EPEVLELGDFVFIPILSAQYETQIGVVGRTGQKMLSRMLEEFRE-----KFRIVIMH 398

Query: 194 HHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIAS 253
           H+   +        +       K+I     +L L GH      +    + +  P++   S
Sbjct: 399 HNLVPVPGVKEIGYLEDAGNVLKIITENETELTLTGH----GGNTSAVKVEKSPIINAGS 454

Query: 254 ASQKVHSNKPQASYNLFYIEKK 275
            S ++H N    S+N+  I + 
Sbjct: 455 ISWELHRNPFGNSFNIIDIYED 476


>gi|83647079|ref|YP_435514.1| phosphohydrolase [Hahella chejuensis KCTC 2396]
 gi|83635122|gb|ABC31089.1| predicted phosphohydrolase [Hahella chejuensis KCTC 2396]
          Length = 275

 Score =  158 bits (401), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 60/269 (22%), Positives = 102/269 (37%), Gaps = 23/269 (8%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           II L + HF  +      V   L+  +     + +  +GDI       +   +  +L  I
Sbjct: 3   IIQLSDPHFGTE---DWTVQEALVRTLNDMRPELLLFSGDITQRATRLQFAAARAFLERI 59

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALI-GC 152
               ++  VPGNHD  +     +    +K Y         G  L P     NN+ALI G 
Sbjct: 60  EA-DNVLAVPGNHDIPLFNLWSRLTAPYKKY-----CEIFGTDLEPEFE--NNLALIVGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMFGI 211
           +T         +G    ++A A ++ L  A  K   R+++ HHP  V+  S   N + G 
Sbjct: 112 NTTH--KYRHVDGEISPQRADAVARRLASAPDK--LRVVVAHHPCQVVLPSDQKNLLIGR 167

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP----VVGIASASQKVHSNKPQASY 267
           +   K     G DL+L GH H   +  ++      P    V+   +A+     +    S+
Sbjct: 168 EYALKAWIEAGVDLVLGGHIHYPFILPLRESFPEAPSGVFVMQAGTATSPRVRSGKPNSF 227

Query: 268 NLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
           N   + +      LE  R+     +   +
Sbjct: 228 NRILVRRDRRMTLLE--RWDYDSATGRFR 254


>gi|332158280|ref|YP_004423559.1| lacZ expression regulatory protein [Pyrococcus sp. NA2]
 gi|331033743|gb|AEC51555.1| lacZ expression regulatory protein [Pyrococcus sp. NA2]
          Length = 502

 Score =  158 bits (401), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 57/267 (21%), Positives = 100/267 (37%), Gaps = 47/267 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           ++AHISD H++   +F   +                       +L+ N++     D V  
Sbjct: 2   LIAHISDTHITNEVAFKSYA----------------------YDLIANEVNTKPFDLVIH 39

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ N     E   +++ LR I  P  + +VPGNHDA   G        ++ YI   + 
Sbjct: 40  TGDVTNNGLREEYEHASYLLRKIEKP--LVVVPGNHDARNVG-----YELFEKYIGPLSG 92

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               K             LI   +   T P  ++G  G  +     + L + + K    +
Sbjct: 93  VYEFKDG----------VLIWIDS---TIPDLSDGRVGGYKFKWLKEKLEEYSHKRIKIV 139

Query: 191 IMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
              HH  P+ DT    N +F       ++      L + GH H+ +++ +++    + V 
Sbjct: 140 AAHHHLVPLPDTGRERNVLFNAGDVLDLLLSHEVTLYMCGHKHVPNVYRVED----LVVD 195

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKN 276
               AS +        SYN+  I +  
Sbjct: 196 NAGCASCRKTRKGDVNSYNIVKITEDG 222



 Score = 90.7 bits (224), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 55/262 (20%), Positives = 93/262 (35%), Gaps = 32/262 (12%)

Query: 19  HLSYSPSFFELSPKR---IIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHVSITGDI 74
           H    P  F    +R   I+ +   + + + YF K      I  I      D V   GD+
Sbjct: 239 HKPIRPKIFIPRGRRLLRIVHVSESNVSDRVYFRKRTLENAIRAINEKYKPDIVVHCGDV 298

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
           V     R    +  +   +    +  IVPG++D    G        +K+Y          
Sbjct: 299 VEKGIERYYEKAFEYYEKVK--AEKIIVPGHNDISYLG-----YELFKEYFG-------- 343

Query: 135 KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMH 194
               P +  R N   I   +A      +  G  G+      + LL   ++K  FRI++MH
Sbjct: 344 ---EPEIVERGNFVFIPILSAQYE---TQIGVVGRTGQKMLANLLEDFSEK--FRIVIMH 395

Query: 195 HPPVL-DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIAS 253
           H  V          +       K+I  +  +L L GH      +    + +  P++   S
Sbjct: 396 HNVVPVPGVREIGYLEDAGNVLKIITEKETELTLTGH----GGNTSAVKVEKSPIINAGS 451

Query: 254 ASQKVHSNKPQASYNLFYIEKK 275
            S ++H N    S+N+  I + 
Sbjct: 452 ISWELHRNPFGNSFNIIDIYED 473


>gi|18976460|ref|NP_577817.1| icc related protein [Pyrococcus furiosus DSM 3638]
 gi|18891999|gb|AAL80212.1| icc related protein [Pyrococcus furiosus DSM 3638]
          Length = 501

 Score =  158 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 55/267 (20%), Positives = 103/267 (38%), Gaps = 47/267 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           ++AHISD H++   +F   +                       +L++N+I     D V  
Sbjct: 2   LIAHISDTHITNEVAFKAYA----------------------FDLIVNEINTRPFDLVIH 39

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ N     E   +++ L+ I  P  + + PGNHDA   G        ++ YI     
Sbjct: 40  TGDVTNNGLREEYEHASYLLKKIEKP--LIVAPGNHDARNVG-----YELFERYIG---- 88

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                 LF     ++ + +I   +   T P  ++G  G  +     + L + + K     
Sbjct: 89  -----PLFGVYEFKDGV-IIWVDS---TIPDLSDGRIGGYKFRWLKEKLEEYSNKKIKIA 139

Query: 191 IMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  HH  P+ DT    N ++       ++      L + GH H+ +++ +++    + V 
Sbjct: 140 VAHHHLVPLPDTGRERNVLYNAGDVLDLLLSHDVTLYMCGHKHVPNVYRVED----LVVA 195

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKN 276
                S +        SYN+  I +K 
Sbjct: 196 NAGCTSCRKTRKGDVNSYNIVKISEKG 222



 Score =  100 bits (249), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 57/266 (21%), Positives = 101/266 (37%), Gaps = 40/266 (15%)

Query: 19  HLSYSPSFFELSPKRI---IGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHVSITGDI 74
           H+   P  F    +RI   + L   + + +KYF K V   ++  I      D V   GD+
Sbjct: 239 HVPIRPKIFVPRGRRIFRIVHLSESNVSDRKYFRKNVIENVVKAINEKYKPDLVIHCGDV 298

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
           V     R    +  +  SI +  +  ++PG H+ Y     E     + +           
Sbjct: 299 VEKGIERFFDMAIDYYESIKS--EKLVIPG-HNDYTYLGPELFREYFGE----------- 344

Query: 135 KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMH 194
               P +   N+   I   +A    P    G  GQ+     + LL + ++K  FR++++H
Sbjct: 345 ----PEIIELNDFVFIPLISAQYETPIGVVGRIGQK---MLANLLEEYSEK--FRVVVLH 395

Query: 195 HP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGH---THLNSLHWIKNEKKLIPVV 249
           H   P+     +   +       K+I     +L+L GH   +H   +          P+V
Sbjct: 396 HNLVPIPRAKEIG-YLEDAGNVLKIITDANTELVLTGHGGNSHAVKVE-------STPLV 447

Query: 250 GIASASQKVHSNKPQASYNLFYIEKK 275
              S S ++H N    S+N+  I + 
Sbjct: 448 NAGSVSWELHRNPFGNSFNIVDIYED 473


>gi|146277006|ref|YP_001167165.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17025]
 gi|145555247|gb|ABP69860.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17025]
          Length = 270

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 52/276 (18%), Positives = 96/276 (34%), Gaps = 24/276 (8%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           KR++ L + HF R +    E+   LI  +     D V+I+GD+       +   +  ++ 
Sbjct: 2   KRLLHLSDLHFGRDR---PELLRPLIETVNGLAPDLVAISGDLTQRATEAQFRAAAAFVE 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  P  + +VPGNHD  +     + +  WK Y         G+ L P     + + + G
Sbjct: 59  RLKPP--VLVVPGNHDVPLHNLYVRLVKPWKRYRRW-----FGRDLEPCWE-DDEMIVAG 110

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI 211
            +T          G+F         ++      +    ++    P           M G 
Sbjct: 111 ANTVNPLAW--QQGWFRSRSLARIRRIFANEESRVRVVVVHH--PMEHTPEDTKELMRGA 166

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHW---IKNEKKLIPVVGIASASQKVHSNKPQASYN 268
            R    +   GAD+IL GH H   +     +     ++ V      S +V        +N
Sbjct: 167 GRAIGELAECGADVILSGHLHTWRVGPFAEVDGRGVVLQVHAGTGLSTRVRGE--PNDFN 224

Query: 269 LFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           L  +        +  +R+T   D    +   +  F 
Sbjct: 225 LLEVSAD----RIHVQRHTALEDGSGFRPTETRTFR 256


>gi|46204008|ref|ZP_00209211.1| COG1409: Predicted phosphohydrolases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 292

 Score =  158 bits (400), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 52/274 (18%), Positives = 87/274 (31%), Gaps = 34/274 (12%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +R+  + + HF R       V   L+ ++     D +  +GD       RE   +  +L 
Sbjct: 2   RRLAHISDLHFGRT---DPAVVEGLVAELNRAPPDLIVASGDFTMRARRREYAEARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  P     VPGNHD        +  H ++ Y          +   P   + + IA+I 
Sbjct: 59  RLAAP--WIAVPGNHDIAYFKLFTRFFHPFRRYRR-----FIAQDTEPTF-LDDEIAVIC 110

Query: 152 CSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
            +T     P    + G   + Q   T + L     +  FRI++ HHP +        R+ 
Sbjct: 111 LNTVRTWAPETDWSQGKITRTQIARTEERLAAVPPQ-VFRIVVGHHPFMPPPWDAEARLV 169

Query: 210 G-IQRFQKMIWHEGADLILHGHTHLNSLHWIKNE-------------------KKLIPVV 249
           G            G  L L GH H +   + +                        +  V
Sbjct: 170 GRADEALDAFRRHGVGLTLAGHLHRHYARFAEAPATGTEPDAVAVDRGVARASGTRLLAV 229

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
              SA+          +YN   I       T+  
Sbjct: 230 QAGSATSTRLRGNEPNAYNRIVIADGQATVTVRI 263


>gi|156740243|ref|YP_001430372.1| metallophosphoesterase [Roseiflexus castenholzii DSM 13941]
 gi|156231571|gb|ABU56354.1| metallophosphoesterase [Roseiflexus castenholzii DSM 13941]
          Length = 278

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 62/286 (21%), Positives = 109/286 (38%), Gaps = 46/286 (16%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           + +VL HISD+H                          + F   VA+ L  +      D 
Sbjct: 1   MRYVLMHISDLHAG------------------------RTFHPHVADQLTREARDLRPDL 36

Query: 68  VSITGDIVNFT-CNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           + I+GD+V       +    T +L+ +  P    IVPGNHD  +    E+       Y  
Sbjct: 37  LIISGDLVQRADFVAQWKAITQYLQQLPEPR--LIVPGNHDVPLFHLVERFFRPLDRYRR 94

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                     L P    R  I ++G ++A         GY   EQ    ++L  +     
Sbjct: 95  -----FISTDLNPVFE-RPGIVVVGGNSAHGLT--IDGGYVSPEQQRTMAQLFVRYPDD- 145

Query: 187 FFRIIMMHH----PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +I ++HH    PP  +  S+      + R   M+   G D++L GH H++ +    + 
Sbjct: 146 VCKIAVLHHGVVRPPGCEKRSIVRNATDVTR---MLEQSGVDVLLCGHHHVSYVGVAGSA 202

Query: 243 KKLIPVVGIASASQKVHSNKP-QASYNLFYIEKKNEYWTLEGKRYT 287
           K+ +      S S++V + +  + +Y++  IE       +  +RY 
Sbjct: 203 KRFVVCQSGTSTSRRVRAGERGRNAYSVLTIEDA--TIHISQRRYV 246


>gi|188584121|ref|YP_001927566.1| metallophosphoesterase [Methylobacterium populi BJ001]
 gi|179347619|gb|ACB83031.1| metallophosphoesterase [Methylobacterium populi BJ001]
          Length = 294

 Score =  156 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 52/274 (18%), Positives = 87/274 (31%), Gaps = 34/274 (12%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +RI  + + HF R       V + L  ++     D +  +GD       +E   +  +L 
Sbjct: 2   RRIAHISDLHFGRT---DTAVVDALAAELNRDPPDLIVASGDFTMRARRKEYVEARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  P     VPGNHD        +  H +  Y          +   P   + + IA++ 
Sbjct: 59  GLTAP--WIAVPGNHDIAYFKLFTRFFHPFGRYRR-----FIARDTEPTF-LDDEIAVVC 110

Query: 152 CSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
            +T     P    + G   + Q   T + L     +  FRI++ HHP +        R+ 
Sbjct: 111 LNTVRTWAPETDWSQGKITRAQIARTEERLAAL-PEHVFRIVVGHHPFMPPPWDAEARLV 169

Query: 210 G-IQRFQKMIWHEGADLILHGHTHLNSLHWIKNE-------------------KKLIPVV 249
           G            G  L L GH H +   + +                        +  V
Sbjct: 170 GRADEALDAFRRHGVGLTLAGHLHRHYARFAEAPETGAEPDSVAVDRGSAQAGGTRLLAV 229

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
              SA+          +YN   IE      T+  
Sbjct: 230 QAGSATSTRLRGNEPNAYNRIVIEDGRATVTVRV 263


>gi|218515220|ref|ZP_03512060.1| putative phosphoesterase protein [Rhizobium etli 8C-3]
          Length = 132

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 61/129 (47%), Positives = 88/129 (68%)

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLN 234
           T  +LR A + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN
Sbjct: 2   TVNMLRAAGEAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLN 61

Query: 235 SLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLS 294
           +LHW++ + + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    +
Sbjct: 62  TLHWLRGQVQPVPVVGIASASQGPGSIKPAAAYNLFSIDGSPGAWELSGERFSLNRAGDA 121

Query: 295 IQKDYSDIF 303
           +  +  DIF
Sbjct: 122 VIPESVDIF 130


>gi|240102780|ref|YP_002959089.1| Metallophosphoesterase, Calcineurin-like phosphoesterase family
           [Thermococcus gammatolerans EJ3]
 gi|239910334|gb|ACS33225.1| Metallophosphoesterase, Calcineurin-like phosphoesterase family
           [Thermococcus gammatolerans EJ3]
          Length = 503

 Score =  156 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/279 (19%), Positives = 101/279 (36%), Gaps = 50/279 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   +F         G                 +L++ +I   + D V
Sbjct: 4   MIKIAHISDTHITNEGAFK--------GY--------------AFDLIVEEINRGDFDFV 41

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGDI N     E   + + L  I  P  + ++PGNHD    G        ++ +I   
Sbjct: 42  VHTGDITNQGLREEYEQAAYQLGKIRKP--LVVIPGNHDVRNVG-----YKLFEKFIGPL 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                           +N  LI   +   T P  ++G  G  +       L + + +  F
Sbjct: 95  NGVYEF----------DNGVLIWVDS---TIPDLSDGRIGGHKFRWLKAKLEEYSDR-RF 140

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +I+  HH   P+ DT    N +F       ++      L   GH H+ +++ +++    +
Sbjct: 141 KIVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLRHEVTLYTCGHKHVPNVYRVED----L 196

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKR 285
            +      S +        SYN+  +       ++  +R
Sbjct: 197 VIDNAGCTSCRKTRRGDVNSYNIIKLHDDGRV-SVTIRR 234



 Score = 88.4 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 60/272 (22%), Positives = 104/272 (38%), Gaps = 33/272 (12%)

Query: 19  HLSYSPSFFELSPKR---IIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHVSITGDI 74
           H    P  F  S KR   I+ L   + + + YF ++V   +I  I      D V   GD+
Sbjct: 244 HKPIRPKIFIPSGKRVLRIVQLSESNVSDRVYFRRKVFENVIRMINERLKPDLVIHNGDV 303

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
           V+    R    +  + R+I    +  +VPG++D    G        +++Y          
Sbjct: 304 VDAGIERYYERAYEYYRAIS--AEKLVVPGHNDITYLGH-----ELFEEYFG-------- 348

Query: 135 KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMH 194
               P +   +   +I   +A    P    G  GQ+      K+L +      FRI++MH
Sbjct: 349 ---EPEVIEFDGYVIIPVLSAQYETPIGVVGRMGQK---KLEKVLEEY--DDRFRIVVMH 400

Query: 195 HPPVL-DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIAS 253
           H  +    S     +       K++  EG +L+L GH      +    + +  P+V   S
Sbjct: 401 HNVIPIPRSREIGFLEDGGDVLKLLTREGTELVLTGH----GGNAYGVKVERTPIVNAGS 456

Query: 254 ASQKVHSNKPQASYNLFYI-EKKNEYWTLEGK 284
            S ++H N    S+NL  +       W ++  
Sbjct: 457 VSWELHRNPFGNSFNLIDVYTDMVVVWEVQAT 488


>gi|254417705|ref|ZP_05031429.1| Ser/Thr protein phosphatase family protein [Brevundimonas sp. BAL3]
 gi|196183882|gb|EDX78858.1| Ser/Thr protein phosphatase family protein [Brevundimonas sp. BAL3]
          Length = 283

 Score =  156 bits (395), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 59/261 (22%), Positives = 94/261 (36%), Gaps = 19/261 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++   + HF         VA  L         D V ITGDI       E   +  W+R+
Sbjct: 3   RVLQFSDVHFG--CEHKGAVAAAL-EYAHATPNDLVLITGDITQKGYPVEFRAAGEWMRA 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  + +  GNHD        +  H W+ +       +TG          + + + G 
Sbjct: 60  MPEPRFVIV--GNHDVPYWSPVARLFHPWRAF-----ETATGFPAHDGQFCNDTVMVRGV 112

Query: 153 STAIATP--PFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
            TA      P  + G    +Q    ++ LR+A   G  RI+  HHP V    +       
Sbjct: 113 VTARGWQARPNWSKGVIDLDQTRRAAEALRQAPI-GALRILACHHPLVEMIGTPMTGDVK 171

Query: 211 IQRFQKMI-WHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKP---QAS 266
                 +I    G DLI+ GH H+     I    +    VG  + S +   + P   Q  
Sbjct: 172 RGDEAALIFAEAGVDLIMTGHVHVPFALPIDLADRCSYAVGCGTLSHRERGSPPGFNQVD 231

Query: 267 YNLFYIEKKNEYWTLEGKRYT 287
           ++   I      W  +G+ Y+
Sbjct: 232 WDARTITVTALAW--DGRGYS 250


>gi|240141274|ref|YP_002965754.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens AM1]
 gi|240011251|gb|ACS42477.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens AM1]
          Length = 294

 Score =  156 bits (394), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 51/274 (18%), Positives = 85/274 (31%), Gaps = 34/274 (12%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +R+  + + HF R       V   L+ ++     D +  +GD       +E   +  +L 
Sbjct: 2   RRVAHISDLHFGRT---DPAVVEALVAELNRDPPDLIVASGDFTMRARRKEYVAARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  P     VPGNHD        +  H +  Y          K   P   + + IA++ 
Sbjct: 59  RLTAP--WIAVPGNHDIAYFKLLTRFFHPFGRYRR-----FIAKDTEPTF-LDDEIAVVC 110

Query: 152 CSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
            +T     P    + G   + Q   T + L        FRI++ HHP +        R+ 
Sbjct: 111 LNTVRTWAPETDWSQGKITRAQIARTEERLAALPDH-VFRIVVGHHPFMPPPWDAEARLV 169

Query: 210 G-IQRFQKMIWHEGADLILHGHTHLNSLHWIKNE-------------------KKLIPVV 249
           G               L L GH H +   + +                        +  V
Sbjct: 170 GRADEALDAFRRHNVGLTLAGHLHRHYSRFAEAPETGTEPDLVSVDRGMARAGGARLLAV 229

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
              SA+          +YN   IE      T+  
Sbjct: 230 QAGSATSTRLRGNEPNAYNRIVIEDGRATVTVRV 263


>gi|254172134|ref|ZP_04878810.1| metallophosphoesterase, calcineurin superfamily [Thermococcus sp.
           AM4]
 gi|214034030|gb|EEB74856.1| metallophosphoesterase, calcineurin superfamily [Thermococcus sp.
           AM4]
          Length = 500

 Score =  156 bits (394), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/279 (20%), Positives = 101/279 (36%), Gaps = 50/279 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   +F         G                 +L++ +I   + D V
Sbjct: 1   MIKIAHISDTHITNEGAFK--------GY--------------AFDLIVEEINRGDFDFV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGDI N     E   + + L  I  P  + ++PGNHD    G        ++ +I   
Sbjct: 39  VHTGDITNQGLREEYEQAAYQLGKIKKP--LVVIPGNHDVRNVG-----YKLFEKFIGPL 91

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                           +N  LI   +   T P  ++G  G  +       L + + K  F
Sbjct: 92  NGVYEF----------DNGVLIWVDS---TIPDLSDGRIGGHKFRWLKAKLEEYSSK-KF 137

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +I+  HH   P+ DT    N +F       ++      L   GH H+ +++ +++    +
Sbjct: 138 KIVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLRHEVTLYTCGHKHVPNVYRVED----L 193

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKR 285
            +      S +        SYN+  +       ++  +R
Sbjct: 194 VIDNAGCTSCRKTRRGDVNSYNIIRLHDDGRV-SVTIRR 231



 Score = 88.4 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 60/272 (22%), Positives = 101/272 (37%), Gaps = 33/272 (12%)

Query: 19  HLSYSPSFFELSPKR---IIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHVSITGDI 74
           H    P  F  S KR   I+ +   + + + YF ++V   +I  I      D V   GD+
Sbjct: 241 HRPIRPKIFVPSGKRVLRIVQISESNVSDRVYFRRKVFENVIRMINERLKPDLVIHNGDV 300

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
           V+    R    +  + R+I    +  +VPG++D    G        +++Y          
Sbjct: 301 VDAGIERYYERAYEYYRAIST--EKLVVPGHNDITYLGH-----ELFEEYFG-------- 345

Query: 135 KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMH 194
               P L   +   +I   +A    P    G  GQ +   T +          FRI++MH
Sbjct: 346 ---EPQLIEFDGYVIIPVLSAQYETPIGVVGRMGQRKLERTLE-----EYNDRFRIVVMH 397

Query: 195 HPPVL-DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIAS 253
           H  +    S     +       K++  E  +L+L GH        ++      P+V   S
Sbjct: 398 HNVIPIPRSREIGFLEDGGDVLKLLTRERTELVLTGHGGNAYGVKVEG----TPIVNAGS 453

Query: 254 ASQKVHSNKPQASYNLFYI-EKKNEYWTLEGK 284
            S ++H N    S+NL  I E     W ++  
Sbjct: 454 VSWELHRNPFGNSFNLIDIYEDMVVVWQVQAT 485


>gi|162457579|ref|YP_001619946.1| hypothetical protein sce9293 [Sorangium cellulosum 'So ce 56']
 gi|161168161|emb|CAN99466.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
          Length = 269

 Score =  155 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 54/277 (19%), Positives = 106/277 (38%), Gaps = 23/277 (8%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           ++ L + HF R     K +   LI  I       V I+GD+     + E   +  +L ++
Sbjct: 4   LVHLSDLHFGRV---DKAILRPLIERIGGLEPHVVVISGDLTQRARDAEFAEARAFLDAL 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
            +P    +VPGNHD  +    ++       Y +  T   +     P+  +   IA++G +
Sbjct: 61  PSPR--IVVPGNHDVPLYNLFDRFFRPLDRYRSHITDDLS-----PF-HLDAEIAVLGIN 112

Query: 154 TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQR 213
           TA +      +G     Q       +     +   +I++ HHP  L  +S +  +   ++
Sbjct: 113 TARSLT--IKDGRINARQVEGIKARMCDLGPE-ITKIVVTHHPFDLPENSPHAIVGRARQ 169

Query: 214 FQKMIWHEGADLILHGHTHLNSLHW----IKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
               I   G D+IL GH H++                 +V   +A+      +  A +N+
Sbjct: 170 AMAAIAGCGVDVILSGHLHMSHTGHSAERFDAGGHSSLIVQAGTATSTRGRGEQNA-FNV 228

Query: 270 FYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDT 306
             +    +   +  +RY   P+        ++ F +T
Sbjct: 229 IRV----DGRKIHIERYFWQPEDGLFGIAITEHFEET 261


>gi|218532766|ref|YP_002423582.1| metallophosphoesterase [Methylobacterium chloromethanicum CM4]
 gi|254563783|ref|YP_003070878.1| metallophosphatase/metallophosphoesterase [Methylobacterium
           extorquens DM4]
 gi|218525069|gb|ACK85654.1| metallophosphoesterase [Methylobacterium chloromethanicum CM4]
 gi|254271061|emb|CAX27068.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens DM4]
          Length = 294

 Score =  155 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 51/274 (18%), Positives = 85/274 (31%), Gaps = 34/274 (12%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +R+  + + HF R       V   L+ ++     D +  +GD       +E   +  +L 
Sbjct: 2   RRVAHISDLHFGRT---DPAVVEALVAELNRDPPDLIVASGDFTMRARRKEYVAARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  P     VPGNHD        +  H +  Y          K   P   + + IA++ 
Sbjct: 59  RLTAP--WIAVPGNHDIAYFKLLTRFFHPFGRYRR-----FIAKDTEPTF-LDDEIAVVC 110

Query: 152 CSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
            +T     P    + G   + Q   T + L        FRI++ HHP +        R+ 
Sbjct: 111 LNTVRTWAPETDWSQGKITRAQIARTEERLAALPDH-VFRIVVGHHPFMPPPWDAEARLV 169

Query: 210 G-IQRFQKMIWHEGADLILHGHTHLNSLHWIKNE-------------------KKLIPVV 249
           G               L L GH H +   + +                        +  V
Sbjct: 170 GRADEALDAFRRHNVGLTLAGHLHRHYSRFAEAPETGTEPDLVSVDRGMARAGGARLLAV 229

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
              SA+          +YN   IE      T+  
Sbjct: 230 QAGSATSTRLRGNEPNAYNRIVIEDGRATVTVRV 263


>gi|163853821|ref|YP_001641864.1| metallophosphoesterase [Methylobacterium extorquens PA1]
 gi|163665426|gb|ABY32793.1| metallophosphoesterase [Methylobacterium extorquens PA1]
          Length = 292

 Score =  155 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 51/274 (18%), Positives = 85/274 (31%), Gaps = 34/274 (12%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +R+  + + HF R       V   L+ ++     D +  +GD       +E   +  +L 
Sbjct: 2   RRVAHISDLHFGRT---DPAVVEALVAELNRDPPDLIVASGDFTMRARRKEYVAARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  P     VPGNHD        +  H +  Y          K   P   + + IA++ 
Sbjct: 59  RLTAP--WIAVPGNHDIAYFKLLTRFFHPFGRYRR-----FIAKDTEPTF-LDDEIAVVC 110

Query: 152 CSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
            +T     P    + G   + Q   T + L        FRI++ HHP +        R+ 
Sbjct: 111 LNTVRTWAPETDWSQGKITRAQIARTEERLAALPDH-VFRIVVGHHPFMPPPWDAEARLV 169

Query: 210 G-IQRFQKMIWHEGADLILHGHTHLNSLHWIKNE-------------------KKLIPVV 249
           G               L L GH H +   + +                        +  V
Sbjct: 170 GRADEALDAFRRHNVGLTLAGHLHRHYSRFAEAPETGTEPDLVSVDRGMARAGGARLLAV 229

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
              SA+          +YN   IE      T+  
Sbjct: 230 QAGSATSTRLRGNEPNAYNRIVIEDGRATVTVRV 263


>gi|14520324|ref|NP_125799.1| lacZ expression regulatory protein [Pyrococcus abyssi GE5]
 gi|5457539|emb|CAB49030.1| Predicted phosphohydrolase, putative [Pyrococcus abyssi GE5]
          Length = 505

 Score =  155 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 56/269 (20%), Positives = 98/269 (36%), Gaps = 47/269 (17%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           +  ++AHISD H++   +F   +                       +L+ N+I     D 
Sbjct: 2   MKMLIAHISDTHITNEVAFKSYA----------------------YDLIANEINTRPFDL 39

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V  TGD+ N     E   +++ L+ I  P  + + PGNHDA   G        ++ YI  
Sbjct: 40  VIHTGDVTNNGLREEYEHASYLLKKIEKP--LIVAPGNHDARNVG-----YELFEKYIGP 92

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  K             +I   +   T P  ++G  G  +       L + + K  
Sbjct: 93  LIGVYEFKDG----------VIIWLDS---TIPDLSDGRVGGYKFKWLKAKLEEYSHKKI 139

Query: 188 FRIIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
             +   HH  P+ DT    N +F       ++      L + GH H+ +++ +++    +
Sbjct: 140 KIVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLSHDVTLYMCGHKHVPNVYRVED----L 195

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKK 275
            V     AS +        SYN+  I K 
Sbjct: 196 VVDNAGCASCRKTRKGDVNSYNIVKITKD 224



 Score = 94.2 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 53/262 (20%), Positives = 89/262 (33%), Gaps = 32/262 (12%)

Query: 19  HLSYSPSFFELSPKR---IIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHVSITGDI 74
           H    P  F    +R   I+ +   + + + YF K      I  I      D V   GD+
Sbjct: 242 HKPIRPKIFIPRGRRLLRIVHVSESNVSDRVYFRKRTLENAIRAINEKYKPDIVVHCGDV 301

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
           V     R    +  +   +    +  IVPG++D    G        +K+Y          
Sbjct: 302 VEKGIERYFEMALEYYEKVK--AEKIIVPGHNDISYLG-----YELFKEYFG-------- 346

Query: 135 KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMH 194
               P +  R +   I   +A         G  GQ+          +      FRII+MH
Sbjct: 347 ---EPEIVERGDFVFIPILSAQYETQIGVVGRTGQKMLSRLLDDFEE-----KFRIIVMH 398

Query: 195 HPPVL-DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIAS 253
           H  V          +       K+I  +  +L L GH   ++   ++      P++   S
Sbjct: 399 HNLVPVPGVREIGYLEDAGNVLKIITDKKTELTLTGHGGNSNAVKVE----KSPIINAGS 454

Query: 254 ASQKVHSNKPQASYNLFYIEKK 275
            S ++H N    S+N+  I + 
Sbjct: 455 ISWELHRNPFGNSFNVIDIYED 476


>gi|254485594|ref|ZP_05098799.1| 3',5'-cyclic-nucleotide phosphodiesterase [Roseobacter sp. GAI101]
 gi|214042463|gb|EEB83101.1| 3',5'-cyclic-nucleotide phosphodiesterase [Roseobacter sp. GAI101]
          Length = 265

 Score =  155 bits (393), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 49/299 (16%), Positives = 98/299 (32%), Gaps = 45/299 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               ++   L+  + +   D V
Sbjct: 1   MSTLIHLSDLHFGKD-------------------------RPDLLEPLVERVNVLAPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+       +   +  +++ I     +  VPGNHD  +     +    W+ Y    
Sbjct: 36  VISGDLTQRAREEQFKEARDFIKKIN--ARVLSVPGNHDVSLHRPFRRFFWPWRSY---- 89

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 + L P     + + ++G ++          G    E+ +     +      G  
Sbjct: 90  -KKYIDQDLTPRFE-NDEMIVVGINSVDRFSW--QTGRLTAERINHACDAM-DHAPDGKT 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           RI+++HHP      +    + G +   + +   GA+LIL GH H         +      
Sbjct: 145 RILVVHHPLEHPAETEKKPIPGAEEALERLLSCGANLILSGHLHTWHAGNFTVKSGKTTA 204

Query: 249 VG---IASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           V      S S +V        +N+  I        +  +R + + ++   +   +  F 
Sbjct: 205 VQLHAGTSLSSRVRGE--ANDFNVIDILDG----RIGIERLSFNEETQQFETTEARQFN 257


>gi|300311856|ref|YP_003775948.1| 3',5'-cyclic-nucleotide phosphodiesterase [Herbaspirillum
           seropedicae SmR1]
 gi|300074641|gb|ADJ64040.1| 3',5'-cyclic-nucleotide phosphodiesterase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 279

 Score =  155 bits (392), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 60/279 (21%), Positives = 103/279 (36%), Gaps = 25/279 (8%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +R+I L + HF R       +   LI  I     D V ++GD+     + +   +  +L 
Sbjct: 2   RRVIHLSDLHFGRT---DPAIIEPLIAQIHELQPDLVVVSGDLTQRARSSQFRQARQFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           ++  P    +VPGNHD  +     + L   + Y    T           L + + IA++G
Sbjct: 59  ALPTPQ--LVVPGNHDVPLFNVAARLLQPLRKYKRHITPDLQP------LYVDDEIAVVG 110

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG- 210
            +TA +      +G     Q     + L         +II+ HHP  L     ++ + G 
Sbjct: 111 INTARSLT--IQDGRVNDRQIELARRELAAVGDH-LVKIIVTHHPFDLPPGPQHHGLVGQ 167

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK----LIPVVGIASASQKVHSNKPQAS 266
                +     GADL+L GH H +S        +       VV   +A+      +   S
Sbjct: 168 ALPAMRAFALCGADLLLAGHVHASSAVSSAARYRIAGYSALVVQAGTATSTRGRGE-ANS 226

Query: 267 YNLFYIEKKNE-----YWTLEGKRYTLSPDSLSIQKDYS 300
           +N+  IE          W  E + + L      +Q+   
Sbjct: 227 FNVLQIEAHQIVVHRLGWRAEERAFGLDASQTFVQRGSE 265


>gi|20093348|ref|NP_619423.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina acetivorans
           C2A]
 gi|19918712|gb|AAM07903.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina acetivorans
           C2A]
          Length = 246

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 53/269 (19%), Positives = 104/269 (38%), Gaps = 33/269 (12%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ L + HF+   Y   E+A+ ++  I  +N D V ITGD+       E   + +++  
Sbjct: 2   RLVHLSDIHFSEAFYM-PEIADTMLEKINQNNPDIVVITGDLTENGLAAEYNGAKNFIDR 60

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           I   + + IVPGNHD+  +G           +        +    F        + ++G 
Sbjct: 61  IECKNKV-IVPGNHDSRNAGYL---------FFEDIFKARSSSGSF------GEVTVVGL 104

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFG 210
            +   + P    G+ G+E      +    A     F++  +HH   P+  T    N +  
Sbjct: 105 DS---SQPELEEGHIGRENYGWIEEAFSTAG----FKVFALHHHLIPIPRTGRGNNVLVD 157

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                +++   G +L+L GH H+  +  + +    + VV   +        K    YN  
Sbjct: 158 AGDVLELLDRSGVNLVLCGHWHIPWVWRLND----MLVVSAGTVCSSKVRGKATQCYNYI 213

Query: 271 YIE-KKNE--YWTLEGKRYTLSPDSLSIQ 296
            +E  +++   W L+  R+        + 
Sbjct: 214 ELEMPESDCTRWHLQVHRFFYGGKKERVV 242


>gi|300113829|ref|YP_003760404.1| metallophosphoesterase [Nitrosococcus watsonii C-113]
 gi|299539766|gb|ADJ28083.1| metallophosphoesterase [Nitrosococcus watsonii C-113]
          Length = 296

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 62/278 (22%), Positives = 97/278 (34%), Gaps = 46/278 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISD+H                            F  E+   L++ I   + D +
Sbjct: 1   MLNLVHISDLHFG------------------------NPFLPEIGEALLHKINSLSPDLL 36

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GDI       E   +  +L  +  P    +VPGNHD  +    E+    +K Y    
Sbjct: 37  VISGDITQRAKPEEFRAAKAYLDRM-PPIPQLVVPGNHDIPLYRIFERLFQPYKLYCRYI 95

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA--NGYFGQEQAHATSKLLRKANKKG 186
           +           +  +NN  ++G  +   T P+ A  NG   +EQ    ++    A+ + 
Sbjct: 96  SESRN------TVLRQNNAVIVGLDS---TNPYFAFTNGRIRREQLDFCAEAFATASPET 146

Query: 187 FFRIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLN----SLHWIKN 241
              ++  HH  P  D       M   +R          DLIL GH H      SL     
Sbjct: 147 ARIVVTHHHFAPAPDYKG-GEIMPKAKRALDFFTGLKVDLILAGHLHRAYIGNSLDVYPG 205

Query: 242 EKKL---IPVVGIASASQKVH-SNKPQASYNLFYIEKK 275
           E +    I      S S++     + + S+N   I K 
Sbjct: 206 EDREHGIIIAQCGTSTSRRGRVREQEKNSFNRIEIMKD 243


>gi|328950407|ref|YP_004367742.1| metallophosphoesterase [Marinithermus hydrothermalis DSM 14884]
 gi|328450731|gb|AEB11632.1| metallophosphoesterase [Marinithermus hydrothermalis DSM 14884]
          Length = 248

 Score =  154 bits (390), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 54/267 (20%), Positives = 93/267 (34%), Gaps = 48/267 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M +L HISDIH++                        KYF  E+   LI++I     D V
Sbjct: 1   MPLLYHISDIHVA-----------------------SKYFLPELMERLIDEINTVGPDLV 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+ +     E   +  W   I  P    + PGNHD+   G        +++     
Sbjct: 38  VLSGDLTDRGLRHEFEEAKAWTDRIQVPM--LVTPGNHDSRNVG-----YIHFEELYGPR 90

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                        R    + ++   +   + P    G  G+       + L  A      
Sbjct: 91  YAT----------RRLEGVYVVAADS---SEPDLDEGRIGRTIYPWLEEALSTAEPSEIK 137

Query: 189 RIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
             +  HH  PV       N +       K++     DL+L+GH H+  +   +    LI 
Sbjct: 138 VFVTHHHLLPVPGAGRERNILQDAGDLLKILVDHKVDLVLNGHKHVPWVWRFEG--MLIV 195

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEK 274
             G ++ ++     +P  SY +  I+ 
Sbjct: 196 NAGTSTTNRVRGRGRP--SYTVIEIDG 220


>gi|15678206|ref|NP_275321.1| Icc related protein [Methanothermobacter thermautotrophicus str.
           Delta H]
 gi|2621221|gb|AAB84684.1| Icc related protein [Methanothermobacter thermautotrophicus str.
           Delta H]
          Length = 196

 Score =  154 bits (390), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 58/231 (25%), Positives = 90/231 (38%), Gaps = 51/231 (22%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++AHISD+H+   P+F E                      ++    I  I     D  
Sbjct: 1   MVLIAHISDLHVGA-PNFKE----------------------DILLEAIRQINKLKPDAT 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD+ +     E   +  +L  +  PH    VPGNHDA   G                
Sbjct: 38  VITGDLTDNGYYLEFLQAAEYLSDLKGPH--IFVPGNHDARHVGN--------------- 80

Query: 129 TTCSTGKKLFPYLR---IRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
               T + +F Y R   + + + +IG  +   + P    G  G+ Q       L +A+ +
Sbjct: 81  ---ETFEDVFRYRRGTFVMDGLTIIGLDS---SEPDLDYGKIGRSQQIWMEDELDRASSR 134

Query: 186 GFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLN 234
           G  R+I +HH   PV  T    N +       + I  +GADL++ GH H+ 
Sbjct: 135 GHIRVIALHHHIIPVPKTGRERNVLADAGDILQSIISKGADLVISGHKHVP 185


>gi|121605438|ref|YP_982767.1| metallophosphoesterase [Polaromonas naphthalenivorans CJ2]
 gi|120594407|gb|ABM37846.1| metallophosphoesterase [Polaromonas naphthalenivorans CJ2]
          Length = 271

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 50/293 (17%), Positives = 93/293 (31%), Gaps = 40/293 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L  ISD H                                V   L+        D +
Sbjct: 1   MACLLQISDPHFGTV-------------------------QPAVMQALVRLAQEQRPDVL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  +   +  P  +  + GNHD  +    ++    +  ++   
Sbjct: 36  VLSGDITQRARVSQFNEARAFCDRLAIP-RMLAIAGNHDIPLLNLYQRLFTPYARFLR-- 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              + G  L P +     + +IG  T         NG     Q       L ++      
Sbjct: 93  ---AFGPVLEPVV-STPLLHVIGVKTTR--RWRHKNGEVSAAQIGRVVAELGRSAPAQL- 145

Query: 189 RIIMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE----K 243
           RI+++H P  VL     ++R+ G +         GAD+++ GH HL  +  +       +
Sbjct: 146 RIVVVHQPVHVLHAEDQHDRLRGWEPAVHAWARAGADIVMGGHIHLPYVCDLSTRLGALE 205

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
           + +  V   +A           S NL   E   +    + +R+     S   +
Sbjct: 206 RRLWCVQAGTALSTRVRQGIPNSVNLLRYEGAGQPLACQLERWDFQAASGQFE 258


>gi|171911751|ref|ZP_02927221.1| probable DNA repair exonuclease [Verrucomicrobium spinosum DSM
           4136]
          Length = 301

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/267 (17%), Positives = 98/267 (36%), Gaps = 21/267 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ L + HF        E    L + +     D   I+GD+     +RE   +  +L +
Sbjct: 2   RLVHLSDLHFGAITMGRPE---ALRDAVQAVGADLTVISGDLTQKGRHREFVAAREFLET 58

Query: 93  IGNPHDISIVPGNHDAYI-SGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           +  P    +VPGNHD         +  H W+ Y         G+++ P L     + + G
Sbjct: 59  LPGPR--FVVPGNHDMPHGVHLWARFEHPWRTYRE-----VMGEEMEPTLHAPGMV-VAG 110

Query: 152 CSTAIATPPFSA--NGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
            +++     +     G     Q     +   +A  +   R++++HHPP          + 
Sbjct: 111 MNSSRPGGLYVDWSRGRLSAGQLIRLRQQYLEATPEAL-RVLVVHHPPAAPPQGTRRHLI 169

Query: 210 GIQ-RFQKMIWHEGADLILHGHTHLNSLHW--IKNEKKLIPVVGIASASQKVHSNKPQAS 266
             +      +   G DL+L GH HL+      +        V+ + S +           
Sbjct: 170 DKRPALFGALNEAGVDLVLSGHFHLSYAVPVKLPGVHPRHFVLSVTSTATSHRLKGEPNG 229

Query: 267 YNLFYIEKKN---EYWTLEGKRYTLSP 290
           +++   ++++   + WT   + Y  + 
Sbjct: 230 FHVIEGDRQHLQVQAWTWNDETYVPTR 256


>gi|77463909|ref|YP_353413.1| phospodiesterase [Rhodobacter sphaeroides 2.4.1]
 gi|221639765|ref|YP_002526027.1| Metallophosphoesterase [Rhodobacter sphaeroides KD131]
 gi|332558781|ref|ZP_08413103.1| Metallophosphoesterase [Rhodobacter sphaeroides WS8N]
 gi|77388327|gb|ABA79512.1| possible phospodiesterase [Rhodobacter sphaeroides 2.4.1]
 gi|221160546|gb|ACM01526.1| Metallophosphoesterase [Rhodobacter sphaeroides KD131]
 gi|332276493|gb|EGJ21808.1| Metallophosphoesterase [Rhodobacter sphaeroides WS8N]
          Length = 273

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 55/276 (19%), Positives = 106/276 (38%), Gaps = 24/276 (8%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           KR++ L + HF R +    E+   L+  +     D V+I+GD+       +   +  ++ 
Sbjct: 2   KRLLHLSDLHFGRDR---PELLRPLVETVNRLEPDLVAISGDLTQRATESQFRAAAAFVA 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           ++  P  + +VPGNHD  +     + +  WK Y         G+ L P     + + ++G
Sbjct: 59  ALKPP--VLVVPGNHDVPLHNLYVRLVKPWKRYRRW-----FGRDLEPCWE-NDEMIVVG 110

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI 211
            +T          G+F         +    A ++   R++++HHP           M G 
Sbjct: 111 ANTVNPLAW--QQGWFRSRSLARIRRSF--AAEERRVRVVVVHHPMEHTPEDTKELMRGA 166

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHW---IKNEKKLIPVVGIASASQKVHSNKPQASYN 268
           +R    +   GAD+IL GH H   +     +     ++ V      S +V        +N
Sbjct: 167 ERAIDELADCGADVILSGHLHTWRVAPFAEVAGRGVVLQVHAGTGLSTRVRGE--PNDFN 224

Query: 269 LFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           L  +        +  +R+T   D+   +   +  F 
Sbjct: 225 LLEVASD----RIHIERHTAQEDASGFRLAETRTFR 256


>gi|126462743|ref|YP_001043857.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17029]
 gi|126104407|gb|ABN77085.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17029]
          Length = 273

 Score =  153 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 55/276 (19%), Positives = 106/276 (38%), Gaps = 24/276 (8%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           KR++ L + HF R +    E+   L+  +     D V+I+GD+       +   +  ++ 
Sbjct: 2   KRLLHLSDLHFGRDR---PELLRPLVETVNRLEPDLVAISGDLTQRATESQFRAAAAFVA 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           ++  P  + +VPGNHD  +     + +  WK Y         G+ L P     + + ++G
Sbjct: 59  ALKPP--VLVVPGNHDVPLHNLFVRLVKPWKRYRRW-----FGRDLEPCWE-NDEMIVVG 110

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI 211
            +T          G+F         +    A ++   R++++HHP           M G 
Sbjct: 111 ANTVNPLAW--QQGWFRSRSLARIRRSF--AAEERRVRVVVVHHPMEHTPDDTKELMRGA 166

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHW---IKNEKKLIPVVGIASASQKVHSNKPQASYN 268
           +R    +   GAD+IL GH H   +     +     ++ V      S +V        +N
Sbjct: 167 ERAIDELADCGADVILSGHLHTWRVAPFAEVAGRGVVLQVHAGTGLSTRVRGE--PNDFN 224

Query: 269 LFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           L  +        +  +R+T   D+   +   +  F 
Sbjct: 225 LLEVASD----RIHIERHTAQEDASGFRLAETRTFR 256


>gi|254000140|ref|YP_003052203.1| metallophosphoesterase [Methylovorus sp. SIP3-4]
 gi|253986819|gb|ACT51676.1| metallophosphoesterase [Methylovorus sp. SIP3-4]
          Length = 268

 Score =  152 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 57/300 (19%), Positives = 106/300 (35%), Gaps = 42/300 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++AH+SD H                                V   L + +       +
Sbjct: 1   MTLIAHLSDPHFGTE-------------------------QPAVMQALQSLLWQQAPHLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  ++ S+  PH   ++PGNHD  +     + L  ++ +    
Sbjct: 36  ILSGDITQRARRSQFKHARAFVDSLNIPHR-LVIPGNHDIPLFNLLARLLTPYRRHRH-- 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              + G++L P  R    +A I  +T  A      +G     Q     + L++A+ +   
Sbjct: 93  ---AFGQELEPVYRDDKTLA-ITVNTTRAY--RHEDGEVSPAQIKRVCEQLQQASPQQL- 145

Query: 189 RIIMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK--- 244
           R+++ H P  V +     N + G Q   +     GADLIL GH HL  +  +  ++    
Sbjct: 146 RLVITHQPVYVTEVRDESNLLHGYQAAVRAWAEAGADLILGGHIHLPFVMALHEKRPDIR 205

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             I  V   +A           S NL  I  +        +R+  +       +  ++  
Sbjct: 206 HRIWAVQAGTAVSTRIRRNAGNSINL--IRYQARQTPCMVERWDYTAAQQQFVQVSAEAL 263


>gi|313202104|ref|YP_004040762.1| metallophosphoesterase [Methylovorus sp. MP688]
 gi|312441420|gb|ADQ85526.1| metallophosphoesterase [Methylovorus sp. MP688]
          Length = 268

 Score =  152 bits (385), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 57/300 (19%), Positives = 106/300 (35%), Gaps = 42/300 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++AH+SD H                                V   L + +       +
Sbjct: 1   MTLIAHLSDPHFGTE-------------------------QPAVMQALQSLLWQQAPHLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  ++ S+  PH   ++PGNHD  +     + L  ++ +    
Sbjct: 36  ILSGDITQRARRSQFKHARAFVDSLNIPHR-LVIPGNHDIPLFNLLARVLAPYRRHRH-- 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              + G++L P  R    +A I  +T  A      +G     Q     + L++A+ +   
Sbjct: 93  ---AFGQELEPVYRDDKTLA-ITVNTTRAY--RHEDGEVSPAQIKRVCEQLQQASPQQL- 145

Query: 189 RIIMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK--- 244
           R+++ H P  V +     N + G Q   +     GADLIL GH HL  +  +  ++    
Sbjct: 146 RLVITHQPVYVTEVRDESNLLHGYQAAVRAWAEAGADLILGGHIHLPFVMALHEKRPDIR 205

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             I  V   +A           S NL  I  +        +R+  +       +  ++  
Sbjct: 206 HRIWAVQAGTAVSTRIRRNAGNSINL--IRYQARQTPCMVERWDYTAAQQQFVQVSAEAL 263


>gi|288932603|ref|YP_003436663.1| metallophosphoesterase [Ferroglobus placidus DSM 10642]
 gi|288894851|gb|ADC66388.1| metallophosphoesterase [Ferroglobus placidus DSM 10642]
          Length = 373

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 50/245 (20%), Positives = 93/245 (37%), Gaps = 32/245 (13%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           +I+ + + HF  +    +      I  I     D V +TGD+  +  + E+  +   L  
Sbjct: 2   KIVHISDLHFGEE--LVRSKVEKAIKQINEIEPDLVVVTGDLSCWGIHSELREAYEALEK 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           + +  D  +VPGNHDA  +G     +  ++ Y                +   + + +IG 
Sbjct: 60  LKS--DYFVVPGNHDARNNG-----IEFFELYFGERKK----------IYKDSEVVIIGV 102

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFG 210
            +   T P   +GY G EQ     +  R    K    ++ +HH   P+ DT    N +  
Sbjct: 103 DS---TQPDIDDGYIGFEQRRWIEENFR----KDRINVLALHHHIVPIPDTGRERNVLID 155

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                +M+ + G  L+L GH H+     +        ++   S         P  +YN+ 
Sbjct: 156 AGEVVEMLINLGFALVLAGHRHMPYSIRLMRTH----IIHAGSLGSFKILGMPDHNYNVI 211

Query: 271 YIEKK 275
            + + 
Sbjct: 212 ELSED 216


>gi|302381414|ref|YP_003817237.1| metallophosphoesterase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192042|gb|ADK99613.1| metallophosphoesterase [Brevundimonas subvibrioides ATCC 15264]
          Length = 285

 Score =  152 bits (384), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 84/242 (34%), Gaps = 16/242 (6%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++   + HF              +        D + ITGDI       E   +  W+R+
Sbjct: 5   RLLQFSDVHFG---VEHPHACAAALEYAHATPTDLILITGDITQKGLPDEFAAAGEWIRA 61

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  + +  GNHD        +    WK +       +TG        + +N+ + G 
Sbjct: 62  MPTPRFVIV--GNHDVPYYSLGARLFRPWKAF-----EDATGHPAHDGEFVSDNVMVRGV 114

Query: 153 STAIATPPF--SANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF- 209
            TA         + G    +Q    ++ LR+A   G  RI+  HHP +    +       
Sbjct: 115 VTARGWQARANWSKGVIDLDQTRRAAEALRQAPV-GALRILACHHPLIEMIGTPMTGDVK 173

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
                 ++    G DLI  GH H+     I    +    VG  + S++     P  S+N 
Sbjct: 174 RGDAAAEIFAEAGVDLITTGHVHVPFAIPIDLSDRCSYAVGCGTLSKRERGTPP--SFNQ 231

Query: 270 FY 271
             
Sbjct: 232 IE 233


>gi|237653530|ref|YP_002889844.1| metallophosphoesterase [Thauera sp. MZ1T]
 gi|237624777|gb|ACR01467.1| metallophosphoesterase [Thauera sp. MZ1T]
          Length = 277

 Score =  152 bits (384), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 48/239 (20%), Positives = 90/239 (37%), Gaps = 15/239 (6%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           ++ + + HF  ++     V   L+        D V + GDI       +   +  ++  +
Sbjct: 4   LLHIADTHFGTEQ---PPVVEALVALAAQQRPDLVVLAGDITQRARPAQFRAARAFVDRL 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
           G P  +  VPGNHD  +     +    +  +     T   G  L P +    ++ ++G +
Sbjct: 61  GAP--VLAVPGNHDIALFDLWARLTRPYARF-----TEVFGADLEP-VHASADLLVVGVN 112

Query: 154 TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRM-FGIQ 212
           T  A      NG     Q    + LL  A+ +   R++++H P  +  +     +  G Q
Sbjct: 113 TTRAW--RHKNGEVSAAQVDRVAGLLASASPQQL-RVVVVHQPAAVSCARDRADLVRGHQ 169

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFY 271
              +     GADL+L GH HL          + + V+   +A       +   S N+  
Sbjct: 170 AALRAWSVAGADLVLGGHIHLPYTLAPPGLARRLWVLQAGTAVSWRTRAEVPNSVNILR 228


>gi|83953123|ref|ZP_00961845.1| possible phospodiesterase [Sulfitobacter sp. NAS-14.1]
 gi|83842091|gb|EAP81259.1| possible phospodiesterase [Sulfitobacter sp. NAS-14.1]
          Length = 268

 Score =  152 bits (384), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 51/299 (17%), Positives = 99/299 (33%), Gaps = 45/299 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               ++   L++ +   N D V
Sbjct: 1   MSTLVHLSDLHFGKD-------------------------RPDLLEPLLSCVNELNPDIV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +I+GD        +   + ++++ I  P  +  VPGNHD  +    ++    W+ Y    
Sbjct: 36  AISGDFTQRARRSQFEEAHNFIQRINAP--VLGVPGNHDVLLDRPFQRFFMPWRRYRKWI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               T +         +++ +IG ++          G     +     K +     +   
Sbjct: 94  NADLTPRYE------DDDMVVIGINSVDRFSW--QTGKLTAGRIAQACKAIDDTAAR-KA 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++++HHP      +    + G +   + +   GA+LIL GH H         E      
Sbjct: 145 RVLVVHHPLEHPNHTNKKPIPGAEIALEKLLSCGANLILSGHLHTWHAENFTVESGGTTA 204

Query: 249 VG---IASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +      S S +V        +NL  I        +   R + + D    +   +  F 
Sbjct: 205 IQLHAGTSLSSRVRGE--PNDFNLVKISDD----QVCVDRLSFNEDKRVFETTEARTFN 257


>gi|307942373|ref|ZP_07657724.1| phosphohydrolase [Roseibium sp. TrichSKD4]
 gi|307774659|gb|EFO33869.1| phosphohydrolase [Roseibium sp. TrichSKD4]
          Length = 306

 Score =  151 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 58/298 (19%), Positives = 103/298 (34%), Gaps = 36/298 (12%)

Query: 3   KRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL 62
           KR    M ++A ISD+HL            R  G   +  +    F++     L N  L 
Sbjct: 26  KRDCPFMTLIAQISDLHL------------RPRGATCFRVSDTNMFAERAVLALKN--LP 71

Query: 63  HNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWK 122
              D V +TGD+ +    RE   +   L  +  P  + +VPGNHD  ++ A      A+K
Sbjct: 72  QMPDAVVVTGDLTDGNDPREYDLAREILSRL--PMPVYVVPGNHDGTLAMA-----QAFK 124

Query: 123 DYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
           DY       +  K    Y      + L+   ++I   P    G  G++Q       L   
Sbjct: 125 DY--PGIRAADQKPKLSYTAQIGELQLVALDSSIPGKP---YGQIGEDQLLWLEAALSAN 179

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWI 239
                   I +HHPP+       +   +        ++        I+ GH H       
Sbjct: 180 TAPTL---IAVHHPPIQTGMHFMDTIGLKDADALGNVVQRHSHVKRIMCGHAHRAVTAEF 236

Query: 240 KNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
                 +  +  ++A          A  + F +E    Y  +     +++  +  +++
Sbjct: 237 AGT---VVTLAPSTAHNSALDFSKDAPAH-FRLEPAQYYIHVTTPDGSIATHTAFVEQ 290


>gi|238027264|ref|YP_002911495.1| metallophosphoesterase [Burkholderia glumae BGR1]
 gi|237876458|gb|ACR28791.1| Metallophosphoesterase [Burkholderia glumae BGR1]
          Length = 277

 Score =  151 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 48/299 (16%), Positives = 92/299 (30%), Gaps = 39/299 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L  +SD H                    W             + L+  +     D V
Sbjct: 1   MSTLLQVSDPHFGAE----------------W---------PAAVDALVALVTTLRPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+      R+   +  ++  +G P  +  +PGNHD  +     +    +  Y    
Sbjct: 36  VLSGDLTQRARRRQFDAARAFVDRLG-PQALLAIPGNHDIPLFDPFARLWRPYARYRH-- 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              + G  L P       + + G +T          G     Q    ++   +  +    
Sbjct: 93  ---AFGADLEPVFDAP-TLLVQGVNTTRPA--RHTAGEISAAQIERVARRF-ELARPAQL 145

Query: 189 RIIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH--WIKNEKKL 245
           R+ ++H P      S  ++R+ G +   +     G DL+L GHTH   ++   +    + 
Sbjct: 146 RVAVVHQPIATAGPSKRHDRLHGAEAALRRWADAGVDLVLGGHTHRPEINAVAVAGSTRK 205

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEY-WTLEGKRYTLSPDSLSIQKDYSDIF 303
           +  +   +A      +    S NL   +   E        RY               + 
Sbjct: 206 VYAIQGGTAVSWRVRDGQPNSVNLIAYDHAGEGARRARVTRYEHDAAGGRFVAGEPRVL 264


>gi|226946463|ref|YP_002801536.1| metallophosphoesterase protein [Azotobacter vinelandii DJ]
 gi|226721390|gb|ACO80561.1| Metallophosphoesterase protein [Azotobacter vinelandii DJ]
          Length = 291

 Score =  151 bits (383), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/274 (18%), Positives = 104/274 (37%), Gaps = 20/274 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ + + HF  ++     V   L + +     D + ++GDI       +   +  ++R 
Sbjct: 22  RILHISDTHFGTEQQP---VIEALESHVREQGADLLVLSGDITQRARREQFDAAVAFVRR 78

Query: 93  IGN--PHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALI 150
           + +       ++PGNHD  +     + L  + +Y         G +L P     + + +I
Sbjct: 79  LEDCGIPRSLVIPGNHDLPLHNLLARFLLPYGNYRR-----CFGWQLEPTFE-NDELLVI 132

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPP-VLDTSSLYNRMF 209
           G +T         +G     Q  A  + LR+++     RI++ H P   +  S L N   
Sbjct: 133 GLNTTHPR--RRKDGRVTDAQVQAVCERLRRSDPDKL-RIVVAHQPFGAMLPSDLSNLQH 189

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE----KKLIPVVGIASASQKVHSNKPQA 265
           G +         G D+++ GH HL  +  +  +     + I  V   +A           
Sbjct: 190 GAETALTRWAEAGLDIVMGGHIHLPYVLPLSGQYPGLAREIWTVQAGTALSSRLRGNLPN 249

Query: 266 SYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
           S+N  ++ +  +   +  +R+   P +     + 
Sbjct: 250 SFNRLHLGENPD-RRVRVERWDYHPPTGRFVPEA 282


>gi|313679720|ref|YP_004057459.1| metallophosphoesterase [Oceanithermus profundus DSM 14977]
 gi|313152435|gb|ADR36286.1| metallophosphoesterase [Oceanithermus profundus DSM 14977]
          Length = 247

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/269 (17%), Positives = 96/269 (35%), Gaps = 48/269 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISDIH++                        KYF  ++   L++++     D +
Sbjct: 1   MTRLYHISDIHVA-----------------------SKYFQPQLMEQLVDEVNRERPDLL 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+ +     E   +  W      P    + PGNHD+   G        +++   S 
Sbjct: 38  VISGDLTDRGLAYEYEEAARWTGRFEVPM--LVTPGNHDSRNVGYV-----HFEELYGSR 90

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                    +  +R+   + ++   +   + P    G  G+       + L  A +    
Sbjct: 91  ---------YRVVRLPG-VHIVAADS---SEPDLDEGRIGRSIYPWLHEALDSAAEGDLK 137

Query: 189 RIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
             +  HH  PV       N +       K++   G +L+L+GH H+  +   +     + 
Sbjct: 138 VFVTHHHLLPVPGAGRERNILQDAGDLLKVLVDHGVELVLNGHKHVPWVWRFE----EML 193

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKN 276
           +V   +A+      K + S+ +  +  + 
Sbjct: 194 IVNAGTATTNRLRGKGRPSFAIIDLTDEA 222


>gi|84683430|ref|ZP_01011333.1| possible phospodiesterase [Maritimibacter alkaliphilus HTCC2654]
 gi|84668173|gb|EAQ14640.1| possible phospodiesterase [Rhodobacterales bacterium HTCC2654]
          Length = 278

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/270 (20%), Positives = 97/270 (35%), Gaps = 27/270 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ L + HF R +    E+   L + I   + D V ++GD+     +RE   +  +L  
Sbjct: 3   RLVHLSDLHFGRAR---PELLAPLSDAINAAHPDLVVVSGDLTQRARSREFAAAREFLDG 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +G       VPGNHD  +    ++ L  ++ Y  +         L P     + + + G 
Sbjct: 60  LG--ARWLAVPGNHDIPLYQPWDRFLKPFRKYREN-----IALDLEPCHEGEDYL-VAGL 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKL--LRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
           +T          G  G+ +A A  ++  L        F I+M HHP   D +S    M  
Sbjct: 112 NTV-----DRFAGQRGRARAGAIRRVCSLFDGGPDDRFNILMAHHPFEQDHASHKTPMKR 166

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWI---KNEKKLIPVVGIASASQKVHSNKPQASY 267
            +   + +   G  ++L GH H+               I V    S S ++        +
Sbjct: 167 AEPMLERLKACGTHVVLSGHLHMWHTGPFLTRPGHVGPIQVHAGTSLSSRLRGE--VNDF 224

Query: 268 NLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
            L  +        L   R  +  D     +
Sbjct: 225 ALLDMTGD----RLTVTRMAVEADGTDFTE 250


>gi|13476688|ref|NP_108257.1| 3',5'-cyclic-nucleotide phosphodiesterase [Mesorhizobium loti
           MAFF303099]
 gi|14027449|dbj|BAB53718.1| 3',5'-cyclic-nucleotide phosphodiesterase [Mesorhizobium loti
           MAFF303099]
          Length = 269

 Score =  151 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/261 (19%), Positives = 100/261 (38%), Gaps = 28/261 (10%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           K ++ L + HF + +     + + +  ++   + D + ++GD+       E   +  +L 
Sbjct: 2   KTLVHLSDLHFGKTESH---LVDAIAAEVRAVDSDLLVVSGDLTQRARKDEFLQARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHA---WKDYITSDTTCSTGKKLFPYLRIRNNIA 148
           S+  P    +VPGNHD  +     +++     ++ YI +DT                 +A
Sbjct: 59  SLPGPR--IVVPGNHDVPLWNVFARAMTPLSRYRRYIEADTDPFYADS---------EVA 107

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNR 207
           ++G +TA +      NG     Q  A ++     +     RI++ HHP   LD  S    
Sbjct: 108 VVGINTARSLT--IKNGRINVRQLKAATEKFAYMSDD-ITRIVVTHHPFEGLDLESDDGI 164

Query: 208 MFGIQRFQKMIWHEGADLILHGHTHLN-----SLHWIKNEKKLIPVVGIASASQKVHSNK 262
           +             G D+IL GH HL+     +  ++ +    + V    + S +V    
Sbjct: 165 VARADLAMDAFSRSGVDIILSGHQHLHRAGSSARRYLIDGYAALLVQAGTAVSSRVRQA- 223

Query: 263 PQASYNLFYIEKKNEYWTLEG 283
              S+N+  IE          
Sbjct: 224 -ANSFNIIRIEHPRISIECRA 243


>gi|84503427|ref|ZP_01001487.1| possible phospodiesterase [Oceanicola batsensis HTCC2597]
 gi|84388214|gb|EAQ01166.1| possible phospodiesterase [Oceanicola batsensis HTCC2597]
          Length = 278

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 52/260 (20%), Positives = 99/260 (38%), Gaps = 18/260 (6%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R+I L + HF R +    E+   L+  +     D V+I+GD+     + +   +  ++  
Sbjct: 3   RLIHLSDLHFGRDR---PELMRPLLTAVNDLGPDIVAISGDLTQRARSSQFRAARTFIDH 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           I  P  +  VPGNHD        + L+++ +Y    +       L P      ++A+IG 
Sbjct: 60  IEAP--VLCVPGNHDLPAHRPIRRFLNSFANYKRHISPDLAPSLLCP------DLAVIGI 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           +T   +P    +G+  +      ++L R    +    +++ HHP  +   S    MF  +
Sbjct: 112 NTN--SPFRWQSGWASRRGIRKAAELCRS-GPEHRLNVVVAHHPFEMPEESHKRPMFNAE 168

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL--IPVVGIASASQKVHSNKPQASYNLF 270
                +   GA ++L GH H   +      +    I +      S +         + + 
Sbjct: 169 WGLACLAEAGAHVVLSGHLHRWRVIGTDKAEGPGIIQIHCGTGLSTRQRGE--PNDFAVL 226

Query: 271 YIEKKNEYWTLEGKRYTLSP 290
            IE       L   R+   P
Sbjct: 227 EIEGNRPDSALTVTRWIAGP 246


>gi|21226673|ref|NP_632595.1| transcriptional regulator, Icc-like protein [Methanosarcina mazei
           Go1]
 gi|20904957|gb|AAM30267.1| transcriptional regulator, Icc related protein [Methanosarcina
           mazei Go1]
          Length = 262

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/282 (19%), Positives = 102/282 (36%), Gaps = 55/282 (19%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           +  + H+SDIH S                       + Y+  E+A+ ++  I   + D V
Sbjct: 16  IIKIVHLSDIHFS-----------------------EAYYMPEIADSMLQIINESSPDIV 52

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD+       E   + +++  I   + + IVPGNHD+  +G           +    
Sbjct: 53  IITGDLTENGFAAEYNGAKNFIDKIECKNKV-IVPGNHDSKNAGYL---------FFEDI 102

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               +    F       ++ +IG  +   + P   +G+ G+E               G F
Sbjct: 103 FKARSSSGYF------GDVTVIGLDS---SQPELDDGHIGRENYGWIESTFST----GSF 149

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           ++  +HH   P+  T    N +       +++   G +L+L GH H+  +  + +     
Sbjct: 150 KVFALHHHLIPIPKTGRGNNVLVDAGDVLELLDRSGVNLVLCGHWHIPWVWRLNDMF--- 206

Query: 247 PVVGIASASQKVHSNKPQASYNLFYI---EKKNEYWTLEGKR 285
            ++   +        K    YNL  +   E +   W L   R
Sbjct: 207 -IISAGTVCSSKIRGKTSQCYNLIELETPESECTRWHLRITR 247


>gi|77164766|ref|YP_343291.1| metallophosphoesterase [Nitrosococcus oceani ATCC 19707]
 gi|254434086|ref|ZP_05047594.1| Ser/Thr protein phosphatase family protein [Nitrosococcus oceani
           AFC27]
 gi|76883080|gb|ABA57761.1| Metallophosphoesterase [Nitrosococcus oceani ATCC 19707]
 gi|207090419|gb|EDZ67690.1| Ser/Thr protein phosphatase family protein [Nitrosococcus oceani
           AFC27]
          Length = 296

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 63/279 (22%), Positives = 98/279 (35%), Gaps = 46/279 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISD+H                            F  ++   L++ I   + D +
Sbjct: 1   MLNLLHISDLHFG------------------------NPFLPDIGEALLHKISGLSPDIL 36

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GDI       E   +  +   +  P    +VPGNHD  +    E+    +K Y    
Sbjct: 37  VISGDITQRARPEEFKAARAYFDRM-PPIPQLVVPGNHDIPLYRIFERLFQPYKLYHR-- 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA--NGYFGQEQAHATSKLLRKANKKG 186
                 K+    LR +NN  ++G  +   T P+ A  NG   +EQ    ++    A  + 
Sbjct: 94  ---YIDKERNIVLR-QNNAVIVGLDS---TNPYFAITNGRIRREQLDFCAEAFAMAPPEA 146

Query: 187 FFRIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLN----SLHWIKN 241
              ++  HH  P  D       M   +R          DLIL GH H      SL     
Sbjct: 147 ARIVVAHHHFAPAPDYKG-GEIMPKAKRALDFFTGLKVDLILAGHLHRAYIGNSLDVYPG 205

Query: 242 EKKL---IPVVGIASASQKVH-SNKPQASYNLFYIEKKN 276
           E +    I      S S++     + + S+N   I K +
Sbjct: 206 EDREHGIIIAQCGTSTSRRGRVREQEKNSFNRIEIMKDS 244


>gi|327479919|gb|AEA83229.1| DNA repair exonuclease [Pseudomonas stutzeri DSM 4166]
          Length = 267

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 51/263 (19%), Positives = 97/263 (36%), Gaps = 20/263 (7%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ + + HF  ++     V   L + +  H  D +  +GDI       +  ++  ++R +
Sbjct: 4   IVQISDTHFGTEQ---PAVVQALEDHVREHRADLLVFSGDITQRARRGQFASAAAFVRRL 60

Query: 94  GN--PHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
                 D  ++PGNHD  +     +    + +Y         G  L P       + +IG
Sbjct: 61  EADGVGDTLVIPGNHDIPLYNVFARLFTPYGNYRQH-----FGDDLEPVFENEQML-VIG 114

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPP-VLDTSSLYNRMFG 210
            +T         +G     Q    ++ L + +  G  RI++ H P   +  S L N   G
Sbjct: 115 LNTTHPR--RHKDGVVTARQVERVARRLEE-SDPGKIRIVVAHQPFGAMVPSDLSNLQHG 171

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWI----KNEKKLIPVVGIASASQKVHSNKPQAS 266
            +   +     G DL++ GH HL  +  +        + I +V   +            S
Sbjct: 172 AEPALQRWAEHGLDLVMGGHIHLPYVLPLSRQYPGLAREIWMVQAGTTLSTRLRGTSPNS 231

Query: 267 YNLFYIEKKNEYWTLEGKRYTLS 289
           +N   +   +E      +R+ LS
Sbjct: 232 FNRLKLHPGDEKKVC-VERWDLS 253


>gi|83942073|ref|ZP_00954535.1| possible phospodiesterase [Sulfitobacter sp. EE-36]
 gi|83847893|gb|EAP85768.1| possible phospodiesterase [Sulfitobacter sp. EE-36]
          Length = 268

 Score =  150 bits (379), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 51/299 (17%), Positives = 99/299 (33%), Gaps = 45/299 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               ++   L++ +   N D V
Sbjct: 1   MSTLVHLSDLHFGKD-------------------------RPDLLEPLLSCVNELNPDIV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +I+GD        +   + ++++ I  P  +  VPGNHD  +    ++    W+ Y    
Sbjct: 36  AISGDFTQRARRSQFEEAHNFIQRINAP--VLGVPGNHDVLLDRPFQRFFMPWRRYRKWI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               T +         +++ +IG ++          G     +     K +     +   
Sbjct: 94  NADLTPRYE------DDDMVVIGINSVDRFSW--QTGKLTAGRIAHACKAMDDTAAR-KA 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++++HHP      +    + G +   + +   GA+LIL GH H         E      
Sbjct: 145 RVLVVHHPLEHPNHTKKKPIPGAEIALEKLLSCGANLILSGHLHTWHAENFTVESGGTTA 204

Query: 249 VG---IASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +      S S +V        +NL  I        +   R + + D    +   +  F 
Sbjct: 205 IQLHAGTSLSSRVRGE--PNDFNLVKISDD----QVCVDRLSFNEDKRVFETTEARTFN 257


>gi|13488517|ref|NP_109524.1| 3',5'-cyclic-nucleotide phosphodiesterase CpdA-like protein
           [Mesorhizobium loti MAFF303099]
 gi|14028271|dbj|BAB54863.1| 3',5'-cyclic-nucleotide phosphodiesterase CpdA homolog
           [Mesorhizobium loti MAFF303099]
          Length = 269

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 50/283 (17%), Positives = 106/283 (37%), Gaps = 32/283 (11%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           K ++ L + HF +      ++ + +  ++   + D + ++GD+       E   +  +L 
Sbjct: 2   KTLVHLSDLHFGKT---ESQLVDAIAAEVRAVDSDLLVVSGDLTQRARKDEFLQARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHA---WKDYITSDTTCSTGKKLFPYLRIRNNIA 148
           S+  P    +VPGNHD  +     +++     ++ YI +DT                 +A
Sbjct: 59  SLPGPR--IVVPGNHDVPLWNVFARAMTPLSRYRRYIEADTDPFYADS---------EVA 107

Query: 149 LIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRM 208
           ++G +TA +      +G     Q  A ++     +     RI++ HHP         + +
Sbjct: 108 VVGINTARSLT--IKDGRINVRQLKAATEKFAHMSDD-ITRIVVTHHPFEGRDLESDDGI 164

Query: 209 FGIQRFQ-KMIWHEGADLILHGHTHLN-----SLHWIKNEKKLIPVVGIASASQKVHSNK 262
            G            G D+IL GH HL+     +  ++ +    + +    + S ++    
Sbjct: 165 VGRADLAMHAFSRSGVDIILSGHQHLHRAGSSARRYLIDGYAALLIQAGTAVSSRLRRA- 223

Query: 263 PQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYD 305
              S+N+  IE    +  +  +     P     +   S  F  
Sbjct: 224 -ANSFNIIRIE----HPRISVECRAWQPSQSGFETSASYSFRQ 261


>gi|268324463|emb|CBH38051.1| conserved hypothetical protein, calcineurin-like phosphoesterase
           family [uncultured archaeon]
 gi|268324870|emb|CBH38458.1| conserved hypothetical protein, calcineurin-like phosphoesterase
           family [uncultured archaeon]
          Length = 247

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 59/293 (20%), Positives = 108/293 (36%), Gaps = 52/293 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISDIH++                       +++F  E+   +I  I     + V +
Sbjct: 2   RVVHISDIHVA-----------------------EQHFLPELLERVIRSINEIEPEIVVV 38

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+       E   +  ++  I     + ++PGNHDA   G                  
Sbjct: 39  TGDLTENGHQSEFKRAKSYIEKIECEKKV-VIPGNHDARNVGYL------------GFEE 85

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               + +   +     I ++G  +   T P    G+ G+E+     K L        F++
Sbjct: 86  IFGHRSI---IEKGEGITIVGIDS---TQPDLDVGHVGREKYGWIEKSLNS----NDFKV 135

Query: 191 IMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           + +HH    +  T              +++   G DL+L GH H+  +  +     +I  
Sbjct: 136 VALHHHLISIPKTGRERQIPMDAGDVLELLVRCGVDLVLCGHKHVPWIWNLNG--MIIAN 193

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
            G A  S +V  N PQ S+NL  I+++ +  T   + Y+     L ++K    
Sbjct: 194 AGTACTS-RVKWNIPQ-SFNLIEIDEEEKGTTKIYRMYSSGGQELVLEKRRDR 244


>gi|146281671|ref|YP_001171824.1| DNA repair exonuclease [Pseudomonas stutzeri A1501]
 gi|145569876|gb|ABP78982.1| probable DNA repair exonuclease [Pseudomonas stutzeri A1501]
          Length = 373

 Score =  149 bits (377), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 51/263 (19%), Positives = 97/263 (36%), Gaps = 20/263 (7%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ + + HF  ++     V   L + +  H  D +  +GDI       +  ++  ++R +
Sbjct: 110 IVQISDTHFGTEQ---PAVVQALEDHVREHRADLLVFSGDITQRARRGQFASAAAFVRRL 166

Query: 94  GN--PHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
                 D  ++PGNHD  +     +    + +Y         G  L P       + +IG
Sbjct: 167 EADGVGDTLVIPGNHDIPLYNVFARLFTPYGNYRQH-----FGDDLEPVFENEQML-VIG 220

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPP-VLDTSSLYNRMFG 210
            +T         +G     Q    ++ L + +  G  RI++ H P   +  S L N   G
Sbjct: 221 LNTTHPR--RHKDGVVTARQVERVARRLGE-SDPGKIRIVVAHQPFGAMVPSDLSNLQHG 277

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWI----KNEKKLIPVVGIASASQKVHSNKPQAS 266
            +   +     G DL++ GH HL  +  +        + I +V   +            S
Sbjct: 278 AEPALQRWAEHGLDLVMGGHIHLPYVLPLSRQYPGLAREIWMVQAGTTLSTRLRGTSPNS 337

Query: 267 YNLFYIEKKNEYWTLEGKRYTLS 289
           +N   +   +E      +R+ LS
Sbjct: 338 FNRLKLHPGDEKKVC-VERWDLS 359


>gi|126732955|ref|ZP_01748716.1| possible phospodiesterase [Sagittula stellata E-37]
 gi|126706572|gb|EBA05648.1| possible phospodiesterase [Sagittula stellata E-37]
          Length = 279

 Score =  149 bits (376), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 50/261 (19%), Positives = 99/261 (37%), Gaps = 21/261 (8%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +R++ L + H+ + +     +   L+  +     D V+I+GD        +   +  +L 
Sbjct: 2   RRVLHLSDLHYGKDRA---NLEAPLLETVDRLAPDLVAISGDFTQRARVSQFDRAQAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  P     VPGNHD  +     + L  WK Y +     +    L P  +  + + L+G
Sbjct: 59  KLTVP--WIAVPGNHDTPLDEFWIRLLTPWKRYRS-----AVSGDLEPVYQ-DDAMTLVG 110

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI 211
            +T          G   +++     +    A  +   RI+M+HHP           M G 
Sbjct: 111 VNTVNRFSW--QRGRLSEKRIKRACQQFSDAPDRA--RIVMLHHPLQHGPEVDKRLMRGA 166

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFY 271
            R  K     GA ++L GH H   +   +   +L+ V    S S ++       ++NL  
Sbjct: 167 GRALKAFAESGAQVVLSGHLHNTVIAPFRAWPQLLFVQAGTSLSSRMRGE--VNTFNLLE 224

Query: 272 IEKKNEYWTLEGKRYTLSPDS 292
           +    +  ++  + +     +
Sbjct: 225 V----DARSVTVESWGAEDLT 241


>gi|330817062|ref|YP_004360767.1| Metallophosphoesterase [Burkholderia gladioli BSR3]
 gi|327369455|gb|AEA60811.1| Metallophosphoesterase [Burkholderia gladioli BSR3]
          Length = 283

 Score =  148 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 52/274 (18%), Positives = 103/274 (37%), Gaps = 26/274 (9%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ + + HF  ++    E  + L+  I     + V I+GD+       +   +  ++  
Sbjct: 3   RLLQISDPHFGAERQ---EAVDALVRLIEQTRPELVVISGDLTQRARRHQFEAARAFVAR 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +G    +  +PGNHD  +     +    + +Y       + G++L P       +A IG 
Sbjct: 60  LGA-QPVLAIPGNHDLPLFDLIARWRQPYVNYRR-----AFGEELEPVFDAPALLA-IGV 112

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMFGI 211
           +T          G    EQ    ++ L  A+     R++++H P   +  ++ ++R+ G 
Sbjct: 113 NTTRPA--RHTAGEISAEQVARVARRLALASPAQL-RVVVVHQPIVAIGPANRHDRLHGG 169

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWI-----------KNEKKLIPVVGIASASQKVHS 260
           +   +     GADL+L GHTH      +             E+ +  V G  + S+++ +
Sbjct: 170 EIALRRWAAAGADLVLGGHTHRAGAWRVTPRDDEAGRDGAVERPVFMVQGGTAVSRRLRA 229

Query: 261 NKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLS 294
             P  S NL                     D   
Sbjct: 230 GTP-NSVNLIDYAGDALGPRRAAVTRCDYDDESR 262


>gi|124267369|ref|YP_001021373.1| putative DNA repair exonuclease [Methylibium petroleiphilum PM1]
 gi|124260144|gb|ABM95138.1| putative DNA repair exonuclease [Methylibium petroleiphilum PM1]
          Length = 274

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/295 (15%), Positives = 93/295 (31%), Gaps = 41/295 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M +   ISD H                                V   L+  +     D  
Sbjct: 1   MTLAIQISDPHFGTE-------------------------QPAVVEALLQLVREQAPDVA 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  ++  +G P    ++PGNHD  +     +    + ++  + 
Sbjct: 36  VLSGDITQRASRAQFRAARAFVDRLGTPV-TLVIPGNHDIPLFNPLARLFAPYANHRQAF 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                    +P      ++ L+  +T         +G     Q    +  L  A + G  
Sbjct: 95  GAELEPMAAWP------DLLLLTVNTTRPW--RHKDGEVSDAQVARVAAQL-HAAQPGQL 145

Query: 189 RIIMMHHPPVLDTSS-LYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE----K 243
           R++++H P  +       NR+       +     GADL+L GH HL  +  +        
Sbjct: 146 RVVVVHQPLAVTREEDEPNRLHRGTEAARAWSQAGADLVLGGHIHLPFVLPLHERFEALA 205

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKK-NEYWTLEGKRYTLSPDSLSIQK 297
           + +  V   +A  +   ++   S NL     +         +R+     S   + 
Sbjct: 206 RPLWAVQAGTAVSRRVRDEAGNSVNLVRSRGRVGPRREALVERWDYRAASQRFEP 260


>gi|281357041|ref|ZP_06243531.1| metallophosphoesterase [Victivallis vadensis ATCC BAA-548]
 gi|281316599|gb|EFB00623.1| metallophosphoesterase [Victivallis vadensis ATCC BAA-548]
          Length = 267

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 87/230 (37%), Gaps = 8/230 (3%)

Query: 11  VLAHISDIHLS-YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            + H SD H    +  +     KR +G+ N+ F R+           ++ IL    D   
Sbjct: 2   KIIHFSDPHAGGPAEDWLAYVDKRWVGVFNYRFRRQFRHDMSKLKKAVDYILDVKPDVAV 61

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPH-DISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            TGD+ +     E       L+ + +    +  +PGNHD Y+     K + A  + +   
Sbjct: 62  CTGDLTSTGQPGEFEQVRPILQPLRDSSIPLLYLPGNHDCYVKRP--KCVRAVNEMVEYL 119

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           +         P +R    +  +  + +  +    + G+     +    ++     +    
Sbjct: 120 SRGDYRFAELPLVREYAGVEFLLLNCSRPSNLLCSWGFVDPRDSEYLDRVCSAPKRGP-- 177

Query: 189 RIIMMHHPPV--LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL 236
           R+++ H+P         + +R+FG +R  +++     DL L GH H   L
Sbjct: 178 RVLLSHYPMFEEHPILRMRHRLFGQKRILELMKEGKIDLSLCGHVHRPYL 227


>gi|295691380|ref|YP_003595073.1| metallophosphoesterase [Caulobacter segnis ATCC 21756]
 gi|295433283|gb|ADG12455.1| metallophosphoesterase [Caulobacter segnis ATCC 21756]
          Length = 261

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 50/260 (19%), Positives = 87/260 (33%), Gaps = 22/260 (8%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           +++ + + HF  +     E        I     D V + GD+       E   +  WL  
Sbjct: 2   KLVQISDIHFGGENQ---EAVEAATQWIRDAAPDLVVVAGDLTLDGKATEFDAAAAWLER 58

Query: 93  IGNPHDISIVPGNHDAYISGA---KEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIAL 149
           + +P    +VPGNHD    G      +    W+ +          +   P       I +
Sbjct: 59  LPDPM--LVVPGNHDTPFVGPGELWTRFTRPWRRFSERFGLEDGAEWRGP------GITV 110

Query: 150 IGCSTAIATP--PFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYN- 206
              +TA A       + G   + Q       L  A  +   ++++ HHP +         
Sbjct: 111 TSINTARAAQLRWNWSKGAVSRRQIRRVCDRLAAAPSEDL-KVVVCHHPLMEVLGGPMTA 169

Query: 207 RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQAS 266
           R+ G         H   DL+L GH HL  +  +        +VG  + S +     P   
Sbjct: 170 RVRGGVDAANRFAHASVDLVLSGHIHLPFVTTVPFGDGKTQLVGSGTLSLRERGAAP--G 227

Query: 267 YNLFYIEKKNEYWTLEGKRY 286
           +NL  I+  +    +    Y
Sbjct: 228 FNL--IDADSGCVRVTALAY 245


>gi|298293393|ref|YP_003695332.1| metallophosphoesterase [Starkeya novella DSM 506]
 gi|296929904|gb|ADH90713.1| metallophosphoesterase [Starkeya novella DSM 506]
          Length = 270

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 53/267 (19%), Positives = 94/267 (35%), Gaps = 31/267 (11%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + HF R     + +A  L  ++     D V ++GD        E  ++  ++  
Sbjct: 2   RIVHLSDLHFGR---HDERLAEGLAEEVTRQAPDLVVVSGDFTQVGSVAEFMSARRFIDQ 58

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P  +  VPGNHD        + +  ++ Y           +  P+L +   IAL G 
Sbjct: 59  LAAP--VFAVPGNHDVPAWNLPLRLVDPYRRYRRH-----IHPEPEPFLNLEG-IALAGI 110

Query: 153 STAI--ATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP---PVLDTSSLYNR 207
            T+         ++G     Q       L   +K    RI++ HHP   P    +     
Sbjct: 111 KTSRRLRAGLDWSHGSISHGQLERLEARLSGVHKDKL-RIVVAHHPLMQPETPMARPMRL 169

Query: 208 MFGIQRFQKMIWHEGADLILHGHTH---LNSLHWIKNEK--------KLIPVVGIASA-S 255
           +    R           L+L GH H   +   H ++ E+          + VV   S  S
Sbjct: 170 VDRADRALATFARLDVRLVLSGHFHMSYVRHHHRVEGERTGPVHAAVAPLLVVQAGSTIS 229

Query: 256 QKVHSNKPQASYNLFYIEKKNEYWTLE 282
            ++  ++    YN+  I        + 
Sbjct: 230 TRLRDHR--NGYNVIDISDGKIAVAVR 254


>gi|197103773|ref|YP_002129150.1| 3',5'-cyclic-nucleotide phosphodiesterase [Phenylobacterium
           zucineum HLK1]
 gi|196477193|gb|ACG76721.1| 3',5'-cyclic-nucleotide phosphodiesterase [Phenylobacterium
           zucineum HLK1]
          Length = 264

 Score =  146 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/283 (19%), Positives = 93/283 (32%), Gaps = 41/283 (14%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           +   LAH+SDIH                             + E      + +     D 
Sbjct: 1   MTIRLAHLSDIHFGGE-------------------------NPEAVAAAADMLRGERFDL 35

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V ++GD+  +    E   +  WL  +  P    + PGNHDA      E+    ++ +   
Sbjct: 36  VVVSGDLTRYGEAWEFEQAKAWLDGL--PEQRLVTPGNHDAPYLAWAERIFAPFRRFERW 93

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFS--ANGYFGQEQAHATSKLLRKANKK 185
                    L P       +A+ G +TA    P    + G   + QA   +     A   
Sbjct: 94  IGAAPAQTWLAP------GVAVRGINTARGAQPRLNWSKGQIARRQAEEAAAWFDTAPPD 147

Query: 186 GFFRIIMMHHPPVLDTSSLYN-RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
              RI+++HHP +         R++G +           DL+L GH H            
Sbjct: 148 AV-RIVVVHHPLIEMLGGPMTARVWGGEAAAAAFAGAKVDLVLSGHIHAPFTWPYPYGDG 206

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
               VG  + S +     P   +N+  +E   + + +    +T
Sbjct: 207 RTYAVGAGTLSVRERGVPP--GFNIVEVE--ADCFRVTALAWT 245


>gi|11500006|ref|NP_071252.1| lacZ expression regulatory protein (icc) [Archaeoglobus fulgidus
           DSM 4304]
 gi|2650659|gb|AAB91233.1| lacZ expression regulatory protein (icc) [Archaeoglobus fulgidus
           DSM 4304]
          Length = 372

 Score =  146 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 61/287 (21%), Positives = 105/287 (36%), Gaps = 40/287 (13%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ + + HF  +    +E     +  I     D + ITGD+  +  + E+  +   L  
Sbjct: 2   RIVHISDLHFGEELI--REKVEKAVRQINEIEPDLLVITGDLSCWGIHSEMRDAYETLLD 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +    D   VPGNHDA   G      + +      +T               + ++LI  
Sbjct: 60  LKP--DYIAVPGNHDARNIG------YEFFQLYFGETKK---------YWKNDVVSLIAA 102

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFG 210
            +   T P   +GY G+EQ       +R    K  F I+ +HH   P+  T    N +  
Sbjct: 103 DS---TQPDLDDGYIGKEQRDWIVSKIR----KDRFNILALHHHIAPIPKTGRERNVLID 155

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                +++   G   +L GH H+     +        V+   +         P  +YN+ 
Sbjct: 156 AGEMVELLIANGISAVLAGHRHMPYSLRLMRTH----VIHAGTLGSFKVLGMPDHNYNVI 211

Query: 271 YIEKKN--------EYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLVL 309
            I+           +Y  +E  RYT++P++      Y  I     VL
Sbjct: 212 EIKDNTLTLKLRFVDYGEVEIGRYTINPETPESISVYQRIAKPKKVL 258


>gi|20090538|ref|NP_616613.1| 3',5'-cyclic-nucleotide phosphodiesterase [Methanosarcina
           acetivorans C2A]
 gi|19915566|gb|AAM05093.1| 3',5'-cyclic-nucleotide phosphodiesterase [Methanosarcina
           acetivorans C2A]
          Length = 244

 Score =  146 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 56/277 (20%), Positives = 99/277 (35%), Gaps = 53/277 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           + H+SDIH S                       + YF  E+A  ++  I   + D V IT
Sbjct: 3   IVHLSDIHFS-----------------------EAYFVPEIAESMLQKINQLDPDIVVIT 39

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+     + E      ++  I     + +VPGNHD+  +G        ++D        
Sbjct: 40  GDLTENGFSAEYDGVKEFIDKIECKDKV-LVPGNHDSKNAGYL-----HFED-------- 85

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
              +  FP  R   N+ ++G  +   + P    G+ G+E      +     N    F++ 
Sbjct: 86  -LFENRFPT-RNLGNVTVVGADS---SQPDLDEGHLGRENYGWIKEAFSGEN----FKVF 136

Query: 192 MMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            +HH   P+         +        ++     +L+L GH H+  +  + N    + VV
Sbjct: 137 ALHHHLVPIPLAGRENTVLVDAGDVLDLLNRCKVNLVLCGHCHIPHVWNLNN----MLVV 192

Query: 250 GIASASQKVHSNKPQASYNLFYIE-KKNEYWTLEGKR 285
              +        K    +NL   E  +N  W +   R
Sbjct: 193 NAGTFCSSKTRGKTTQCFNLIQAENGENNNWNVRVSR 229


>gi|292492919|ref|YP_003528358.1| metallophosphoesterase [Nitrosococcus halophilus Nc4]
 gi|291581514|gb|ADE15971.1| metallophosphoesterase [Nitrosococcus halophilus Nc4]
          Length = 284

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 55/275 (20%), Positives = 97/275 (35%), Gaps = 46/275 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISD+H                            F  EV   L+  I   + + +
Sbjct: 1   MLNLLHISDLHFGKP------------------------FLPEVGEALLGKIEKLSPELL 36

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+      +E   +  +L  + +   + +VPGNHD  +    E+    ++ Y    
Sbjct: 37  VVSGDLTQRAKAQEFRAARAYLDLMPSIPQV-VVPGNHDIPLYRIFERLFQPYELYRRYI 95

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA--NGYFGQEQAHATSKLLRKANKKG 186
           +           +  +N   ++G  +   T P+ A  NG   ++Q    +K   +A  + 
Sbjct: 96  SEQRD------TVLHQNKAVIVGLDS---TNPYFAITNGRIHRKQLAFCAKAFTEAPAEA 146

Query: 187 FFRIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL----HWIKN 241
              ++  HH  P  D       M   +R   +      DLIL GH H   +         
Sbjct: 147 VRIVVAHHHFAPAPDYKG-GEVMPKAKRALDLFTQLKVDLILAGHLHRAYVGNSLDVYPG 205

Query: 242 EKKL---IPVVGIASASQK-VHSNKPQASYNLFYI 272
           E +    I      S S++ V   + + S+N   I
Sbjct: 206 EDREHGIIIAQCGTSTSRRGVAREQEKNSFNWIEI 240


>gi|82617413|emb|CAI64324.1| probable phosphodiesterase [uncultured archaeon]
          Length = 266

 Score =  146 bits (368), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 53/278 (19%), Positives = 101/278 (36%), Gaps = 54/278 (19%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + H+SD+H+                          +F  +VA  ++  +   + D +
Sbjct: 1   MTRIVHLSDLHVC-----------------------GAHFLTDVAESVVQGVNKISPDIL 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD+      +E   +  W+      + + IVPGNHD+   G        ++D   + 
Sbjct: 38  VITGDLTQNGSCQEYKEAKEWIDRFECRNKV-IVPGNHDSRNVGYL-----LFEDIFGAR 91

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK--ANKKG 186
           ++C +           + + ++G  +   +     +G+ G+E     ++      ++K  
Sbjct: 92  SSCCSL----------DGVTVVGVDS---SQHDIDDGHLGREVYGWIAENFNSNLSSKSN 138

Query: 187 F----FRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
                FRI  +HH   PV  T              +++   G D++L GH H+  +  + 
Sbjct: 139 LNSTDFRIFALHHHLIPVPMTGREEEIPVDSGDVLELLDRCGVDIVLCGHRHVPWVWKLN 198

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY 278
                  VV   +A       K    YNL  IE   + 
Sbjct: 199 GMF----VVNAGTACSNKIKAKTTQCYNLIEIENDGKG 232


>gi|320104186|ref|YP_004179777.1| metallophosphoesterase [Isosphaera pallida ATCC 43644]
 gi|319751468|gb|ADV63228.1| metallophosphoesterase [Isosphaera pallida ATCC 43644]
          Length = 350

 Score =  145 bits (367), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 62/267 (23%), Positives = 101/267 (37%), Gaps = 32/267 (11%)

Query: 10  FVLAHISDIHL-SYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
             + H+SDIH         +L  KRI+G V+    R + F  +    +I  +L    DHV
Sbjct: 19  LRIVHLSDIHFWRIEIGPRDLFSKRIVGSVSLLLGRARAFKLDRLPAVIERVLSLQPDHV 78

Query: 69  SITGDIVNFTCNREIFTSTHWLRS-IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            I+GD+      RE   +   L   + +P   +IVPGNHD Y   A  +    +++Y   
Sbjct: 79  VISGDLTTTASEREFQDARAGLAPLLEDPRRATIVPGNHDRYTGEA--QRSRRFEEYFG- 135

Query: 128 DTTCSTGKKLFPYLRIRNN-IALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK----- 181
                TG   FP+L+  ++  A++G     A    +A G+  + Q  A   LL       
Sbjct: 136 ---EFTGGPEFPWLKHLDHQTAILGLDPTRA--DLTARGHLPESQIVAAHHLLGGQLTPD 190

Query: 182 -----------ANKKGFFRIIMMHH----PPVLDTSSLYNRMFGIQRFQKMIWHEGADLI 226
                         K    I++ H+    PP+        R+       + +   G  L 
Sbjct: 191 PDGSGEVHVGVPPHKPRRLIVLCHYPLTAPPIYLLELHPKRLTNAWVLGEWLRLLGPHLY 250

Query: 227 LHGHTHLN-SLHWIKNEKKLIPVVGIA 252
             GH H   +   +   ++L    G  
Sbjct: 251 CCGHIHAAWAFRPLDLPEQLCLNAGAP 277


>gi|219849812|ref|YP_002464245.1| metallophosphoesterase [Chloroflexus aggregans DSM 9485]
 gi|219544071|gb|ACL25809.1| metallophosphoesterase [Chloroflexus aggregans DSM 9485]
          Length = 276

 Score =  145 bits (366), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 55/278 (19%), Positives = 91/278 (32%), Gaps = 44/278 (15%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           + F + HISD+H                            F+   A  LI D      D 
Sbjct: 1   MAFRILHISDVHTGPP------------------------FNPAAAERLIADAHTLKPDL 36

Query: 68  VSITGDIVNFT-CNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           V I+GD V       +   +      +  P    +V GNHD  +    E+ LH  + Y  
Sbjct: 37  VVISGDFVQRADFAAQWRAARILRERLPQPQ--LVVAGNHDVPLFNLPERLLHPLRRY-- 92

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                     L P       +A++G  TA         G     Q  A  + L +     
Sbjct: 93  ---QQQISPDLNPVFTAPG-LAVVGACTAHGWT--VDGGKLYPNQMTALRQRLSQFGPD- 145

Query: 187 FFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKN--- 241
            ++I++ HHP  L  +    R+         +++     DL+L GH H++ +   ++   
Sbjct: 146 VYKIVVWHHPVALPPTYRRKRVTISNAHEAIRLLDELAVDLLLCGHLHISFVGNTRDFQP 205

Query: 242 ---EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
                  I   G  ++ +         + NL  IE   
Sbjct: 206 DVRHGTYIVQSGTTTSRRGYGPEHGMNTCNLITIEHDG 243


>gi|163745069|ref|ZP_02152429.1| possible phospodiesterase [Oceanibulbus indolifex HEL-45]
 gi|161381887|gb|EDQ06296.1| possible phospodiesterase [Oceanibulbus indolifex HEL-45]
          Length = 268

 Score =  145 bits (366), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 56/275 (20%), Positives = 98/275 (35%), Gaps = 22/275 (8%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R+I L + HF + +    ++   L++ +  ++ D V I+GD+      +E   +  ++  
Sbjct: 3   RLIHLSDLHFGKDR---PDLLAPLLSAVNGYDPDLVIISGDLTQRAREKEYRAARAFIDR 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           I  P  +  VPGNHD  +     + L  W+ Y          + L P     + IA +G 
Sbjct: 60  INAP--VLSVPGNHDIPLHRPFTRFLTPWRYYRHW-----IDRDLTPVHEGPDFIA-VGI 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           +T      F         +    +        +   RI + HHP    T +    + G +
Sbjct: 112 NT---VDRFKWQTGKLGLRRLRRACRALSRGGENTLRIAVCHHPLDHPTETQKRPIPGAK 168

Query: 213 RFQKMIWHEGADLILHGHTHL----NSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYN 268
           R  + +   GADLIL GH H+       H        + +   A  S           +N
Sbjct: 169 RALRRLLDCGADLILSGHLHIWHAGTFAHPAPEHDGHLAIQLHAGTSLSSRQRGEPNDFN 228

Query: 269 LFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           L  I        +   R +      +  K  +  F
Sbjct: 229 LIDISPL----HVNLSRISFDDAKGAFTKAEARQF 259


>gi|15606092|ref|NP_213469.1| hypothetical protein aq_684 [Aquifex aeolicus VF5]
 gi|2983283|gb|AAC06876.1| putative protein [Aquifex aeolicus VF5]
          Length = 249

 Score =  145 bits (366), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 52/269 (19%), Positives = 103/269 (38%), Gaps = 50/269 (18%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +AHISD+H+                       + +++   + N L+  +     D + I
Sbjct: 2   KIAHISDLHV-----------------------KCEWYEDRLGNNLVKYLNAQKPDLLII 38

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ ++    E   +  +L  I     + +VPGNHDA   G        ++++  +   
Sbjct: 39  TGDLTDYGYYAEYKRAYSFLELIEVEKRV-VVPGNHDARNEG-----YELFEEFFGTRM- 91

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                   PY      + +IG  +++   P    G+ G++      + L+    K   +I
Sbjct: 92  --------PYYE-DEYMVIIGMDSSL---PDREEGHIGRKGYKFLRETLKDKGDK--LKI 137

Query: 191 IMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           + +HH   P+  T S    +       K++   G +L+L GH H   +  +         
Sbjct: 138 VALHHHVVPIPATGSDLAILTDAGNLMKVVDELGVELVLTGHKHKAWVWKLN----ETYY 193

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNE 277
           V   +A+ +    K   S+ + Y+E +  
Sbjct: 194 VTAGTATTRRLKAKDYPSFYMLYLEDEKN 222


>gi|83594620|ref|YP_428372.1| metallophosphoesterase [Rhodospirillum rubrum ATCC 11170]
 gi|83577534|gb|ABC24085.1| Metallophosphoesterase [Rhodospirillum rubrum ATCC 11170]
          Length = 289

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 63/274 (22%), Positives = 106/274 (38%), Gaps = 31/274 (11%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +RI  + + HF R      +    L  +++    D V ++GD+     +R+   +  +L 
Sbjct: 2   RRIAHISDLHFGRV---DPDAVIALGQELIAQAPDLVVVSGDLTQRARSRQFLDARAFLD 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           S+  P  I +VPGNHD       ++ L     +         GK L P LR    + + G
Sbjct: 59  SLKLP--ILVVPGNHDVPWHNPVQRFLGPHGRFRK-----MIGKDLSPVLR-DPEMTVAG 110

Query: 152 CSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPV-----LDTSSL 204
            +T+ A  P    ANG    ++A   + LL  A      R+++ HHP          +S 
Sbjct: 111 ITTSRALVPHWNWANGRISTKRARRVATLLA-AEPAEKLRVVVTHHPLAFAPSPTGGASP 169

Query: 205 YNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL-------IPVVGIASAS 255
              +  F      + +     DL+L GH H++    +               VV  ASA 
Sbjct: 170 DGTLPTFNAAGALRALGAARVDLMLSGHMHVSRAACLSFPGPKPDGTPWTAVVVQAASAI 229

Query: 256 QKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
                 +P A YN+  IE       +  + +T+ 
Sbjct: 230 STRLRGEPNA-YNM--IETSANGLDVHIRAWTVG 260


>gi|108803821|ref|YP_643758.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
 gi|108765064|gb|ABG03946.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
          Length = 271

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 50/252 (19%), Positives = 86/252 (34%), Gaps = 24/252 (9%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ + + H      F  E+    + +      D V++ GD+       E   +   L  
Sbjct: 2   RIVQMSDIHVG-SGLFRPELLEAAVRETNELRPDLVAVAGDLTMEGYRWEFEEARRHLDR 60

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  PH + +V GNHDA   G        ++D   S                +    ++  
Sbjct: 61  LECPH-VVVVMGNHDAKSVG-----YRHFEDIFGSRARSLVVPSP------QGEAKVVAI 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFG 210
            +   T P    G  G+E         R   +    +I+M+HH    V  T    N +  
Sbjct: 109 DS---TKPDLDEGEVGREYYAWIDSEFRGWERGP--KILMIHHHILAVPGTGRDVNILRD 163

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                 M+     D++L GH H+  +  I   +    V+   + S          SYNL 
Sbjct: 164 AGDVMAMLRELKVDMVLSGHRHVPYVWSISGVR----VIHSGTVSSLRVRGTMPPSYNLI 219

Query: 271 YIEKKNEYWTLE 282
            ++ +    TL 
Sbjct: 220 DLDDETVRITLR 231


>gi|114762136|ref|ZP_01441604.1| possible phospodiesterase [Pelagibaca bermudensis HTCC2601]
 gi|114545160|gb|EAU48163.1| possible phospodiesterase [Roseovarius sp. HTCC2601]
          Length = 275

 Score =  144 bits (364), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 52/277 (18%), Positives = 99/277 (35%), Gaps = 21/277 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ + + HF R      E+ + L++ +     D V++TGD      N +   +  +L  
Sbjct: 3   RIVHISDLHFGRT---DVELLDPLVDAVNATQADLVAVTGDFTQRARNSQYRDARAFLDR 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
              P     VPGNHD  +     + +  ++ Y            LFP  R    +A +G 
Sbjct: 60  FEAP--WLAVPGNHDISLDNLWLRLMRPFRRYR-----DHICNDLFPVHRGDGFVA-VGL 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           +T          G     Q     K+   +      R+++ HHP   D     + M   +
Sbjct: 112 NT--VDQYRWQRGRIRWRQMRNACKIFSDS--DEAIRVVLAHHPFEQDQDVKKSLMPKAE 167

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGI---ASASQKVHSNKPQASYNL 269
           +  + +   GA L+L GH H        + K    V+ I      S ++   +    + +
Sbjct: 168 KAIEQLAECGAHLLLSGHLHRWRAEPFLSRKHGAQVLQIHVGTGLSTRLRGQE--NDFAV 225

Query: 270 FYIE-KKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYD 305
             ++  + +   +  +     P      +   D + D
Sbjct: 226 LDLDADEAKVTRMVARGEQFVPAGSRSFQFGEDGWRD 262


>gi|163847798|ref|YP_001635842.1| metallophosphoesterase [Chloroflexus aurantiacus J-10-fl]
 gi|222525666|ref|YP_002570137.1| metallophosphoesterase [Chloroflexus sp. Y-400-fl]
 gi|163669087|gb|ABY35453.1| metallophosphoesterase [Chloroflexus aurantiacus J-10-fl]
 gi|222449545|gb|ACM53811.1| metallophosphoesterase [Chloroflexus sp. Y-400-fl]
          Length = 295

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/289 (19%), Positives = 96/289 (33%), Gaps = 46/289 (15%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           + F + HISDIH                            F+   A  LI D    N D 
Sbjct: 1   MPFRILHISDIHTGPP------------------------FNPAAAERLIADAHALNPDL 36

Query: 68  VSITGDIVNFT-CNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           + I+GD V     +R+   +    R +  P    +V GNHD  +    E+    +  Y  
Sbjct: 37  LVISGDFVQRADFSRQWQAACELRRRLPQPQ--LVVAGNHDVPLFLLHERLFRPFDRYRR 94

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
             T         P       IA+IG  TA         G   ++Q       L       
Sbjct: 95  YITPDLNPVFTAP------GIAVIGACTAHGWT--IDGGRLNRDQMQTLRSQLAGLAAD- 145

Query: 187 FFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN--- 241
            +++++ HHP     +    R  +       +++     DL+L GH HL+ +   ++   
Sbjct: 146 TYKVVVWHHPVGFPPAYQRKRPLVANAGEAMQLLAEFAVDLLLCGHLHLSFVGNTRDFLP 205

Query: 242 ---EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
                  I   G  ++ +         + NL  IE   +   ++  R+ 
Sbjct: 206 ELRHGTYIVQSGTTTSRRGYGDEHGANTCNLITIE--ADGARVQHLRFD 252


>gi|310819179|ref|YP_003951537.1| metallophosphoesterase [Stigmatella aurantiaca DW4/3-1]
 gi|309392251|gb|ADO69710.1| Metallophosphoesterase [Stigmatella aurantiaca DW4/3-1]
          Length = 296

 Score =  143 bits (362), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 88/218 (40%), Gaps = 11/218 (5%)

Query: 11  VLAHISDIHLSYS---PSFFELSPKRIIGLVNWHFNRKKY---FSKEVANLLINDILLHN 64
              H SD+H++          L  +R + +V     R+      +      +  +   H 
Sbjct: 2   RFIHCSDVHVTGDYFALPLRRLGWRRWLAMVELTVGRRARAYRHAPATLARIAQEAHAHA 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRS-IGNPHDISIVPGNHDAYISG--AKEKSLHAW 121
            DH+ ++GDI  +    E   +   L     +    +++PGNHD +  G     +    +
Sbjct: 62  ADHLILSGDITAYALESEFQGAREALGEWAQDRRRCTVIPGNHDVFTPGGHRSRRFERYF 121

Query: 122 KDYITSDTTCSTGKKLFPYLRIRN-NIALIGCSTA-IATPPFSANGYFGQEQAHATSKLL 179
              + SD      +  FP++R+     A++G  +A +   P  A+G+ G  Q    + ++
Sbjct: 122 GHLLESDLPEHCREGAFPFVRLVGEGAAVVGLLSARVPFMPGIAHGWVGPAQLEGLAAVV 181

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKM 217
           +    +G   ++++HH P+       +   G++  + +
Sbjct: 182 KDPRLEGRALLVVVHHAPLTPRGRTDHVFHGLRDAEAL 219


>gi|94496929|ref|ZP_01303503.1| hypothetical protein SKA58_12772 [Sphingomonas sp. SKA58]
 gi|94423605|gb|EAT08632.1| hypothetical protein SKA58_12772 [Sphingomonas sp. SKA58]
          Length = 296

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 48/277 (17%), Positives = 85/277 (30%), Gaps = 42/277 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AH+SDIH   +                            + +     +     D V
Sbjct: 1   MARIAHLSDIHFGAN-------------------------DPRIVDAATAWLEERRPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPH-DISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            I+GD        +   +  WL  +        ++PGNHD  +     + L   + Y   
Sbjct: 36  VISGDFTQRARVGQFRQAAAWLGKLRAAGLKTLVIPGNHDVPLYDVLRRFLTPLRRYRR- 94

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                    L P+    + +A+ G +TA +      +G    +Q            +   
Sbjct: 95  ----YISHDLCPFYE-DDEVAIFGINTARSLT--IKDGRINHDQMDMLRHRFAHVPRD-K 146

Query: 188 FRIIMMHHP----PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK--- 240
            RI++ HHP    P+     L   +       +     G  + L GH H           
Sbjct: 147 TRILVTHHPLFSMPIGKGGELSEAVGRHDDAVQAACEAGVHVALAGHFHRTYAESADKMV 206

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE 277
                  V+   +A+     N    S+N  ++ + NE
Sbjct: 207 AHSGGALVIQAGTATSTRLRNDEPQSFNWLHVRRNNE 243


>gi|56475738|ref|YP_157327.1| DNA repair exonuclease [Aromatoleum aromaticum EbN1]
 gi|56311781|emb|CAI06426.1| DNA repair exonuclease [Aromatoleum aromaticum EbN1]
          Length = 285

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 58/285 (20%), Positives = 97/285 (34%), Gaps = 44/285 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            LAHISD H     +                          V + L  D+L    D V +
Sbjct: 2   RLAHISDPHFGTEEAP-------------------------VRDALREDLLREAPDLVVL 36

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGDI       +   +  +L S+  P  +  +PGNHD  +     +    ++ Y      
Sbjct: 37  TGDITQRARQAQFRAARAFLDSLA-PLPVLTLPGNHDLPLFDLFTRFTAPYRHYRRH--- 92

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                 L P  R R  +A++G ++         +G          ++ L    +   F++
Sbjct: 93  --ICASLSPLWRGR-RVAVVGVNSTR--MLRHKHGELPAPLVEQVARQLAALGES--FKV 145

Query: 191 IMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           + +HHP  +++ S   NR+ G           GADL L GH HL       +  +   V+
Sbjct: 146 VALHHPLEIIEPSDRRNRVRGADAALAAWIAAGADLFLGGHIHLPYCVATGDGSRDALVL 205

Query: 250 GIASASQKVHSNKPQASYNLFYI-------EKKNEYWTLEGKRYT 287
              ++      N    SYNL            +     +E +   
Sbjct: 206 QAGTSMSTRRRNGRPNSYNLVRFVPIALRGAGEAGLRRIEIEERD 250


>gi|16127786|ref|NP_422350.1| hypothetical protein CC_3556 [Caulobacter crescentus CB15]
 gi|221236607|ref|YP_002519044.1| phosphohydrolase [Caulobacter crescentus NA1000]
 gi|13425294|gb|AAK25518.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220965780|gb|ACL97136.1| predicted phosphohydrolase, Icc family [Caulobacter crescentus
           NA1000]
          Length = 262

 Score =  142 bits (359), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 57/249 (22%), Positives = 91/249 (36%), Gaps = 22/249 (8%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R+I L + HF  +   +   A      I     D V + GD+       E   +  WL +
Sbjct: 2   RLIQLSDIHFGGENAEAVAAAGA---WIRAAAPDLVVVAGDLTLDGRACEFDAAAAWLET 58

Query: 93  IGNPHDISIVPGNHDAYISGA---KEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIAL 149
           +  P    + PGNHD    G     E+    W+ +          +   P       + L
Sbjct: 59  LPRPM--IVTPGNHDTPFVGPGELWERFTRPWRRFCDRFGAEDGARWRGP------GVTL 110

Query: 150 IGCSTAIATPPFS--ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPP--VLDTSSLY 205
              +TA A       + G  GQ+Q       L +A   G  RI++ HHP   +L      
Sbjct: 111 TTLNTARAAQLRLNWSKGAVGQDQIRRVVGEL-EAAPAGDLRIVVCHHPLMEILGGPMTA 169

Query: 206 NRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQA 265
               G+   ++ +   GAD+IL GH HL  +  +         +G  + SQ+     P  
Sbjct: 170 RVHGGVGAAKQFVK-AGADVILSGHIHLPFVTPLPFGDGRTQAIGSGTLSQRERGAAP-- 226

Query: 266 SYNLFYIEK 274
            +N+  I  
Sbjct: 227 GFNVIEIAP 235


>gi|32476883|ref|NP_869877.1| 3,5-cyclic-nucleotide phosphodiesterase cpdA-like protein
           [Rhodopirellula baltica SH 1]
 gi|32447431|emb|CAD79020.1| 3,5-cyclic-nucleotide phosphodiesterase cpdA homolog
           [Rhodopirellula baltica SH 1]
          Length = 304

 Score =  142 bits (358), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 42/277 (15%), Positives = 91/277 (32%), Gaps = 48/277 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H                            +   V   L+      + D V +
Sbjct: 2   KILHISDVHFGPP------------------------YLPNVGEALLRTAPSIDPDVVVV 37

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA---WKDYITS 127
           +GD+      ++   +  +++ + +   I ++PGNHD  +    E+       ++ YI++
Sbjct: 38  SGDLTQRAKPQQFQQAAEFIKQLPDVPRI-VIPGNHDVPLYRIMERLTDPHRYYRQYISN 96

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           +                 +   +G  +        +NG     Q              G 
Sbjct: 97  ELNTVLQTP---------DALFVGLDSTAPRS-AISNGRIHPSQLDFCRDAFGSV-PDGL 145

Query: 188 FRIIMMHHPPVLDTSSLYN-RMFGIQRFQKMIWHEGADLILHGHTHLNSL------HWIK 240
            +I++ HH        L++  M   +R   +    G +LIL GH H   +      +   
Sbjct: 146 AKIVVAHHHFAPAPDYLHDQTMPKAKRAINLFVKLGVELILGGHLHRAFIGNTLDFYPGA 205

Query: 241 NEKKLIPVVGIASASQKVHSNK--PQASYNLFYIEKK 275
                I +V   + + +    +   + S+N   + ++
Sbjct: 206 GRAHGIVIVQCGTTTSRRGRGREKEKNSFNEIDVTEQ 242


>gi|294012653|ref|YP_003546113.1| putative phosphohydrolase [Sphingobium japonicum UT26S]
 gi|292675983|dbj|BAI97501.1| putative phosphohydrolase [Sphingobium japonicum UT26S]
          Length = 293

 Score =  142 bits (358), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 47/277 (16%), Positives = 88/277 (31%), Gaps = 42/277 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AH+SD+H                                +       +  H  D V
Sbjct: 1   MARIAHLSDVHFGA-------------------------HDPRIVAATEAWLQRHRPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNP-HDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            I+GD        +   +  WL  +     ++ +VPGNHD  +     +     + Y   
Sbjct: 36  VISGDFTQRARPEQFRQAAAWLNRLRAAGMELLVVPGNHDVPLYDLARRFGAPLRRY--- 92

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                    L P+ +  + +A++G +TA +      +G    +Q             +  
Sbjct: 93  --KRYISNDLCPFFQ-DDAVAILGLNTARSLT--IKDGRINHDQMDMLRASFASVAPE-K 146

Query: 188 FRIIMMHHP----PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK--- 240
            RI++ HHP    P+     L   +   +   +     G  + L GH H           
Sbjct: 147 TRILVTHHPLFAMPIGKGGELSEAVGRHEDAVRAAAEAGIHIALAGHFHRTYAEAADRMV 206

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE 277
                  V+   +A+     N    S+N  ++ + +E
Sbjct: 207 AHAGGALVIQAGTATSTRLRNAEPQSFNWLHVHRHDE 243


>gi|307294590|ref|ZP_07574432.1| metallophosphoesterase [Sphingobium chlorophenolicum L-1]
 gi|306879064|gb|EFN10282.1| metallophosphoesterase [Sphingobium chlorophenolicum L-1]
          Length = 308

 Score =  141 bits (357), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 47/277 (16%), Positives = 90/277 (32%), Gaps = 42/277 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AH+SD+H                               ++A      +     D V
Sbjct: 1   MARIAHLSDMHFGA-------------------------HDPKIAAAAEAWLQQRQPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNP-HDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            I+GD        +   ++ W+  +      + +VPGNHD  +     +     + Y   
Sbjct: 36  VISGDFTQRARRDQFRQASAWVNRLRAAGMKLLVVPGNHDVPLYDLARRFGAPLRRY--- 92

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
               +    L P+    + +A++G +TA +       G    +Q         +    G 
Sbjct: 93  --KRAISNDLCPFFE-NDEVAILGLNTARSLT--IKGGRLNHDQMRMLRDRFARVAP-GK 146

Query: 188 FRIIMMHHP----PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK--- 240
            RI++ HHP    P+     L   +   +   +     G  + L GH H       +   
Sbjct: 147 TRILVTHHPLFAMPIGKGGELSEAVGRHEDAVRAAASAGIHVALAGHFHRTYAEAAEKMV 206

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE 277
                  V+   +A+     N    S+N  ++ + +E
Sbjct: 207 AHAGGALVIQAGTATSTRLRNAEPQSFNWLHVHRHDE 243


>gi|328543617|ref|YP_004303726.1| Ser/Thr protein phosphatase family protein [polymorphum gilvum
           SL003B-26A1]
 gi|326413361|gb|ADZ70424.1| Ser/Thr protein phosphatase family protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 284

 Score =  141 bits (357), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/238 (21%), Positives = 92/238 (38%), Gaps = 31/238 (13%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
            M +LA I+D+HL            R  GL  +  +     ++     L+   L    D 
Sbjct: 6   FMTILAQITDLHL------------RPRGLTCYRVSDTNNLAERAIRALLA--LSPRPDA 51

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V +TGDI +    RE   + H L  +  P  + ++PGNHD     + +    A+ DY   
Sbjct: 52  VVVTGDITDGADAREYALARHILGRL--PMPVYVLPGNHD-----SSDTLRAAFSDYPGI 104

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
               +   KL  Y      + L+   +++A  PF   G  G EQ     ++L + ++   
Sbjct: 105 RDAPTASGKLH-YTADVGGLRLVALDSSVAGKPF---GLLGAEQLAWLDRVLAEDDRPA- 159

Query: 188 FRIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
             ++ +HHPP+       +   +     F  ++      + ++ GH H   +      
Sbjct: 160 --VVAVHHPPMATGIQHMDSIALHDTDAFAAVLSRHAHVERLICGHVHRPIVAGFAGT 215


>gi|167644056|ref|YP_001681719.1| metallophosphoesterase [Caulobacter sp. K31]
 gi|167346486|gb|ABZ69221.1| metallophosphoesterase [Caulobacter sp. K31]
          Length = 286

 Score =  141 bits (355), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 51/263 (19%), Positives = 94/263 (35%), Gaps = 24/263 (9%)

Query: 20  LSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTC 79
           ++  P      P +++ + + HF  +    K      +  I     D +   GD+     
Sbjct: 1   MTPEPR----KPLKLVQVSDIHFGGEH---KAAVEAAVERINAEAPDLLIAAGDLTKDGK 53

Query: 80  NREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE---KSLHAWKDYITSDTTCSTGKK 136
           + E   +  WL  +  P    + PGNHD    G  E   + +  W+ Y     +   G+ 
Sbjct: 54  STEFDAAQAWLDRLPRPR--LVTPGNHDTPFVGPSEILTRLVAPWRRY----ESRFGGRH 107

Query: 137 LFPYLRIRNNIALIGCSTAIATPPFS--ANGYFGQEQAHATSKLLRKANKKGFFRIIMMH 194
              +   R  +A    ++A A       + G   + Q       L +A   G  +I++ H
Sbjct: 108 NSDWDDPRATVAT--LNSARAFQLRLNWSKGAVSRGQVREVCADL-EAAAPGAVKIVVCH 164

Query: 195 HPPVLDTSSLYN-RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIAS 253
           HP +         ++ G     +     G DL+L GH H   +H           VG  +
Sbjct: 165 HPLIEMLGGPMTAKVRGGTAAAQAFSQAGVDLVLTGHIHAPFVHPYPFSDGCTQAVGSGT 224

Query: 254 ASQKVHSNKPQASYNLFYIEKKN 276
            S +     P  S+N+  ++  +
Sbjct: 225 LSVRERGVPP--SFNVIEVDDAD 245


>gi|149185235|ref|ZP_01863552.1| hypothetical protein ED21_19317 [Erythrobacter sp. SD-21]
 gi|148831346|gb|EDL49780.1| hypothetical protein ED21_19317 [Erythrobacter sp. SD-21]
          Length = 286

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 48/262 (18%), Positives = 96/262 (36%), Gaps = 17/262 (6%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           +RI  L + HF  +        + +  +I     D V+ITGD+     +RE   +THW+ 
Sbjct: 6   RRIFHLSDIHFGLENN---RALDWVKQEISEKRPDAVAITGDLTMRARHREFEAATHWIN 62

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           S+  P  + +  GNHD       E+    +K +   +        L         +A++ 
Sbjct: 63  SLEAPVTVEV--GNHDMPYFNPIERFFAPYKRFRGMEEKVEKEIDL-------GCLAIVP 113

Query: 152 CSTAIATPPFS--ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
             TA+   P    + G+   +        +  A  +G   ++ +HHP     +       
Sbjct: 114 LKTAVRAQPRLNWSKGWVTDDALAKCLAAI-DALPEGTRAVVAVHHPLREVGTQGTALTK 172

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
              +    +     + +L GH H         E+  + ++G  + S++  S  P  S+N 
Sbjct: 173 NGDKALLALAKRPVEAVLSGHVHDAFDIMESTEEGPVRMIGAGTLSKRTRSTPP--SFNE 230

Query: 270 FYIEKKNEYWTLEGKRYTLSPD 291
              +      ++    +  + D
Sbjct: 231 IEWDGATLSVSVRNLEHVETRD 252


>gi|73668764|ref|YP_304779.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina barkeri
           str. Fusaro]
 gi|72395926|gb|AAZ70199.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina barkeri
           str. Fusaro]
          Length = 230

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 46/240 (19%), Positives = 91/240 (37%), Gaps = 30/240 (12%)

Query: 50  KEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAY 109
            E+AN ++ +I   + D + ITGD+       E   +  ++  I   + + IVPGNHD+ 
Sbjct: 2   PEIANSMLENINRSSPDIIVITGDLTENGLAAEYNGAKKFIDRIECKNKV-IVPGNHDSR 60

Query: 110 ISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQ 169
            +G           +        +    F        I ++G  +   + P    G+ G+
Sbjct: 61  NAGYL---------FFEDLFKTRSTSGQF------GEITVVGLDS---SQPELDEGHIGR 102

Query: 170 EQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILH 228
           E  +         +  GF    + HH  P+  T    N +       +++   G +L+L 
Sbjct: 103 ENYNWIENTF---SVNGFKVFALHHHLIPIPRTGRGNNVLVDAGDVLELLDRSGVNLVLC 159

Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIE-KKNE--YWTLEGKR 285
           GH H+  +  + +    + V+   +        K    YN   ++  +++   W L+  R
Sbjct: 160 GHWHIPWVWRLND----MLVISAGTVCSSKVRGKMSQCYNFIEVDAPESDCKRWHLQVCR 215


>gi|309789926|ref|ZP_07684503.1| metallophosphoesterase [Oscillochloris trichoides DG6]
 gi|308228058|gb|EFO81709.1| metallophosphoesterase [Oscillochloris trichoides DG6]
          Length = 268

 Score =  140 bits (353), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 54/301 (17%), Positives = 104/301 (34%), Gaps = 47/301 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H                            F  +VA  L         D V I
Sbjct: 4   RILHISDLHAGPP------------------------FRPQVAQHLAAQAQRLKPDLVVI 39

Query: 71  TGDIVNFT-CNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +GD V       +   +     ++  P    +V GNHD  +     + L+    Y     
Sbjct: 40  SGDFVQRADFASQWRAAKELRAALPTPQ--LVVAGNHDVPLFNLHLRLLNPMGRYRRH-- 95

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                + L P   +   + ++G +TA         G   + Q++   ++L     +  ++
Sbjct: 96  ---ISRDLNPVCELPG-VVVVGANTAHGLT--FDGGRLSRSQSNTLRRILAGYGPE-VYK 148

Query: 190 IIMMHHPPVLDTSSLYNR-MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN-----EK 243
           +++ HHP V       +R M G     +++   G DL+L GH H+ +L+  ++      +
Sbjct: 149 VVVWHHPVVTPPGGKRDRTMQGAHAAMQLLDECGVDLLLSGHLHVFALNHTRDLDPSLRR 208

Query: 244 KLIPVVGIASASQKVHSNKP-QASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +      S S++ H ++  + S NL  +E +     +          +          
Sbjct: 209 GTLLCQCGTSTSRRGHGSEHGKNSCNLITLEDQ----QVRITHMLYDDAAAEFVPAAEHT 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|325983364|ref|YP_004295766.1| metallophosphoesterase [Nitrosomonas sp. AL212]
 gi|325532883|gb|ADZ27604.1| metallophosphoesterase [Nitrosomonas sp. AL212]
          Length = 280

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 51/267 (19%), Positives = 99/267 (37%), Gaps = 21/267 (7%)

Query: 37  LVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNP 96
           + + HF  ++    EV + L   I     + V ++GDI       +   +  ++  +G P
Sbjct: 5   ISDLHFGTER---PEVVSALEALIHSMPPELVVLSGDITQRARRSQFQAARSFVDRLGAP 61

Query: 97  HDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAI 156
               ++PGNHD  +     ++L+ + ++  S      G +L P       + +IG +T  
Sbjct: 62  A-TLVIPGNHDIPLFNLISRALNPYANHCRS-----FGAELEPVYD-SPTLLVIGVNTTR 114

Query: 157 ATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLY-NRMFGIQRFQ 215
                  +G     Q    ++ L  A+ +   RI++ H P  +       N + G +   
Sbjct: 115 --RWRHVDGEVSAYQRQRVAQRLSHASAEQL-RIVVTHQPVAVTREEDVTNLLHGHKAAV 171

Query: 216 KMIWHEGADLILHGHTHLNSLHWIKN-----EKKLIPVVGIASASQKVHSNKPQASYNLF 270
                 GAD+IL GH HL  +  +        ++L       + S ++       S NL 
Sbjct: 172 HEWSSAGADIILGGHIHLPFVVPLHKHYDNLARRLWAAQAGTAVSSRIRRGA-NNSVNLV 230

Query: 271 YIEKKNEYWTLEG-KRYTLSPDSLSIQ 296
                +        +R+  S  +    
Sbjct: 231 RSTGLSNGTRAAIVQRWDYSDTTRMFT 257


>gi|260429500|ref|ZP_05783477.1| metallophosphoesterase [Citreicella sp. SE45]
 gi|260420123|gb|EEX13376.1| metallophosphoesterase [Citreicella sp. SE45]
          Length = 282

 Score =  139 bits (351), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 56/304 (18%), Positives = 101/304 (33%), Gaps = 54/304 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD+H                      F R      E+ N L+  +     D V
Sbjct: 1   MTRIAHISDLH----------------------FGRT---DVELLNPLLAAVNGARPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD        +   +  +L  +  P     VPGNHD  +     + +  +K Y    
Sbjct: 36  AVTGDFTQRARVSQYREARAFLDRLEAP--WMAVPGNHDVSLDNLWMRFIRPYKRYREH- 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                   LFP  R    +A +G +T          G     Q     ++  ++      
Sbjct: 93  ----ICNDLFPTFRGAGIVA-VGLNT--VDRYRWQRGKVRWFQLRQACRIFGESEG---T 142

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           ++++ HHP   D     + M G  +  + +   GA ++L GH H        + K    V
Sbjct: 143 KLVLAHHPFEQDADVKKSLMRGANKAIEQLSDCGAHIVLSGHLHRWRAEPFLSRKNRSQV 202

Query: 249 VGI---ASASQKVHSNKPQASYNLFY-----------IEKKNEYWTLEGKRYTLSPDSLS 294
           + I      S ++   +    + L             I +   +     +R+    +   
Sbjct: 203 LQIHVGTGLSTRLRGQE--NDFALLDVAQDEVAVTRMIARDGAFAEAGVRRFVYGDEGWK 260

Query: 295 IQKD 298
            ++D
Sbjct: 261 ERRD 264


>gi|119896431|ref|YP_931644.1| phosphodiesterase [Azoarcus sp. BH72]
 gi|119668844|emb|CAL92757.1| probable phosphodiesterase [Azoarcus sp. BH72]
          Length = 282

 Score =  137 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 50/289 (17%), Positives = 98/289 (33%), Gaps = 45/289 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD H                                V   L++ +    +D  
Sbjct: 1   MAALLHLSDPHFGTE-------------------------RAPVVEALLHCVARQTIDVA 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGN---PHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
            I+GDI       +   +  ++  +        + ++PGNHD  +   + + L  +  + 
Sbjct: 36  VISGDITQRARRHQFDAARAFVERLRAGLNGAPVLVLPGNHDIPLYALQRRLLRPFAGFR 95

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                              +++ L   +T   +     +G    +Q    ++ L +A + 
Sbjct: 96  RVFGPQLEACHE------DDSLQLQLVNT--VSRWRHTDGVVRADQVERVARRL-EAARP 146

Query: 186 GFFRIIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI----- 239
           G  R+I+ H P  V+      + + G +R  +     GADL+L GH HL  +  +     
Sbjct: 147 GQLRVIVTHQPAAVVRPQDASDLLRGRERALRRWAAAGADLLLGGHIHLPYVQPLALPGP 206

Query: 240 KNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
               + + VV   +A      ++   S+NL  I           +R+  
Sbjct: 207 DGAPRPLWVVQAGTALSHRIRHEAGNSFNL--IRHGAGASACVVERWDY 253


>gi|312113500|ref|YP_004011096.1| metallophosphoesterase [Rhodomicrobium vannielii ATCC 17100]
 gi|311218629|gb|ADP69997.1| metallophosphoesterase [Rhodomicrobium vannielii ATCC 17100]
          Length = 265

 Score =  136 bits (342), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 41/255 (16%), Positives = 84/255 (32%), Gaps = 15/255 (5%)

Query: 38  VNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPH 97
            + HF         + + L   +     D + + GD+      RE   +  WL ++  P 
Sbjct: 7   ADLHFG---SVPIGLEDALREAMEAERPDVIVVAGDLTLRARRREFEAAKTWLAALRTPA 63

Query: 98  DISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIA 157
              ++PGNHD       ++    +  +       +    L P        A++G +TA +
Sbjct: 64  --LVLPGNHDLPYFNLLQRFADPFHRF----HQATGTPHLMPVFEGGGG-AILGFNTARS 116

Query: 158 TPP-FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNR-MFGIQRFQ 215
             P         + +  A ++    A   G F+ +  HHP +        R +       
Sbjct: 117 WQPHLRWQEGAARRRDIAAAEAEFAAMPPGLFKAVAAHHPFLRVRDEPRARPVRRAGDAL 176

Query: 216 KMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKK 275
           +     G +L++ GHTH +    ++     +  +G  +A       +    +    +E  
Sbjct: 177 RAFARCGVELLMSGHTHRSFAVEVQVGGGRLVALGAPTALSARMRGEANGFW---TVEAD 233

Query: 276 NEYWTLEGKRYTLSP 290
                        +P
Sbjct: 234 AAAIACTLWLREGAP 248


>gi|152981968|ref|YP_001353567.1| DNA repair exonuclease [Janthinobacterium sp. Marseille]
 gi|151282045|gb|ABR90455.1| DNA repair exonuclease [Janthinobacterium sp. Marseille]
          Length = 281

 Score =  136 bits (342), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 54/282 (19%), Positives = 98/282 (34%), Gaps = 19/282 (6%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           K ++ + + HF  ++    +    L      H  + + ++GDI       E   +  ++ 
Sbjct: 2   KTVLHISDPHFGTERAPVVKALERL---AHAHAPNLLILSGDITQRARAVEFKLARAFVE 58

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  P  I ++ GNHD  +     +    +  Y  S      G +L P     + + L  
Sbjct: 59  RLAIPSHI-VIAGNHDIPLFDVMTRIFLPYTRYCRS-----FGPELEPVHDSPDLLVLAV 112

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVL-DTSSLYNRMFG 210
            +T          G     Q    ++ L++A  K   RI++ H P  +       + + G
Sbjct: 113 RTTRRYRHI---EGEVSDVQIERVAQGLKQAGDKQL-RIVVTHQPVFVTHEVDEEHLLRG 168

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP----VVGIASASQKVHSNKPQAS 266
            QR        GADLIL GH H      +  E   +P     V   +A      +    S
Sbjct: 169 HQRAIGRWAEAGADLILGGHIHRPFTCALHEELADLPRRVWAVQAGTAVSSRIRHDSNNS 228

Query: 267 YNLFYIEKKNEYWTLEGKRYTLSPDSLSI-QKDYSDIFYDTL 307
            N       +       +R+  + ++     KD  D+    L
Sbjct: 229 VNFIRYGCADAPLRCIVERWDYNDEADEFLLKDSIDMHRSIL 270


>gi|87201333|ref|YP_498590.1| metallophosphoesterase [Novosphingobium aromaticivorans DSM 12444]
 gi|87137014|gb|ABD27756.1| metallophosphoesterase [Novosphingobium aromaticivorans DSM 12444]
          Length = 282

 Score =  135 bits (341), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 56/285 (19%), Positives = 96/285 (33%), Gaps = 39/285 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISDIH                              +   + +   I     D V
Sbjct: 1   MTRLFHISDIHFGLE-------------------------DRRALDWVAQCIAREKPDAV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +ITGD+     +RE   +  W+R++  P  + +  GNHD       E+ +  ++ +  S 
Sbjct: 36  AITGDLTMRARHREFAAACQWIRALDVPVTVEV--GNHDLPYFNLVERFVDPYRRF-RSI 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGC-STAIA-TPPFSANGYFGQEQAHATSKLLRKANKKG 186
                 +   P       +A++   +TA A      + G  G     A +     A  +G
Sbjct: 93  EALVEREIDLP------GVAIVPLKTTARAQWRLNWSKGVVGNAAL-AHTLCAIDALPEG 145

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
              I+  HHP V   +       G  R    +       ++ GH H             +
Sbjct: 146 TRAIVACHHPLVEAGTRGKALTRGGSRALAELARRDVIAVISGHVHDAFDLIHPTPNGPV 205

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
            ++G  + SQ+V S  P  S+N   +E       +    +  + D
Sbjct: 206 RMIGAGTLSQRVRSTPP--SFNELTLEDGRITVRVRNLEHVPTCD 248


>gi|217978481|ref|YP_002362628.1| metallophosphoesterase [Methylocella silvestris BL2]
 gi|217503857|gb|ACK51266.1| metallophosphoesterase [Methylocella silvestris BL2]
          Length = 278

 Score =  135 bits (341), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 48/262 (18%), Positives = 91/262 (34%), Gaps = 29/262 (11%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ L + HF  +     +              D   ++GD+     ++E   +  WL S
Sbjct: 9   RLVHLSDPHFGTEN---GDAVEAAAAAARALRPDLTIVSGDLTAEGRSQEFSAARDWLAS 65

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    + PGNHD  +    ++    +  Y       +    L P L +R+       
Sbjct: 66  LPQPQ--IVTPGNHDTPVWNLPQRLFWPFGRYRAYVGQPAAAGFL-PGLTVRS------L 116

Query: 153 STAIATPPFSA--NGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPV-----LDTSSLY 205
           +TA    P      G    +     +K +  A K    ++ + HHP V       +  ++
Sbjct: 117 NTARGVQPRFDWSKGSIDLDAVRQAAKEMTVATKA--LKVFVCHHPLVEMTNAAVSGGVH 174

Query: 206 NRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQA 265
             +       +++  +  DLIL GH H      +         VG  + SQ+       A
Sbjct: 175 RGL----AAARLLAEQNIDLILSGHVHNPFSLALPWGDGKTYAVGAGTLSQRTRGT--PA 228

Query: 266 SYNLFYIEKKNEYWTLEGKRYT 287
            +    IE   +   +  + +T
Sbjct: 229 CF--LTIEAGPDTIRVAVQEWT 248


>gi|108804494|ref|YP_644431.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
 gi|108765737|gb|ABG04619.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
          Length = 274

 Score =  135 bits (340), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 51/272 (18%), Positives = 94/272 (34%), Gaps = 48/272 (17%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           T     +  ISDIH                           YF  ++    I +I   + 
Sbjct: 3   TQGRLTICQISDIHCGSP-----------------------YFIPDLLERSILEINDLDP 39

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
             V ++GD+ N    +E   +  ++R       + ++PGNHD+   G         + Y 
Sbjct: 40  TAVVVSGDLTNAGYRQEYEQAAEYIRRFRC-EHLMVIPGNHDSRNVGYVHFERLFGERYS 98

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D   +                 +G  +   + P   +G  G+E      +    A +K
Sbjct: 99  VIDFEDAIM---------------VGVDS---SEPDLNDGRVGREHYGFIHESFAGAEEK 140

Query: 186 GFFRIIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
                ++ HH  P+  T    N +F      +++     DL+L GH H+     ++    
Sbjct: 141 -LKIFVVHHHLIPIPGTGRERNIVFDAGDVLELLADTEVDLVLSGHKHVPYSWRLE--NM 197

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I   G AS ++   + +P   YN+  +E + 
Sbjct: 198 FIVNAGTASTTRLRGNTRPC--YNIIEVENER 227


>gi|315497135|ref|YP_004085939.1| metallophosphoesterase [Asticcacaulis excentricus CB 48]
 gi|315415147|gb|ADU11788.1| metallophosphoesterase [Asticcacaulis excentricus CB 48]
          Length = 257

 Score =  135 bits (340), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 56/284 (19%), Positives = 104/284 (36%), Gaps = 44/284 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +AHISD+H                              + V   LI+ ++    D V  
Sbjct: 2   RIAHISDLHFGA-------------------------HDRRVTETLISTLIELEPDLVVA 36

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GDI       E   ++ + + +  P    ++PGNHD        + +  WK Y      
Sbjct: 37  SGDITQDATVAEFVEASEFFKLLPMPA--FVIPGNHDLP-GLDLRRFIQPWKRYR----- 88

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKGFF 188
               ++L P L+  + + + G ++A    P    A G     Q H  +     +     +
Sbjct: 89  DHIARELEPELQA-DLVDIKGINSARMILPSLNWAYGSISARQRHDIADFFAASTTP--W 145

Query: 189 RIIMMHHPPVLDTSSLYNR-MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           R++ +HHPP+       +  +F   +F + +  +  D++L GH H   +   +       
Sbjct: 146 RVLTVHHPPLNPPEFPLDVTLFNKGKFLETLGEQKVDIVLSGHQHHAYVET-RIMNGHTT 204

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
           +   AS +  V   K    +NL   + K    ++  +   LS D
Sbjct: 205 LFVCASTAMSVRIRKQPQGFNLLDFKDK----SVRIELRQLSGD 244


>gi|312195989|ref|YP_004016050.1| metallophosphoesterase [Frankia sp. EuI1c]
 gi|311227325|gb|ADP80180.1| metallophosphoesterase [Frankia sp. EuI1c]
          Length = 266

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 50/256 (19%), Positives = 99/256 (38%), Gaps = 19/256 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI  + + HF R    +  +A  L+ D+   +   V++ GD+     + E   +  +L  
Sbjct: 4   RIAQISDLHFGRT---AAAIAENLLADLRDLDATLVAVCGDLTQRAKDTEFQAARAFLGR 60

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    W  +                    + +  +G 
Sbjct: 61  LPAPA--LVVPGNHDLPVWPIWTRIARPWHPWRRQFGANPADVTTHS----GDGLTAVGL 114

Query: 153 STAIATPP--FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
           +TA  +      + G     Q  A  ++  + + +G  R+++ HHP +L+  +  + + G
Sbjct: 115 NTARRSSLHVDWSRGRVNDRQVAAALRVFEE-SPRGDLRVLVAHHPFLLEPRAGGHGLVG 173

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                    H+ ADL+L        L +      L+      + S ++       SYNL 
Sbjct: 174 RSDLALRQLHQRADLLL---GGHLHLAYSGVADGLVVAQSGTTLSNRLRGE--PNSYNL- 227

Query: 271 YIEKKNEYWTLEGKRY 286
            IE   +  T+E +++
Sbjct: 228 -IEADGDQLTVETRQW 242


>gi|254294395|ref|YP_003060418.1| metallophosphoesterase [Hirschia baltica ATCC 49814]
 gi|254042926|gb|ACT59721.1| metallophosphoesterase [Hirschia baltica ATCC 49814]
          Length = 258

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/245 (20%), Positives = 95/245 (38%), Gaps = 21/245 (8%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           ++ + + H   +   + E+A+    +I   N D + + GD+       E   ++ WL   
Sbjct: 4   LVHMADLHLGTEDVRAMEIASR---EIKQLNPDAIIVAGDLTQSGKKSEFILASEWLSQF 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
             P   +IVPGNHD  +     + +  +  +       S  +         ++  + G +
Sbjct: 61  LIPK--TIVPGNHDTPLINMFSRVVRPFGRFDRLFARHSNLQI--------DDTHIAGLN 110

Query: 154 TAIATPPFS--ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--PVLDTSSLYNRMF 209
           TA      S  A G    E  +    L + A++K    II  HHP  P+         + 
Sbjct: 111 TARGWQVRSNWAEGSVNSEDLNEILDLQKVADQK--LNIIACHHPFLPIPHVPMRTRTIR 168

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
           G +  +K+    G  L+L+GH H  + H  ++       V   + S +  +  P  S+N+
Sbjct: 169 GRKSSEKIAARNGRSLMLYGHVHTPAAHRFEHGDGHYYGVTCGTLSTRTRNAPP--SFNI 226

Query: 270 FYIEK 274
             I  
Sbjct: 227 INISD 231


>gi|329766400|ref|ZP_08257946.1| metallophosphoesterase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329137169|gb|EGG41459.1| metallophosphoesterase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 248

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 89/242 (36%), Gaps = 29/242 (11%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ + + H      F ++  + L++++   N + + +TGD+ N     E       L   
Sbjct: 3   IVQISDLHVG--SQFLQDKFDQLVDEVNQLNPNVIVVTGDLTNEGLMHEYERCRELLTKF 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
            +   I  + GNHD   +G        +  +   +              + +++ L+   
Sbjct: 61  KS-KKIITISGNHDYRNTGYL--LFKKFFPFEAIN-------------ELSDDVVLVTLG 104

Query: 154 TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFGI 211
           TA    P    G  G  Q     + ++K   K   +I+ MHH    + DT S    +   
Sbjct: 105 TAR---PDRNEGEVGYRQNLWLERTMKKYKDK--VKILAMHHHLIAIPDTGSDQLTVVDA 159

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFY 271
               + I   G DL+L GH H       +     + VV   +A+ +      + +YN+  
Sbjct: 160 GDVLRTILDTGVDLVLCGHKHRP----WEWNFGKLMVVNAGTATSERVRGLFENTYNIIT 215

Query: 272 IE 273
           I 
Sbjct: 216 IS 217


>gi|262375894|ref|ZP_06069125.1| phosphohydrolase [Acinetobacter lwoffii SH145]
 gi|262308988|gb|EEY90120.1| phosphohydrolase [Acinetobacter lwoffii SH145]
          Length = 258

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 52/248 (20%), Positives = 92/248 (37%), Gaps = 25/248 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            I+ L + HF  +K    E    + +    H ++ V I+GD+       + F    +L  
Sbjct: 1   MILHLSDLHFGTEK---PECLEAIRHFCQTHPLEAVVISGDLTQRARLGQFFACKKFLDQ 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    ++PGNHD  +     +  + +  Y           +L P      N  LIG 
Sbjct: 58  LNTP--YMVIPGNHDIPLYHLWNRLFNPFTRY------QIFFGELEPIFE-TENFYLIGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP---PVLDTSSLYNRMF 209
           ++      +   G+   EQ       L +A      +II+ H P   P  +     +   
Sbjct: 109 NSIR--RRYHTKGHLSLEQIQRIDLQLAQAPASKL-KIIVSHQPFYVPFQNKRGFKDSPL 165

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIK-----NEKKLIP-VVGIASASQKVHSNKP 263
             +   +     G   +LHGH H  +++ +           +  V    SAS ++H N+P
Sbjct: 166 MAKIALEAWAEHGLFAVLHGHLHQPAIYDLNQMFGLGMDHPVYDVHAGTSASNRLHKNEP 225

Query: 264 QASYNLFY 271
             S+NL  
Sbjct: 226 -NSFNLID 232


>gi|103487725|ref|YP_617286.1| metallophosphoesterase [Sphingopyxis alaskensis RB2256]
 gi|98977802|gb|ABF53953.1| metallophosphoesterase [Sphingopyxis alaskensis RB2256]
          Length = 282

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 52/285 (18%), Positives = 92/285 (32%), Gaps = 39/285 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISD+H                                  +   + +     D V
Sbjct: 1   MTRLFHISDLHFGLE-------------------------DPAALDWFTDCVRAERPDAV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD+       E   +  W+ ++  P  + +  GNHD        +  H ++  I   
Sbjct: 36  LITGDLTMRARAHEFAAACDWIETLDVPVTVEV--GNHDLPYFNPVARFFHPYRR-IRRI 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGC-STAIA-TPPFSANGYFGQEQAHATSKLLRKANKKG 186
                 +   P       +A++   +TA A      + G+   +    T   +  A   G
Sbjct: 93  ERLVEREIDLP------GLAIVSLKTTARAQWRLDWSKGWVTDKALARTLAAI-DALPPG 145

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
              ++  HHP V   +       G +R    +   G   +L GH H       +     I
Sbjct: 146 AMPLVTAHHPLVEAGTKGRALTRGGERALAALAKRGVAAVLTGHVHDAFDLVKQTAGGPI 205

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
            ++G  + SQ++ S  P  S+N   +  +     +       +PD
Sbjct: 206 RMIGAGTLSQRIRSTPP--SFNDLLVRGRALSVRVRNLADVPTPD 248


>gi|332185406|ref|ZP_08387154.1| calcineurin-like phosphoesterase family protein [Sphingomonas sp.
           S17]
 gi|332014384|gb|EGI56441.1| calcineurin-like phosphoesterase family protein [Sphingomonas sp.
           S17]
          Length = 257

 Score =  133 bits (336), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 49/271 (18%), Positives = 85/271 (31%), Gaps = 40/271 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                                        +     D V
Sbjct: 1   MIRLFHVSDVHFGAE-------------------------DPAALAWFAERVAAEKPDAV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDA-YISGAKEKSLHAWKDYITS 127
            +TGD+      RE      WL+S+G P  + +  GNHD  Y      +    ++ Y   
Sbjct: 36  IMTGDLTMRATKREFQAGGEWLQSLGVPVTVEV--GNHDIPYYWDPFRRFFAPYQRYAAV 93

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGC-STAIA-TPPFSANGYFGQEQAHATSKLLRKANKK 185
           +        L         + ++   +TA A      + G            L+ +A K 
Sbjct: 94  ERMIEKPLDL-------PGVTVVPLKTTARAQWRWNWSKGRVSSGSLRRALALIAQAPKD 146

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
               ++  HHP +   +    +          +   GA  +L GH H      I     +
Sbjct: 147 HLI-LVAAHHPLIEGGTKGTAKTRNGDEALSQLAAAGAHAVLSGHVHDPFDVPIDRNGWI 205

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           I ++G  + S++     P  ++N   IE + 
Sbjct: 206 IRMIGAGTLSKRTRKTPP--AFNEIRIEGQG 234


>gi|327400518|ref|YP_004341357.1| metallophosphoesterase [Archaeoglobus veneficus SNP6]
 gi|327316026|gb|AEA46642.1| metallophosphoesterase [Archaeoglobus veneficus SNP6]
          Length = 381

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 54/267 (20%), Positives = 91/267 (34%), Gaps = 54/267 (20%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISDIH                          +   ++     +  I   + D V I
Sbjct: 2   KIVHISDIHFG------------------------EELVRDKVRKAVRQINEMDPDLVII 37

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+  +  + E+  +   L ++  P  +++ PGNHDA   G        +K Y      
Sbjct: 38  TGDLTCWGTHHEMRDAYEELSNL-TPEFVAL-PGNHDARNIG-----YEYFKLYFGKTKK 90

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               +          +  LI   TA +T P    G+ G EQ       ++    KG    
Sbjct: 91  VLDFE----------DFRLI---TADSTQPDIDEGHIGIEQREWIEGNIK----KGKINA 133

Query: 191 IMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           I +HH   P+ +T    N +       +++   G   +L GH H+     +        +
Sbjct: 134 IALHHHIVPIPETGRERNVLIDAGEMVELLIRNGVSFVLAGHRHMPYSIRLMRTH----I 189

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKK 275
           +   S         P  +YN+  IE  
Sbjct: 190 IHAGSLGSFKILGMPDHNYNIIEIEDD 216


>gi|327538838|gb|EGF25484.1| metallophosphoesterase [Rhodopirellula baltica WH47]
          Length = 289

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/238 (15%), Positives = 82/238 (34%), Gaps = 24/238 (10%)

Query: 50  KEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAY 109
             V   L+      + D V ++GD+       +   +  +++ + +   I ++PGNHD  
Sbjct: 2   PNVGEALLRTAPSIDPDVVVVSGDLTQRAKPEQFQQAAEFIKQLPDVPRI-VIPGNHDVP 60

Query: 110 ISGAKEKSLHA---WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGY 166
           +    E+       ++ YI+++                 +   +G  +        +NG 
Sbjct: 61  LYRIMERLTDPHRYYRQYISNELNTVLQTP---------DALFVGLDSTAPRS-AISNGR 110

Query: 167 FGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYN-RMFGIQRFQKMIWHEGADL 225
               Q              G  +I++ HH        L++  M   +R   +    G +L
Sbjct: 111 IHPSQLDFCRDAFGSV-PDGLAKIVVAHHHFAPAPDYLHDQTMPKAKRAINLFVKLGVEL 169

Query: 226 ILHGHTHLNSL------HWIKNEKKLIPVVGIASASQKVHSNK--PQASYNLFYIEKK 275
           IL GH H   +      +        I +V   + + +    +   + S+N   + ++
Sbjct: 170 ILGGHLHRAFIGNTLDFYPGAGRAHGIVIVQCGTTTSRRGRGREKEKNSFNEIDVTEQ 227


>gi|85709833|ref|ZP_01040898.1| hypothetical protein NAP1_13148 [Erythrobacter sp. NAP1]
 gi|85688543|gb|EAQ28547.1| hypothetical protein NAP1_13148 [Erythrobacter sp. NAP1]
          Length = 248

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 53/272 (19%), Positives = 93/272 (34%), Gaps = 37/272 (13%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           +   L H+SD+H                             ++E    +   I     D 
Sbjct: 1   MTTRLFHVSDVHFGVE-------------------------NREALEHVAKAIRDERPDA 35

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +  TGD+     + E   +  W   +G P  + + PGNHD       E+    ++ +   
Sbjct: 36  LVCTGDVTQRAKHSEYAAAAEWFAGLGVP--VVLEPGNHDMPYYNLLERFSDPYRRFRRL 93

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGC-STAIATPPFSAN-GYFGQEQAHATSKLLRKANKK 185
           D+   +  +        +++ L+   ST  A P F  + G   +     T   LRK +  
Sbjct: 94  DSEVGSRFE-------NDDVVLVSLKSTVRAQPRFPWSDGIVTKRSLERTLAELRKLSGD 146

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
               I+  HHP +       N   G  R    +   GAD I+ GH H       +     
Sbjct: 147 PRHVIVTAHHPLLGPKEDAGNPTIGGDRAFAALASAGADAIMTGHVHRPFDETREMAGAS 206

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNE 277
           + ++G  + S ++    P  SY +    +  E
Sbjct: 207 MRMIGAGTLSTRLRHGAPP-SYRVLNCRRGEE 237


>gi|329847417|ref|ZP_08262445.1| calcineurin-like phosphoesterase family protein [Asticcacaulis
           biprosthecum C19]
 gi|328842480|gb|EGF92049.1| calcineurin-like phosphoesterase family protein [Asticcacaulis
           biprosthecum C19]
          Length = 257

 Score =  133 bits (334), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 54/269 (20%), Positives = 89/269 (33%), Gaps = 40/269 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +AHISD+H                                V+ +LI        D V +
Sbjct: 2   KIAHISDLHFGSLSRP-------------------------VSEVLIRHFQADKPDLVVV 36

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GDI       E   +  +   +  P  +  +PGNHD       E+    W  Y      
Sbjct: 37  SGDITQDATCSEFEEARAFFDLL--PMPVFCIPGNHDLP-GMDMERFYDPWGRY-----K 88

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTA--IATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               + L P L+  + + L G +TA  +      ANG   Q Q     +    A     +
Sbjct: 89  RFIAEDLEPELK-TDLVHLKGINTARRVLAHWNWANGSVSQRQCRDIQRSYADATAP--W 145

Query: 189 RIIMMHHPPVLDTSSLYNR-MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           R+ +MHHP +          +F   R  K +     D++L GH H   +   +       
Sbjct: 146 RVFVMHHPVMNAREMPLQVSLFNRNRLLKCLDDVRVDIVLAGHQHHAYVEN-RLTGGHTT 204

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKN 276
           +   AS +  +   +    +N+     K 
Sbjct: 205 IFVNASTTTSLRIRRQPNGFNMLNFTDKA 233


>gi|161528886|ref|YP_001582712.1| metallophosphoesterase [Nitrosopumilus maritimus SCM1]
 gi|160340187|gb|ABX13274.1| metallophosphoesterase [Nitrosopumilus maritimus SCM1]
          Length = 252

 Score =  132 bits (333), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 52/246 (21%), Positives = 91/246 (36%), Gaps = 35/246 (14%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ + + H      F +E  ++L++++   N D + ITGD+ N    +E       L   
Sbjct: 3   IVQISDLHIG--SQFLEEKFDVLVSEVNELNPDVIVITGDLTNEGLMKEYEKCKSLLEKF 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYL---RIRNNIALI 150
                I  + GNHD   +G                      KK FP+     + N++ L+
Sbjct: 61  NT-KKIIAISGNHDYRNTGYL------------------LFKKFFPFQTVNELDNDVVLV 101

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRM 208
              TA    P    G  G  Q     + ++K   K   +I+ MHH    + DT S    +
Sbjct: 102 TVGTAR---PDRNEGEVGYRQNLWLERTMKKYKDK--IKIVAMHHHLIAIPDTGSDQLTV 156

Query: 209 FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYN 268
                  + +     D++L GH H             + VV   +A+ +      + +YN
Sbjct: 157 VDAGDVLRTVLDSEVDVVLCGHKHRPWAW----NFGTLTVVNAGTATSERVRGLFENTYN 212

Query: 269 LFYIEK 274
           +  I+ 
Sbjct: 213 ILTIKD 218


>gi|254500762|ref|ZP_05112913.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
 gi|222436833|gb|EEE43512.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
          Length = 278

 Score =  132 bits (333), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 55/236 (23%), Positives = 87/236 (36%), Gaps = 33/236 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++AHI+D+HL            R  GL  +  +     ++     L  + L    D V
Sbjct: 1   MALIAHITDLHL------------RPRGLACYRVSDTNMLAERAILAL--NGLTPRPDAV 46

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ + +  RE   +   L  +  P  + ++PGNHD      +E S     D     
Sbjct: 47  VLTGDLTDKSDPREYALARQILSRLAMP--VFMIPGNHDGSADMRREMSGFPGMDGDVDG 104

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
             C T +          ++ LI   T I   P   NG  G  Q +  S  L   N+    
Sbjct: 105 KLCYTAEI--------GDVRLIALDTNIPGKP---NGELGTPQLNWLSDRLSDDNRPTL- 152

Query: 189 RIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIW-HEGADLILHGHTHLNSLHWIKN 241
             I +HHPP L      +   +       ++I  H+    +L GH H   +     
Sbjct: 153 --IALHHPPALSGIQHMDAIGLNDANALAEVIGPHKHIQRLLCGHLHRPIIAEFAG 206


>gi|153004962|ref|YP_001379287.1| metallophosphoesterase [Anaeromyxobacter sp. Fw109-5]
 gi|152028535|gb|ABS26303.1| metallophosphoesterase [Anaeromyxobacter sp. Fw109-5]
          Length = 223

 Score =  130 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 40/214 (18%), Positives = 77/214 (35%), Gaps = 14/214 (6%)

Query: 74  IVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE--KSLHAWKDYITSDTTC 131
           +      RE       LR       +++VPGNHD +   + E  + L A           
Sbjct: 1   MTFSAEPREFERVADLLRPFAEARKLTVVPGNHDLWTEESVETARFLRALGP---DGLGM 57

Query: 132 STGKKLFP-YLRIRNNIALIGCSTAI-ATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +P  + +     L+   +A     P++  G  G +Q  A  +++R+  K G   
Sbjct: 58  KKAAPSYPHVVPLGEEAVLVALDSARWGEDPWTTPGRLGSDQLRAAREIVREHAKLGRAV 117

Query: 190 IIMMHH----PPVL---DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
           ++ +HH    PP     D       +    +  +++       +LHGH H      +   
Sbjct: 118 VLALHHHLVLPPERVPSDAHVARMPLADADQVVRLVAELPVAAVLHGHRHTAFRVDLPGA 177

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
               PV+   SAS+       +A   ++ +++  
Sbjct: 178 AGATPVLCAGSASRVADEPVRRARAYVYELDRTG 211


>gi|115379952|ref|ZP_01467007.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|115363032|gb|EAU62212.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
          Length = 266

 Score =  130 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/182 (18%), Positives = 74/182 (40%), Gaps = 5/182 (2%)

Query: 41  HFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS-IGNPHDI 99
              R    +      +  +   H  DH+ ++GDI  +    E   +   L     +    
Sbjct: 8   RRARAYRHAPATLARIAQEAHAHAADHLILSGDITAYALESEFQGAREALGEWAQDRRRC 67

Query: 100 SIVPGNHDAYISG--AKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRN-NIALIGCSTA- 155
           +++PGNHD +  G     +    +   + SD      +  FP++R+     A++G  +A 
Sbjct: 68  TVIPGNHDVFTPGGHRSRRFERYFGHLLESDLPEHCREGAFPFVRLVGEGAAVVGLLSAR 127

Query: 156 IATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQ 215
           +   P  A+G+ G  Q    + +++    +G   ++++HH P+       +   G++  +
Sbjct: 128 VPFMPGIAHGWVGPAQLEGLAAVVKDPRLEGRALLVVVHHAPLTPRGRTDHVFHGLRDAE 187

Query: 216 KM 217
            +
Sbjct: 188 AL 189


>gi|84489354|ref|YP_447586.1| phosphohydrolase [Methanosphaera stadtmanae DSM 3091]
 gi|84372673|gb|ABC56943.1| predicted phosphohydrolase [Methanosphaera stadtmanae DSM 3091]
          Length = 243

 Score =  130 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/267 (20%), Positives = 88/267 (32%), Gaps = 49/267 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD+H                G           F +++    I++I       V
Sbjct: 1   MTKIVHISDLH---------------TGYA--------QFREDLLLQTIDEINKIQPSAV 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+ +    RE   +  ++  I       IVPGNHDA                I   
Sbjct: 38  VISGDLTDQGFYREFIEAKEYIDLIQP--KTLIVPGNHDARN--------------IGDT 81

Query: 129 TTCSTGKKLFPYLRIRNN-IALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  K +  L ++   I +IG  +   + P   +G  G+ Q       +  A +KG 
Sbjct: 82  VFEELFGKRYSVLELKEEAIKIIGLDS---SEPDLGHGKIGRLQKKFMEDEIADAKEKGL 138

Query: 188 F--RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           F   ++  H   + +T    N +         I     +L+L GH H+     + N    
Sbjct: 139 FIIIVLHHHIISIPNTGRERNILSDAGDILLTILENNVNLVLSGHKHVPHAWKMNNTL-- 196

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYI 272
                  + S          SYN+  I
Sbjct: 197 --FATAGTVSSMKLRGNTCPSYNVIDI 221


>gi|255594763|ref|XP_002536159.1| conserved hypothetical protein [Ricinus communis]
 gi|223520651|gb|EEF26224.1| conserved hypothetical protein [Ricinus communis]
          Length = 224

 Score =  130 bits (327), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 51/234 (21%), Positives = 94/234 (40%), Gaps = 15/234 (6%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ + + HF  ++     V   L+        D + ITGDI       +   +  ++ ++
Sbjct: 4   ILHISDLHFGTER---PPVVRALLQLARELKPDLLLITGDITQRARRAQFREAAAFVEAL 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
             P  + +  GNHD  +     ++LH +++Y       + G  L P     +++ ++G +
Sbjct: 61  AAPAQVIVS-GNHDVPLYNLFARALHPFRNYRR-----AFGANLEP-DFASDDLLVLGVN 113

Query: 154 TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVL-DTSSLYNRMFGIQ 212
           +          G    EQ    S  LR A      RI+ MHHP +       +N +    
Sbjct: 114 STRPQ--RHTRGSVSVEQIERVSARLRAAAPDQL-RIVAMHHPVLAISDGDRHNLLHNRA 170

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKN-EKKLIPVVGIASASQKVHSNKPQA 265
              +     GADLI+ GH HL  +  + +  + L  V    + S +V  + P +
Sbjct: 171 AALRAWALAGADLIIGGHIHLPYVRPLPDLPRSLWTVQAGTATSWRVRGDAPNS 224


>gi|144897590|emb|CAM74454.1| phosphohydrolases [Magnetospirillum gryphiswaldense MSR-1]
          Length = 256

 Score =  130 bits (326), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 50/252 (19%), Positives = 89/252 (35%), Gaps = 25/252 (9%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I  L + HF R       V + L++DI  H      I+GD+     + +   +  +L  +
Sbjct: 4   IAHLSDLHFGRT---DPMVVDALVHDIAHHRPHLAIISGDLTQRAKSHQFLEARKFLERL 60

Query: 94  GNPHDISIVPGNHD-AYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           G P  + +VPGNHD A +     + L+    +       +            + I +IG 
Sbjct: 61  GIP--VLVVPGNHDLAPVYRPLNRLLNPRAKFEKYLPASAHANG-----WNDDEIIVIGL 113

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPP-VLDTSSLYNRMFGI 211
            +         +G             L+ +      +I+ +HHPP    +   ++ +   
Sbjct: 114 DSTRHLRW--QSGKLRDHHLDHVEDSLQDSGDH-HCKIVFLHHPPSTAQSGHPFHTLT-- 168

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFY 271
                     G DLIL GH H   +  I +      V+  AS +      +    Y L  
Sbjct: 169 --------ELGVDLILAGHVHKAHVDLIDSPDHGACVLVQASTACSTRLREDANGYALIR 220

Query: 272 IEKKNEYWTLEG 283
           I+  +    + G
Sbjct: 221 IDGPSLEVDIRG 232


>gi|83311602|ref|YP_421866.1| phosphohydrolase [Magnetospirillum magneticum AMB-1]
 gi|82946443|dbj|BAE51307.1| Predicted phosphohydrolase [Magnetospirillum magneticum AMB-1]
          Length = 265

 Score =  130 bits (326), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 44/253 (17%), Positives = 87/253 (34%), Gaps = 23/253 (9%)

Query: 32  KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           K +  L + HF R       V   L++D+     D V ++GD+     + +   +  +L 
Sbjct: 2   KTVAHLSDLHFGRT---DGRVVAALLHDLQHQRPDLVIVSGDLTQRARSHQFAEARTFLS 58

Query: 92  SIGNPHDISIVPGNHDA-YISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALI 150
               P    +VPGNHD   +    ++       +         G + FP     +++  I
Sbjct: 59  --HCPAPTLVVPGNHDLEPLYRPWKRMFRPRAKFHKHLP----GHEPFPAW-ADDSLVAI 111

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
           G  +  +      +G             L  A+ +   +++ +HHPP   +         
Sbjct: 112 GLDSTRSLRW--KSGALKGAHLDHLEATLDGASPE-ATKLVFLHHPPSTTSG-------- 160

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                +++   G D +L GH H   +  I        V+  A+ +      +    Y L 
Sbjct: 161 -GHPYEVLVEHGIDAVLTGHVHHAHVELINGVHGHSLVLVQATTACSTRLREDANGYCLL 219

Query: 271 YIEKKNEYWTLEG 283
             +  +    + G
Sbjct: 220 RFDAGHMEVAIRG 232


>gi|73670623|ref|YP_306638.1| 3',5'-cyclic-nucleotide phosphodiesterase [Methanosarcina barkeri
           str. Fusaro]
 gi|72397785|gb|AAZ72058.1| 3',5'-cyclic-nucleotide phosphodiesterase [Methanosarcina barkeri
           str. Fusaro]
          Length = 222

 Score =  129 bits (324), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 46/245 (18%), Positives = 89/245 (36%), Gaps = 29/245 (11%)

Query: 56  LINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE 115
           +++ I     + V ITGD+     + E      ++  I    +  +VPGNHD+  +G   
Sbjct: 1   MVDGINQLEPNLVVITGDLTENGFSAEYDGVKRFIDRIEC-KNKILVPGNHDSKNAGYV- 58

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHAT 175
                ++D  T             + R   N+ ++G  +   + P    G+ G+E     
Sbjct: 59  ----HFEDLFTDRY----------FSRNFENVTVVGADS---SQPDLDEGHLGRENYGWI 101

Query: 176 SKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLN 234
            +     + + F    M HH  P+         +       +++     +L+L GH H+ 
Sbjct: 102 KEAF---SGENFKVFAMHHHLVPIPLAGRENTVLVDAGDVLELLNRCKVNLVLCGHCHIP 158

Query: 235 SLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN--EYWTLEGKRYTLSPDS 292
            +  + N    + VV   +        K +  YNL   +K+N    W +   R     D 
Sbjct: 159 WVWNLNN----MLVVNAGTFCSSKTRGKTKQCYNLIQADKENPAGDWKVRVSRVFSKGDR 214

Query: 293 LSIQK 297
             + +
Sbjct: 215 ELVTE 219


>gi|159897715|ref|YP_001543962.1| metallophosphoesterase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159890754|gb|ABX03834.1| metallophosphoesterase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 288

 Score =  129 bits (324), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 49/300 (16%), Positives = 96/300 (32%), Gaps = 46/300 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + H+SD+H                            F+ E A  ++            +
Sbjct: 4   TILHLSDLHAGPP------------------------FNPEKAQQILEAAWQIKPTLTVL 39

Query: 71  TGDIVNFT-CNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +GD V       +  T   ++  +  P     V GNHD  +  A  + L     Y     
Sbjct: 40  SGDFVQRADIRSQWLTIRDFVAQL--PQPTIAVMGNHDVPLYNALYRMLRPNYYY----- 92

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                  L P     ++   +G +T  +       G    +Q     + L +       +
Sbjct: 93  KKYISPILEPVW-GNDDFVAVGVNTTRSFT--VDGGKLTDQQLLELERSLARY-PDSLCK 148

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL----NSLHWIKNEKKL 245
           I++MHH PV+      + +       +       +L+L GHTH     N+L +  + ++ 
Sbjct: 149 IVVMHHHPVMPPGETRDVIQNAAAALRTFDRSNVELVLCGHTHASYIGNTLEFDPDLRQG 208

Query: 246 IPVVGIASASQKVHSN--KPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +V   +A+ +      + + ++N+  IE           +Y    D+          F
Sbjct: 209 TVIVQAGTATSRRGRRWYRGKNAFNVLEIEHMRSV----ITQYLYLEDAGRFLPVSQHQF 264


>gi|46202506|ref|ZP_00053113.2| COG1409: Predicted phosphohydrolases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 262

 Score =  128 bits (323), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 43/249 (17%), Positives = 84/249 (33%), Gaps = 23/249 (9%)

Query: 36  GLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGN 95
            L + HF R      +V + L+ D+     D V ++GD+     + +   +  +L     
Sbjct: 3   HLSDLHFGRT---DSKVVDALLRDLQHQRPDLVIVSGDLTQRARSHQFAEARSFLSHCPA 59

Query: 96  PHDISIVPGNHDA-YISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCST 154
           P    +VPGNHD   +     +       +         G + FP   +  ++  +G  +
Sbjct: 60  PA--LVVPGNHDLEPLYRPLRRIFRPRAKFHMHLP----GHEPFPAW-VDESLVAVGLDS 112

Query: 155 AIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRF 214
             +      +G             L  A  +   R++ +HHPP   +             
Sbjct: 113 TRSLRW--KSGALKGAHLDHLETTLDGAPPE-ATRLVFLHHPPSTTSG---------GHP 160

Query: 215 QKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEK 274
            +++   G D +L GH H   +  I        V+  A+ +      +    Y L   + 
Sbjct: 161 YEVLLDHGIDAVLTGHVHHARVELINGANGHSLVLVQATTACSTRLREDANGYCLLSFDA 220

Query: 275 KNEYWTLEG 283
            +    + G
Sbjct: 221 DHMEVAIRG 229


>gi|307610670|emb|CBX00258.1| hypothetical protein LPW_20031 [Legionella pneumophila 130b]
          Length = 269

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 39/262 (14%), Positives = 76/262 (29%), Gaps = 40/262 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H                               +V N  + +  L   D + I
Sbjct: 2   KIIHISDLHFG-------------------------MHQPKVLNAFLQETALDKPDIILI 36

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+     + +      ++  +  P     VPGNHD        + +  ++ Y      
Sbjct: 37  SGDLTQRGLSYQYREICSFINQL--PAQTLTVPGNHDIPFYNVPARFIFPFRQYKRYINP 94

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             T           + + ++G ++         NG    E  +   +  +         +
Sbjct: 95  DIT------TTFENDCVRILGVNSVNPLQ--LKNGKLSHETLNRIERYFK--PDDEKLNL 144

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           +  HH        L+  +   Q     +      L+  GH H   L  I         + 
Sbjct: 145 LFFHHN-FDYMEGLHKPLANAQTLLSFLKQSTIHLVCTGHLHYAHLSLIAKNNGYS-CLA 202

Query: 251 IASASQKVHSNKPQ-ASYNLFY 271
           + + S     +K    SY +  
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIE 224


>gi|326386012|ref|ZP_08207636.1| metallophosphoesterase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209237|gb|EGD60030.1| metallophosphoesterase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 253

 Score =  126 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 52/257 (20%), Positives = 85/257 (33%), Gaps = 37/257 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISD+H                              +     L+  +     + V
Sbjct: 1   MIRLFHISDLHFGLE-------------------------DRRALEWLVGLVRAERPEGV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD       RE   +  W+  +G P  +++ PGNHD       E+ +  ++ +  + 
Sbjct: 36  VITGDFTMRARPREFAAAAQWIGELGVP--VTLDPGNHDLPYFNPVERFVDPYRRF-RAL 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGC-STAIA-TPPFSANGYFGQEQAHATSKLLRKANKKG 186
                 K   P       +AL+   +TA A      + G  G      T   L    K  
Sbjct: 93  EAGLGAKLDLP------GLALVRLPTTARAQWRLNWSKGCVGAAALARTLATLDALPKDT 146

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
              I+  HHP V   +       G +R    +       +L GH H       +     I
Sbjct: 147 PA-IVTCHHPLVEAGTRGQALTRGGERALAELARRQVLAVLSGHVHDAFDLVRETAHGPI 205

Query: 247 PVVGIASASQKVHSNKP 263
            ++G  + SQ++ +  P
Sbjct: 206 RMIGAGTLSQRLRTTPP 222


>gi|148359515|ref|YP_001250722.1| 3',5'-cyclic nucleotide phosphodiesterase [Legionella pneumophila
           str. Corby]
 gi|148281288|gb|ABQ55376.1| 3',5'-cyclic nucleotide phosphodiesterase [Legionella pneumophila
           str. Corby]
          Length = 270

 Score =  126 bits (316), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 76/262 (29%), Gaps = 40/262 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H                                V N  + +  L   D + I
Sbjct: 2   KIIHISDLHFG-------------------------KHQPAVLNAFLQETALDKPDIILI 36

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+     + +      ++  +  P     VPGNHD        + +  ++ Y      
Sbjct: 37  SGDLTQRGLSYQYRELCSFINQL--PAQTLTVPGNHDIPFYNVPARFIFPFRHYKRYINP 94

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             T           + + ++G ++         +G   +E  +   +  +         +
Sbjct: 95  DVT------TTFENDCVRILGVNSVNPLQ--LKDGELSRETLNRIKRYFK--PDDEKLNL 144

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           +  HH        L+  +   Q     +      L+  GH H   L  I         + 
Sbjct: 145 LFFHHN-FDYMEGLHKPLANAQTLLSFLKQSTIHLVCTGHLHYAHLSLIAKNNGYS-CLA 202

Query: 251 IASASQKVHSNKPQ-ASYNLFY 271
           + + S     +K    SY +  
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIE 224


>gi|54294842|ref|YP_127257.1| hypothetical protein lpl1921 [Legionella pneumophila str. Lens]
 gi|53754674|emb|CAH16161.1| hypothetical protein lpl1921 [Legionella pneumophila str. Lens]
          Length = 269

 Score =  125 bits (315), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 39/262 (14%), Positives = 76/262 (29%), Gaps = 40/262 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H                               +V N  + +  L   D + I
Sbjct: 2   KIIHISDLHFG-------------------------MHQPKVLNAFLQETALDKPDIILI 36

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+     + +      ++  +  P     VPGNHD        + +  ++ Y      
Sbjct: 37  SGDLTQRGLSYQYRELCSFINQL--PAQTLTVPGNHDIPFYNVPARFIFPFRQYKRYINP 94

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             T           + + ++G ++         NG    E  +   +  +         +
Sbjct: 95  DIT------TTFENDCVRILGVNSVNPLQ--LKNGKLSHETLNRIKRYFKL--DDEKLNL 144

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           +  HH        L+  +   Q     +      L+  GH H   L  I         + 
Sbjct: 145 LFFHHN-FDYMEGLHKPLANAQTLLSFLKQSTVHLVCTGHLHYAHLSLIAKNNGYS-CLA 202

Query: 251 IASASQKVHSNKPQ-ASYNLFY 271
           + + S     +K    SY +  
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIE 224


>gi|296107559|ref|YP_003619260.1| 3',5'-cyclic-nucleotide phosphodiesterase [Legionella pneumophila
           2300/99 Alcoy]
 gi|295649461|gb|ADG25308.1| 3',5'-cyclic-nucleotide phosphodiesterase [Legionella pneumophila
           2300/99 Alcoy]
          Length = 270

 Score =  125 bits (314), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 76/262 (29%), Gaps = 40/262 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H                                V N  + +  L   D + I
Sbjct: 2   KIIHISDLHFG-------------------------KHQPAVLNAFLQETALDKPDIILI 36

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+     + +      ++  +  P     VPGNHD        + +  ++ Y     +
Sbjct: 37  SGDLTQRGLSYQYRELCSFINQL--PAQTLTVPGNHDIPFYNVPARFIFPFRHYKRYINS 94

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             T           + + ++G ++         +G    E  +   +  +         +
Sbjct: 95  DVT------TTFENDCVRILGVNSVNPLQ--LKDGKLSHETLNRIERYFK--PDDEKLNL 144

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           +  HH        L+  +   Q     +      L+  GH H   L  I         + 
Sbjct: 145 LFFHHN-FDYMEGLHKPLANAQTLLSFLKQSTIHLVCTGHLHYAHLSLIAKNNGYS-CLA 202

Query: 251 IASASQKVHSNKPQ-ASYNLFY 271
           + + S     +K    SY +  
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIE 224


>gi|54297879|ref|YP_124248.1| hypothetical protein lpp1934 [Legionella pneumophila str. Paris]
 gi|53751664|emb|CAH13086.1| hypothetical protein lpp1934 [Legionella pneumophila str. Paris]
          Length = 270

 Score =  124 bits (313), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 77/262 (29%), Gaps = 40/262 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H                                V N  + +  L   D + I
Sbjct: 2   KIIHISDLHFG-------------------------KHQPAVLNAFLQETALDKPDIILI 36

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+     + +      ++  +  P     VPGNHD        + +  ++ Y     +
Sbjct: 37  SGDLTQRGLSYQYRELCSFINQL--PAQTLTVPGNHDIPFYNVPARFIFPFRHYKRYINS 94

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             T           + + ++G ++         +G   +E  +   +  +         +
Sbjct: 95  DVT------TTFENDCVRILGVNSVNPLQ--LKDGELSRETLNRIKRYFK--PDDEKLNL 144

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           +  HH        L+  +   Q     +      L+  GH H   L  I         + 
Sbjct: 145 LFFHHN-FDYMEGLHKPLANAQTLLSFLKQSTIHLVCTGHLHYAHLSLIAKNNGYS-CLA 202

Query: 251 IASASQKVHSNKPQ-ASYNLFY 271
           + + S     +K    SY +  
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIE 224


>gi|167042721|gb|ABZ07441.1| putative calcineurin-like phosphoesterase [uncultured marine
           crenarchaeote HF4000_ANIW133O4]
          Length = 247

 Score =  124 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/252 (20%), Positives = 89/252 (35%), Gaps = 29/252 (11%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ L + H      F +E    +I++I     D V ITGD+ N     +       +  I
Sbjct: 3   IVQLSDIHVG--SQFREETFQKVIDEINSLKPDVVVITGDLTNEGLIEQYEKCKKLISQI 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
            +     ++ GNHD   +G        +K Y         G          ++  L+   
Sbjct: 61  -DVEKKIVISGNHDYRNTGYL-----LFKKYFPIRAENKLG----------DDTILVTIG 104

Query: 154 TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMFGIQ 212
           +A    P    G  G  Q     + L+K + K    + M HH   + DT S    +    
Sbjct: 105 SAR---PDRDEGEVGHHQNLWLERTLKKYDDK-LKIVAMHHHLISIPDTGSDRLTVIDAG 160

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYI 272
              + I      L+L GH H   +         + +    +AS +      + SYN+  +
Sbjct: 161 DVLRTILDSNVSLVLCGHKHRPWIWDFNT----LSIANAGTASSERVRGFFENSYNIVNV 216

Query: 273 EKKNEYWTLEGK 284
             +N  + ++ K
Sbjct: 217 --QNGTFRVDLK 226


>gi|114799578|ref|YP_761031.1| Ser/Thr protein phosphatase family protein [Hyphomonas neptunium
           ATCC 15444]
 gi|114739752|gb|ABI77877.1| Ser/Thr protein phosphatase family protein [Hyphomonas neptunium
           ATCC 15444]
          Length = 267

 Score =  124 bits (312), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 86/256 (33%), Gaps = 21/256 (8%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           +I    + HF R+    K+        +   +VD + ++GD+       E   +  WL  
Sbjct: 2   KIAHFADLHFGRE---DKDALQAASELVQELDVDAIVVSGDLTQRGKREEFEAAQLWLAQ 58

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
              P  +  VPGNHD  +     ++  A+  Y       +    +       +  ++ G 
Sbjct: 59  FKAP--LICVPGNHDTPLLNLAARASDAFGRYDNYFAAHAGPLDI-------DGASIRGL 109

Query: 153 STAIATPPFS--ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDT-SSLYNRMF 209
           +TA         A G    +   +        +      II  HHP V  T + L     
Sbjct: 110 NTARGWQTRMNWAEGRVNLDDLDSAIG----HSGDHRLHIIACHHPFVSPTLAGLQTETK 165

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
             Q   + I      +++ GH H      I+        +   + S ++ +  P  ++N+
Sbjct: 166 RGQEASRRIADSAVQILMTGHVHTPHAEVIRESDGGYIAITAGTLSTRLRAQPP--AFNI 223

Query: 270 FYIEKKNEYWTLEGKR 285
             +        ++  R
Sbjct: 224 LSVRDGIAALNVQSFR 239


>gi|52842169|ref|YP_095968.1| 3',5'-cyclic nucleotide phosphodiesterase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|52629280|gb|AAU28021.1| 3',5'-cyclic nucleotide phosphodiesterase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 269

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/262 (14%), Positives = 76/262 (29%), Gaps = 40/262 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H                               +V N  + +  L   D + I
Sbjct: 2   KIIHISDLHFG-------------------------MHQPKVLNAFLQETALDKPDIILI 36

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+     + +      ++  +  P     VPGNHD        + +  ++ Y      
Sbjct: 37  SGDLTQRGLSYQYRELCSFINQL--PAQTLSVPGNHDIPFYNVPARFIFPFRQYKRYINP 94

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             T           + + ++G ++         +G    E  +   +  +         +
Sbjct: 95  DVT------TTFENDCVRILGVNSVNPLQ--LKDGKLSHETLNRIKRYFK--PDDEKLNL 144

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           +  HH        L+  +   Q     +      L+  GH H   L  I         + 
Sbjct: 145 LFFHHN-FDYMEGLHKPLANAQTLLSFLKQSTIHLVCTGHLHYAHLSLIAKNNGYS-CLA 202

Query: 251 IASASQKVHSNKPQ-ASYNLFY 271
           + + S     +K    SY +  
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIE 224


>gi|304321569|ref|YP_003855212.1| hypothetical protein PB2503_10089 [Parvularcula bermudensis
           HTCC2503]
 gi|303300471|gb|ADM10070.1| hypothetical protein PB2503_10089 [Parvularcula bermudensis
           HTCC2503]
          Length = 259

 Score =  123 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 50/260 (19%), Positives = 88/260 (33%), Gaps = 25/260 (9%)

Query: 38  VNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPH 97
            + HF  +    K     + + +    VD V + GD+       E   ++ WL  +G P 
Sbjct: 2   ADLHFGAEN---KSALEAVKDILPSLGVDAVIVAGDMTQKGRREEFDAASTWLSDLGPP- 57

Query: 98  DISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIA 157
            +  VPGNHD  +    ++    +K Y        +   L          AL G +TA  
Sbjct: 58  -VLGVPGNHDTPLLNMVDRVKAPFKRYEDRLGWLPSSSSL-------KGAALFGLNTARG 109

Query: 158 TP--PFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI-QRF 214
                  A G    +Q      +       G+  ++  HHP +    +         QR 
Sbjct: 110 WQARRNWAEGSVNLDQLGGA--IEYAHAHDGWGAVLFCHHPFLSPPKAPLRIATRRGQRA 167

Query: 215 QKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP-VVGIASASQKVHSNKPQASYNLFYIE 273
            + +      L+L GH H+     I+ +       V   + S ++      AS+N+  + 
Sbjct: 168 SEQLSKSPYTLLLAGHVHVPRAQ-IEGDGHHTYLSVTCGTLSTRLRDG--PASFNVVDLS 224

Query: 274 KKNEYWTLEGKRYTLSPDSL 293
                  +E   +    DS 
Sbjct: 225 PD----AVEITAHRFETDSG 240


>gi|21226179|ref|NP_632101.1| hypothetical protein MM_0077 [Methanosarcina mazei Go1]
 gi|20904409|gb|AAM29773.1| hypothetical protein MM_0077 [Methanosarcina mazei Go1]
          Length = 232

 Score =  123 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 44/244 (18%), Positives = 85/244 (34%), Gaps = 41/244 (16%)

Query: 56  LINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE 115
           ++  I   N D V ITGD+     + E      ++  I   + + +VPGNHD+  +G   
Sbjct: 1   MLQSINQLNPDIVVITGDLTENGFSAEYDGVKMFIDRIECKNRV-LVPGNHDSKNAGYL- 58

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHAT 175
                ++D   +              R   N+ ++G  +   + P   +G+ G+E     
Sbjct: 59  ----HFEDLFENRFQT----------RNLGNMTIVGADS---SQPDIDDGHLGRENYGWI 101

Query: 176 SKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
            +     N    F++  +HH   P+         +        ++     +L+L GH H+
Sbjct: 102 KEAFSGEN----FKVFALHHHLVPIPLAGRENTVLVDAGDVLDLLNKCRVNLVLCGHCHI 157

Query: 234 NSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEK------------KNEYWTL 281
             +  + N    + VV   +        K    +NL   E             ++  W +
Sbjct: 158 PHVWNLNN----MLVVNAGTFCSSKTRGKTTQCFNLIQAENSEKNGNGESEKIEDGGWKV 213

Query: 282 EGKR 285
              R
Sbjct: 214 RVSR 217


>gi|182415709|ref|YP_001820775.1| metallophosphoesterase [Opitutus terrae PB90-1]
 gi|177842923|gb|ACB77175.1| metallophosphoesterase [Opitutus terrae PB90-1]
          Length = 267

 Score =  123 bits (310), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 53/279 (18%), Positives = 95/279 (34%), Gaps = 43/279 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AH+SD+H                                V + L +++       V
Sbjct: 1   MRTIAHLSDLHFGTEI-------------------------LAVVDGLAHELHTRLPSLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+       +   +  +L  +  P    IVPGNHD  +     +       Y    
Sbjct: 36  VISGDLTQRARRAQFAAARSFLARLPRPQ--LIVPGNHDVPLYDLARRFFAPLARYRH-- 91

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                  +L P L     +  IG +TA +      +G     Q       L+ A  +   
Sbjct: 92  ---YICAELNP-LHCDAEVCAIGLNTARSLTW--KSGRISAAQIARLRAHLQHAGPR--L 143

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKN----EK 243
           ++I+ HHP V     +  ++ G       ++    ADL+L GH H      I+      +
Sbjct: 144 KVIVTHHPFVPPPDDVGIKLVGRAGLAIPLFDAHQADLLLAGHLHRGYAADIRAHYQLAR 203

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           + +      +A+     ++P A YN   +E +     + 
Sbjct: 204 RSVLAAQAGTATSGRTRHEPNA-YNWIQLEAERITIEVR 241


>gi|83859340|ref|ZP_00952861.1| hypothetical protein OA2633_13085 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852787|gb|EAP90640.1| hypothetical protein OA2633_13085 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 260

 Score =  123 bits (309), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/271 (19%), Positives = 81/271 (29%), Gaps = 49/271 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  LA ISD+H                             S  +   L+  +     D V
Sbjct: 1   MTRLAQISDLHFGAE-------------------------SPGLPEALLETLNALAPDAV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             +GD   +   RE   +  +  +I  P  +   PGNHD        +    W  +    
Sbjct: 36  IASGDFTQYGRRREFDAARDFFSAINAP--VIAAPGNHDTPYLNLAARVAAPWARFEKRL 93

Query: 129 TTCSTGKKLFP------YLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
               T     P      YL  R   A +  S   A P  +A             ++ +  
Sbjct: 94  GKGVTPSWRSPTAAVESYLTARGLQAQLDWSLGRANPRHAA-------------RIAQSL 140

Query: 183 NKKGFFRIIMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
           N     +++  HHP           +  G +    +    G DL++ GH H       + 
Sbjct: 141 NDFRGLKVVAAHHPLMAPGGLKGRAKTRGGREAADIFVQAGLDLVVTGHLHQVFALPQRR 200

Query: 242 EKKLIP-VVGIASASQKVHSNKPQASYNLFY 271
                   VG  +A       +P  S+NLF 
Sbjct: 201 PDGGSCWFVGAGTALSHRTRGEPP-SFNLFD 230


>gi|326318169|ref|YP_004235841.1| metallophosphoesterase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323375005|gb|ADX47274.1| metallophosphoesterase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 256

 Score =  122 bits (307), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 53/289 (18%), Positives = 91/289 (31%), Gaps = 43/289 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M VL H+SD+H                                    +        V  V
Sbjct: 1   MSVLMHLSDLHFGA-------------------------HDPRACAAVQALARALPVSVV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+       +   +  ++ ++   H   ++PGNHD  +    E+   A++ Y    
Sbjct: 36  VVSGDLTQRATVPQFEAAHAFISALPVRH-TLVMPGNHDLPLFAWWERLGGAYRRYARW- 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G    P         ++G  T  A       G    EQ    ++ L  A   G +
Sbjct: 94  ----WGDDREPVCDA-GGFFVVGVDTTRAWRHRR--GSLSPEQIDRAAQRLA-AAPPGRW 145

Query: 189 RIIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           RI+  HHP          +R              GA+L+L GH H   L  ++    L  
Sbjct: 146 RILATHHPLVARHPGDADHRPHRAAEALARWRAAGAELLLSGHAHEPGL--VEALPGLRA 203

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
                + S ++ +  P +   L  +E   E   L   R+    ++    
Sbjct: 204 AQAGTAVSVRLRAQAPNS---LLTLETGPEGRQLT--RWDFDQETGEFV 247


>gi|160899260|ref|YP_001564842.1| metallophosphoesterase [Delftia acidovorans SPH-1]
 gi|160364844|gb|ABX36457.1| metallophosphoesterase [Delftia acidovorans SPH-1]
          Length = 271

 Score =  122 bits (307), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 51/303 (16%), Positives = 97/303 (32%), Gaps = 48/303 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M +L H+SD+H                                V            V  +
Sbjct: 1   MALLMHMSDLHFGA-------------------------HDPAVCAAAARLAARLPVALL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEK----SLHAWKDY 124
            ++GD+       +   +  +L ++  P    +VPGNHD  +    E+    +   +  +
Sbjct: 36  VVSGDLTQRATAAQFAQAREFLDALPVPRR-LVVPGNHDLPLLAWWERLGGHAHDRYARW 94

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
           I+++      ++ F          +IG  T          G     Q    ++ L +A+ 
Sbjct: 95  ISAELQPWCAEQGF---------CVIGVDTTRWW--RHQRGSLSASQIRQVAQRLAQASP 143

Query: 185 KGFFRIIMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            G +RI++ HHP          +R              GA L+L GH H   L  ++   
Sbjct: 144 -GDWRIVVSHHPLAAAHAQDRSHRPHRAATALAAWRDAGAQLMLSGHGHDPGL--VQPLP 200

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEK---KNEYWTLEGKRYTLSPDSLSIQKDYS 300
            L       + S ++ ++ P + + L   E    +      E  R+  S  +        
Sbjct: 201 GLWAAQAGTAVSLRLRAHAPNSLFTLEQQEDSAGQGRALRRELTRWDYSRQADEFLPVQK 260

Query: 301 DIF 303
            + 
Sbjct: 261 HVL 263


>gi|239503400|ref|ZP_04662710.1| phosphohydrolase [Acinetobacter baumannii AB900]
          Length = 252

 Score =  121 bits (305), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 48/257 (18%), Positives = 95/257 (36%), Gaps = 26/257 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +K   KE    + +  +    + + ++GDI       + F    +L S
Sbjct: 1   MLLHLSDLHFGTEK---KECLEAIRDFCIQQQPEVIVVSGDITQRAKYEQFFKCRQYLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y           +L P L    +  ++G 
Sbjct: 58  LNIP--YLVVPGNHDIPLYHVWNRFFSPFTRY------RYFFGELEPTLE-TEHFYIVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   G+   EQ  AT + L +   K   ++++ H P      + +  +    
Sbjct: 109 NSIR--RRYHTRGHISIEQIQATYERLDR-GPKNKIKLVVFHQPFYTPPDNKH-GIKDCP 164

Query: 213 RFQKMIWHE----GADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              K+   +    G   +LHGH H  +++ +           I  +   +A+     +  
Sbjct: 165 VLGKIALEKWSTTGLFGMLHGHLHKTAIYDLTQIYSLKIDHPIFDIHAGTATSTRLYHHN 224

Query: 264 QASYNLFYIEKK-NEYW 279
             S+N    E K   YW
Sbjct: 225 PNSFNTISNEGKIQHYW 241


>gi|85375401|ref|YP_459463.1| hypothetical protein ELI_12870 [Erythrobacter litoralis HTCC2594]
 gi|84788484|gb|ABC64666.1| hypothetical protein ELI_12870 [Erythrobacter litoralis HTCC2594]
          Length = 284

 Score =  121 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 92/242 (38%), Gaps = 21/242 (8%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I  L + HF  +     +  + +  +I     D V+ITGD+     +RE   +T W+R +
Sbjct: 6   IFHLSDIHFGLE---DNQALDWVQQEIAELRPDAVAITGDLTMRARHREFDAATKWIRGL 62

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
           G P  + +  GNHD       E+    ++ +          +   P      +IA++   
Sbjct: 63  GVPVTVEV--GNHDMPYFNPIERFFDPYRRF-RGMQDLVEKEIDLP------DIAIVPLK 113

Query: 154 TAIATPPFS--ANGYFGQEQAHATSKLLR--KANKKGFFRIIMMHHPPVLDTSSLYNRMF 209
           TA+   P    + G+  Q    A  K L    A   G   ++ +HHP     +       
Sbjct: 114 TAVRAQPRLNWSKGWVTQT---ALDKCLAAVDALPPGTQALVAVHHPLREVGTEGTALTR 170

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
              +  + +       ++ GH H       + ++  + ++G  + S++  S  P  S+N 
Sbjct: 171 NGTKALRELATRPVAAVISGHVHDAFDIVEQTDRGPVRMIGAGTLSKRTRSTPP--SFNE 228

Query: 270 FY 271
             
Sbjct: 229 LR 230


>gi|299769024|ref|YP_003731050.1| phosphohydrolase [Acinetobacter sp. DR1]
 gi|298699112|gb|ADI89677.1| phosphohydrolase [Acinetobacter sp. DR1]
          Length = 252

 Score =  121 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/257 (17%), Positives = 94/257 (36%), Gaps = 26/257 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +    +   + +      H  + + ++GDI      ++ +    +L S
Sbjct: 1   MLLHLSDLHFGTE---IEACLDAIRLFCTEHRPEVIVVSGDITQRARYQQFYNCRQFLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y           +L P L    +  ++G 
Sbjct: 58  LNIP--YLVVPGNHDIPLYHIWNRFFSPFTRY------QYFFGQLEPTLE-TEHFYIVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   G+   EQ   T + L++   +   ++++ H P        +  +    
Sbjct: 109 NSIR--RRYHTRGHISIEQIQTTYERLQQ-GPENKIKLVVFHQPFYTPPDDEH-GIKDCP 164

Query: 213 RFQKMIWHE----GADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              KM   +    G   +LHGH H  +++ +           I  +   +A+        
Sbjct: 165 VLGKMALEKWSKTGLFGMLHGHLHKTAVYDLTQIYQLGIDHPIYDIHAGTATSSRLHYHV 224

Query: 264 QASYNLFYIEKK-NEYW 279
             S+N+   E + N YW
Sbjct: 225 PNSFNVISNEGRINHYW 241


>gi|193078138|gb|ABO13082.2| putative 3'5'-cyclic-nucleotide phosphodiesterase [Acinetobacter
           baumannii ATCC 17978]
          Length = 252

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/257 (19%), Positives = 95/257 (36%), Gaps = 26/257 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +K   KE    + +  +    + + ++GDI       + F    +L S
Sbjct: 1   MLLHLSDLHFGAEK---KECLEAIRDFCIQQQPEVIVVSGDITQRAKYEQFFKCRQYLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y           +L P L    N  ++G 
Sbjct: 58  LNIP--YLVVPGNHDIPLYHVWNRFFSPFTRY------RYFFGELEPTLE-TENFYIVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   G+   EQ  AT + L +   K   ++++ H P      + +  +    
Sbjct: 109 NSIR--RRYHTRGHISIEQIQATYERLDR-GPKNKIKLVVFHQPFYTPPDNKH-GIKDCP 164

Query: 213 RFQKMIWHE----GADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              K+   +    G   +LHGH H  +++ +           I  +   +A+     +  
Sbjct: 165 VLGKIALEKWSTTGLFGMLHGHLHKTAIYDLTQIYSLKIDHPIFDIHAGTATSTRLYHHN 224

Query: 264 QASYNLFYIEKK-NEYW 279
             S+N    E K   YW
Sbjct: 225 PNSFNTISNEGKIQHYW 241


>gi|184159231|ref|YP_001847570.1| phosphohydrolase [Acinetobacter baumannii ACICU]
 gi|332876169|ref|ZP_08443950.1| Ser/Thr phosphatase family protein [Acinetobacter baumannii
           6014059]
 gi|183210825|gb|ACC58223.1| predicted phosphohydrolase [Acinetobacter baumannii ACICU]
 gi|322509145|gb|ADX04599.1| phosphohydrolase [Acinetobacter baumannii 1656-2]
 gi|332735637|gb|EGJ66683.1| Ser/Thr phosphatase family protein [Acinetobacter baumannii
           6014059]
          Length = 252

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/257 (18%), Positives = 95/257 (36%), Gaps = 26/257 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +K   KE    + +  +    + + ++GDI       + F    +L S
Sbjct: 1   MLLHLSDLHFGTEK---KECLEAIRDFCIQQQPEVIVVSGDITQRAKYEQFFKCRQYLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y           +L P L    +  ++G 
Sbjct: 58  LNIP--YLVVPGNHDIPLYHVWNRFFSPFTRY------RYFFGELEPTLE-TEHFYIVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   G+   EQ  AT + L +   K   ++++ H P      + +  +    
Sbjct: 109 NSIR--RRYHTRGHISIEQIQATYERLDR-GPKNKIKLVVFHQPFYTPPDNKH-GIKDCP 164

Query: 213 RFQKMIWHE----GADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              K+   +    G   +LHGH H  +++ +           I  +   +A+     +  
Sbjct: 165 VLGKIALEKWSTTGLFGMLHGHLHKTAIYDLTQIYSLKIDHPIFDIHAGTATSTRLYHHN 224

Query: 264 QASYNLFYIEKK-NEYW 279
             S+N    E K   YW
Sbjct: 225 PNSFNTISNEGKIQHYW 241


>gi|50085883|ref|YP_047393.1| putative 3',5'-cyclic-nucleotide phosphodiesterase [Acinetobacter
           sp. ADP1]
 gi|49531859|emb|CAG69571.1| putative 3',5'-cyclic-nucleotide phosphodiesterase [Acinetobacter
           sp. ADP1]
          Length = 258

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 41/247 (16%), Positives = 90/247 (36%), Gaps = 25/247 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +K    E    + +    H  + + ++GD+       + +    +L S
Sbjct: 1   MLLHLSDLHFGTEK---PECLTAIEDFCRQHRPEVIVVSGDLTQRARFIQFYNCKQFLES 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y           +L P L    +  ++G 
Sbjct: 58  LNVP--YLVVPGNHDIPLYHLWNRFFSPFVRY------QFFFGELEPTLE-TEHFFIVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   GY   EQ   T+++L++A       +++  H P        + +    
Sbjct: 109 NSIR--RRYHTRGYISLEQIQKTNEILKQAPSHKLKLVVL--HQPFYTPPDQPHGIKDCP 164

Query: 213 RFQKM----IWHEGADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              +M        G   +LHGH H  +++ +         + +  +   +A+        
Sbjct: 165 VLGRMALDNWSKSGLFGVLHGHLHKTAVYDLTQIYQLRVDESVYDIHAGTATSYRLYKNL 224

Query: 264 QASYNLF 270
             S+N+ 
Sbjct: 225 PNSFNVI 231


>gi|260556465|ref|ZP_05828683.1| phosphohydrolase [Acinetobacter baumannii ATCC 19606]
 gi|260409724|gb|EEX03024.1| phosphohydrolase [Acinetobacter baumannii ATCC 19606]
          Length = 252

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/257 (18%), Positives = 95/257 (36%), Gaps = 26/257 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +K   KE    + +  +    + + ++GDI       + F    +L S
Sbjct: 1   MLLHLSDLHFGTEK---KECLEAISDFCIQQQPEVIVVSGDITQRAKYEQFFKCRQYLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y           +L P L    +  ++G 
Sbjct: 58  LNIP--YLVVPGNHDIPLYHVWNRFFSPFTRY------RYFFGELEPTLE-TEHFYIVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   G+   EQ  AT + L +   K   ++++ H P      + +  +    
Sbjct: 109 NSIR--RRYHTRGHISIEQIQATYERLDR-GPKNKIKLVVFHQPFYTPPDNKH-GIKDCP 164

Query: 213 RFQKMIWHE----GADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              K+   +    G   +LHGH H  +++ +           I  +   +A+     +  
Sbjct: 165 VLGKIALEKWSTTGLFGMLHGHLHKTAIYDLTQIYSLKIDHPIFDIHAGTATSTRLYHHN 224

Query: 264 QASYNLFYIEKK-NEYW 279
             S+N    E K   YW
Sbjct: 225 PNSFNTISNEGKIQHYW 241


>gi|296282960|ref|ZP_06860958.1| hypothetical protein CbatJ_05038 [Citromicrobium bathyomarinum
           JL354]
          Length = 284

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/252 (18%), Positives = 89/252 (35%), Gaps = 17/252 (6%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           +  + + HF  +     E  +    ++     D V+ITGD+     + E   +  W+ ++
Sbjct: 6   LFHVSDIHFGLENN---EALDWFAAEVARLRPDAVAITGDLTMRARHHEFRAAEEWIGTL 62

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
             P  + +  GNHD       E+ +  +K +    T     +   P       IAL+   
Sbjct: 63  QAPATLDV--GNHDMPYFNLIERFVTPYKRFGR-LTEIVEREIDLP------GIALVPLK 113

Query: 154 TAI-ATPPFSAN-GYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI 211
           TA+ A P F+ + G+            +  A   G   ++ +HHP     +       G 
Sbjct: 114 TAVRAQPRFNWSKGWVTGRALEDCLARI-DALPAGTRALVTVHHPLREVGTQGTAMTRGG 172

Query: 212 QRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFY 271
                 +       +L GH H             + ++G  + SQ++ S  P  S+N   
Sbjct: 173 SNALAELAKRNVLGVLSGHVHDAFEIMEDTPHGPVRMIGAGTLSQRLRSTPP--SFNELR 230

Query: 272 IEKKNEYWTLEG 283
            + +     +  
Sbjct: 231 WDGETLRVHIRN 242


>gi|89901135|ref|YP_523606.1| metallophosphoesterase [Rhodoferax ferrireducens T118]
 gi|89345872|gb|ABD70075.1| metallophosphoesterase [Rhodoferax ferrireducens T118]
          Length = 272

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 54/290 (18%), Positives = 101/290 (34%), Gaps = 39/290 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M VL  ISD H                                V   L+        D +
Sbjct: 1   MSVLLQISDPHFGTE-------------------------QAAVVEALVALSQHQQPDLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  ++  +G P  +  + GNHD  +    ++  H +  Y    
Sbjct: 36  VLSGDITQRARRAQFAAARAFMDRLGAP--LLAIAGNHDIPLFDLGQRLFHPYARY---- 89

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFS-ANGYFGQEQAHATSKLLRKANKKGF 187
            + + G +L P    R+ + L G +T   T  +   NG     Q    ++ L  A  +  
Sbjct: 90  -SHAFGDELEPVYGSRDLLVL-GVNT---TRWYRHKNGEVSLAQTERVARRLGSAEPEQL 144

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
             +++     VL     +N + G    Q+     G DL++ GH HL  +  +    + + 
Sbjct: 145 RVVVVHQPVAVLRAGEDHNLLRGHAGAQQRWAAAGCDLVMGGHIHLPYVTPLAGLARPMW 204

Query: 248 VVGIASA-SQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
            V   +A S++V    P  S NL    +         +++  +  + +  
Sbjct: 205 AVQAGTAVSKRVRDGAP-NSVNLLRWGRHAPSGCCMIEQWDYAASAQAFV 253


>gi|255318904|ref|ZP_05360130.1| DNA repair exonuclease [Acinetobacter radioresistens SK82]
 gi|262378841|ref|ZP_06071998.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255304160|gb|EET83351.1| DNA repair exonuclease [Acinetobacter radioresistens SK82]
 gi|262300126|gb|EEY88038.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 257

 Score =  121 bits (303), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 44/257 (17%), Positives = 85/257 (33%), Gaps = 35/257 (13%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  ++    E    L         + + ++GD+       + +    +L S
Sbjct: 1   MLLHLSDLHFGTER---PECIKALRVFCKEQQPEALVVSGDLTQRARFTQFYYCKQFLES 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAW--KDYITSDTTCSTGKKLFPYLRIRNNIALI 150
           +  P    +VPGNHD  +     +    +    Y   +       + F          +I
Sbjct: 58  LQIP--YLVVPGNHDIPLYHLWNRVFSPFTCYQYFFGNLENVLETEHF---------YVI 106

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
           G ++      +   G+   EQ H T + L +A      +II  H P   +    +  +  
Sbjct: 107 GINS--VRRRYHTRGHVSLEQIHETREKLEQAPLHKL-KIITSHQPFYTEPDDPH-GLKD 162

Query: 211 IQRFQKMIWHE-------GADLILHGHTHLNSLHWIKN-----EKKLIPVVGIASASQKV 258
                +M           G   ILHGH H  +++ +           I  +   +A+   
Sbjct: 163 CPVLGRMALEVWGQYKLFG---ILHGHLHKTAIYDLTRLYNLKVDHPIYNIHAGTATSWR 219

Query: 259 HSNKPQASYNLFYIEKK 275
                  S+N   I  +
Sbjct: 220 LHKNLPNSFNTVSISGE 236


>gi|325123172|gb|ADY82695.1| probable DNA repair exonuclease [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 252

 Score =  120 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/257 (17%), Positives = 92/257 (35%), Gaps = 26/257 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +    +   + +      H  + + ++GDI      ++ +    +L S
Sbjct: 1   MLLHLSDLHFGTE---VEACLDAIRLFCTQHKPEVIVVSGDITQRARYQQFYKCRQFLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y           +L P L    +  ++G 
Sbjct: 58  LNIP--YVVVPGNHDIPLYHVWNRFFSPFTRY------QYFFGQLEPTLE-TEHFYIVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   G+   EQ   T + L++A       ++   H P        + +    
Sbjct: 109 NSIR--RRYHTRGHISIEQIQTTYERLQQAPADKIKLVVF--HQPFYTPPDDEHGIKDCP 164

Query: 213 RFQKMIWHE----GADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              KM   +    G   +LHGH H  +++ +           I  +   +A+        
Sbjct: 165 VLGKMALEKWSTTGLFGMLHGHLHKTAVYDLTQIYQLKIDHPIYDIHAGTATSSRLHYHV 224

Query: 264 QASYNLFYIEKK-NEYW 279
             S+N+   E K N YW
Sbjct: 225 PNSFNVISNEGKINHYW 241


>gi|293609964|ref|ZP_06692266.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828416|gb|EFF86779.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 252

 Score =  120 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/257 (17%), Positives = 92/257 (35%), Gaps = 26/257 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +    +   + +      H  + + ++GDI      ++ +    +L S
Sbjct: 1   MLLHLSDLHFGTE---IEACLDAIRLFCTQHKPEVIVVSGDITQRARYQQFYKCRQFLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y           +L P L    +  ++G 
Sbjct: 58  LNIP--YLVVPGNHDIPLYHVWNRFFSPFTRY------QYFFGQLEPTLE-TEHFYIVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   G+   EQ   T + L++A       ++   H P        + +    
Sbjct: 109 NSIR--RRYHTRGHISIEQIQTTYERLQQAPADKIKLVVF--HQPFYTPPDDEHGIKDCP 164

Query: 213 RFQKMIWHE----GADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              KM   +    G   +LHGH H  +++ +           I  +   +A+        
Sbjct: 165 VLGKMALEKWSTTGLFGMLHGHLHKTAVYDLTQIYQLKIDYPIYDIHAGTATSSRLHYHV 224

Query: 264 QASYNLFYIEKK-NEYW 279
             S+N+   E K N YW
Sbjct: 225 PNSFNVISNEGKINHYW 241


>gi|226227882|ref|YP_002761988.1| putative metallophosphoesterase [Gemmatimonas aurantiaca T-27]
 gi|226091073|dbj|BAH39518.1| putative metallophosphoesterase [Gemmatimonas aurantiaca T-27]
          Length = 276

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 39/254 (15%), Positives = 87/254 (34%), Gaps = 28/254 (11%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           R++ L + H      F     +  +        + + ++GD       RE   +   L +
Sbjct: 2   RVLHLSDIHCG--HPFVGAHVDGALALARAGGWNAIVVSGDFSQRAREREFRQARELLDA 59

Query: 93  IGNPHDISIVPGNHDAYISGA------KEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNN 146
           +     +  VPGNHD     A        +    ++ +I  D        + P LR+   
Sbjct: 60  LRTFAPVLTVPGNHDTAWWHAPFGVGDASRLHTGYRAWINED--------IEPVLRVPG- 110

Query: 147 IALIGCSTAIA---------TPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPP 197
           ++++G +++              +   G     Q    +  L ++      R++++HH  
Sbjct: 111 LSIVGLNSSWGMLSAALTWYPRDWRVKGGLTDAQLDRAAAQLAESPADDL-RLLVVHHNV 169

Query: 198 VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQK 257
           V    S    M   Q     I     D++  GH H   +  ++       +    + S++
Sbjct: 170 VRGNLSRRWGMKRPQLMLDRIAALNVDVVCTGHDHEERVEVVERRTGRFVISAANTLSRR 229

Query: 258 VHSNKPQASYNLFY 271
           +   +  ++ N+  
Sbjct: 230 MRG-RRASALNIIE 242


>gi|193213911|ref|YP_001995110.1| metallophosphoesterase [Chloroherpeton thalassium ATCC 35110]
 gi|193087388|gb|ACF12663.1| metallophosphoesterase [Chloroherpeton thalassium ATCC 35110]
          Length = 288

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 51/271 (18%), Positives = 90/271 (33%), Gaps = 64/271 (23%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +AHISDIH+ +                            E    LI +I     DH+ I
Sbjct: 2   KIAHISDIHIDHVALPN---------------------RSEQFENLIINIFEEGFDHLII 40

Query: 71  TGDIVNFTCNREIFTSTHWLRS--IGNPHDISIVPGNHDA---YISGA------------ 113
           TGD+ +     ++           + +   I+++PGNHD    Y   A            
Sbjct: 41  TGDVTDVAREEDMLLVKDIFERNGLLDWKKITLIPGNHDLFGKYEFNAERVLSNAIRASG 100

Query: 114 ------KEKSLHAWKDYITSDTTCSTGKKLFPYLRI----RNNIALIGCST----AIATP 159
                  +     ++D +T     +T +  FP+++I       +A++  ++    ++A  
Sbjct: 101 TNSLKKLQIFCEIFRDVMT---PNNTARYYFPFVKIFNGPGEGVAIVAFNSVFEFSLANN 157

Query: 160 PFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH---------PPVLDTSSLYNRMFG 210
           P  + GY   E+  A          KG F I + HH          P          +  
Sbjct: 158 PIGSRGYIRTEELRAMLDPEVLDVLKGKFVIALCHHAYKILESAIAPYEQAFVWTMELIN 217

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
              +   +    A + LHGH H    + +  
Sbjct: 218 RSEYVDTLRKIHAKVALHGHLHKTETYEVDG 248


>gi|260549235|ref|ZP_05823455.1| phosphohydrolase [Acinetobacter sp. RUH2624]
 gi|260407641|gb|EEX01114.1| phosphohydrolase [Acinetobacter sp. RUH2624]
          Length = 252

 Score =  119 bits (300), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 44/248 (17%), Positives = 87/248 (35%), Gaps = 25/248 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +K    E    + +  +    + + I+GDI       + F    +L S
Sbjct: 1   MLLHLSDLHFGTEKQ---ECLEAIRHFCIQQQPEVIVISGDITQRAKYEQFFKCRQYLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y           +L P L    +  ++G 
Sbjct: 58  LYIP--YLVVPGNHDIPLYHVWNRFFSPFTRY------RYFFGELEPTLE-TEHFYIVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   G+   EQ   T + L+K  K     ++   H P        + +    
Sbjct: 109 NSIR--RRYHTRGHISIEQIQDTYERLQKGPKDKLKLVVF--HQPFYTPPDNKHGIKDCP 164

Query: 213 RFQKMIWHE----GADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              K+   +    G   +LHGH H  +++ +           I  +   +A+     +  
Sbjct: 165 VLGKIALEKWSTTGLFGMLHGHLHKTAIYDLTQIYHLEIDHPIYDIHAGTATSTRLYHHN 224

Query: 264 QASYNLFY 271
             S+N   
Sbjct: 225 PNSFNTVS 232


>gi|194335841|ref|YP_002017635.1| metallophosphoesterase [Pelodictyon phaeoclathratiforme BU-1]
 gi|194308318|gb|ACF43018.1| metallophosphoesterase [Pelodictyon phaeoclathratiforme BU-1]
          Length = 291

 Score =  119 bits (299), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 58/305 (19%), Positives = 99/305 (32%), Gaps = 68/305 (22%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +AHISD+H+                       ++     +  + L     +   DH+ 
Sbjct: 6   IKIAHISDLHI---------------------LGKQDRRQLDDLDRLFAHFNISGFDHLV 44

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPH--DISIVPGNHDA---------YI-------- 110
           ITGD+ N +   E       L S G  H    +++ GNHD          Y         
Sbjct: 45  ITGDLSNSSNPEEWRIVKEKLESHGLYHWDKTTVIAGNHDLINLEEEMRFYNALNPLPLL 104

Query: 111 -SGAKEKSLHAWKDYITSDTTCST-GKKLFPYLRIRN----NIALIGCSTAIAT----PP 160
              A ++ + A+  +     +    G++ FP+++I N     IA +  ++         P
Sbjct: 105 RKKAFDRKMAAFCTFFQELISGEEHGERAFPFVKIINYPSVRIAFVALNSVYPWYPADNP 164

Query: 161 FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--------PVLDTSSLYNRMFGIQ 212
             A G     Q  A S     A+ K  F I + HH          +         +   +
Sbjct: 165 LGARGVISAGQLRALSAQSTLASLKECFVIGLCHHAYRVYGTDSLIDQAFDWTMELKNRE 224

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYI 272
            F  ++    A L+LHGH H    + +      I  +   S             Y+   I
Sbjct: 225 EFLALMQTMQAKLVLHGHFHRFQSYVVNG----ITFINGGSFRYTPQ------RYSELLI 274

Query: 273 EKKNE 277
             + E
Sbjct: 275 AGQGE 279


>gi|119385110|ref|YP_916166.1| metallophosphoesterase [Paracoccus denitrificans PD1222]
 gi|119374877|gb|ABL70470.1| metallophosphoesterase [Paracoccus denitrificans PD1222]
          Length = 262

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 87/233 (37%), Gaps = 18/233 (7%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
           RI+ L + HF  ++     + + L++ I     D V +TGD+ +   + +   +  +LR 
Sbjct: 3   RILHLSDLHFGLERQP---LVDPLLDRINGARADLVVVTGDLTHRGRSAQFAQAAAFLRR 59

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           I  P  +  VPGNHD  +    ++ +  ++ +       +    L P   +  N+ + G 
Sbjct: 60  IEAP--LLAVPGNHDIPLYKLADRMMRPYRRWRR-----AIAANLEPVGHV-GNLRVQGV 111

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++          G     Q       +          I+ +HHP           M G  
Sbjct: 112 NSVDPMAW--QRGIITPAQVARVIAGI----DPACINIVALHHPMQQRPQVDKALMQGAG 165

Query: 213 RFQKMIWHEGADLILHGHTHLNSLH-WIKNEKKLIPVVGIASASQKVHSNKPQ 264
                   EG  L+L GH HL S+  ++  + + I  V   +A      ++  
Sbjct: 166 PALARFEAEGVQLVLSGHLHLWSIGAFLGEQGRPILQVQAGTALCARPGDRQN 218


>gi|262278075|ref|ZP_06055860.1| phosphohydrolase [Acinetobacter calcoaceticus RUH2202]
 gi|262258426|gb|EEY77159.1| phosphohydrolase [Acinetobacter calcoaceticus RUH2202]
          Length = 252

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 46/257 (17%), Positives = 94/257 (36%), Gaps = 26/257 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +    +   + +      H  + + ++GDI      ++ +    +L S
Sbjct: 1   MLLHLSDLHFGTE---IEACLDAIRLFCTQHRPEVIVVSGDITQRARYQQFYNCRQFLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    IVPGNHD  +     +    +  Y           +L P L    +  ++G 
Sbjct: 58  LNIP--YLIVPGNHDIPLYHVWNRFFSPFTRY------QYFFGQLEPTLE-TEHFYIVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   G+   EQ  AT + L++       ++++ H P        +  +    
Sbjct: 109 NSIR--RRYHTRGHISIEQIQATYERLQQ-GPANKIKLVVFHQPFYTPPDDEH-GIKDCP 164

Query: 213 RFQKMIWHE----GADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              KM   +    G   +LHGH H  +++ +           I  +   +A+        
Sbjct: 165 VLGKMALEKWSTTGLFGMLHGHLHKTAVYDLTQIYHLEIDHPIYDIHAGTATSSRLHYHV 224

Query: 264 QASYNLFYIEKK-NEYW 279
             S+N+   E K + YW
Sbjct: 225 PNSFNVISNEGKIDHYW 241


>gi|170734930|ref|YP_001774044.1| metallophosphoesterase [Burkholderia cenocepacia MC0-3]
 gi|169820968|gb|ACA95549.1| metallophosphoesterase [Burkholderia cenocepacia MC0-3]
          Length = 266

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 49/249 (19%), Positives = 84/249 (33%), Gaps = 38/249 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M V+A +SDIH+            R  G++               + L    +    D V
Sbjct: 1   MTVIAQLSDIHV------------RPHGVLYQDAVDSNAMFSAAVDSLNR--IRPEPDLV 46

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+ +     E       L  +  P    ++PGNHD   +       HAW       
Sbjct: 47  VISGDLTDEGTEGEYRKLRELLVELRRP--FVVLPGNHDDRGNLRAAFPDHAWLP----- 99

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 +    +      + L+   T++   P   +G  G E        L +   +   
Sbjct: 100 -----DEGALSFALDVGELRLVALDTSV---PGLHHGELGAETLAWLDTELAEH--RNRT 149

Query: 189 RIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKL 245
            +I+MHHPP +      +   +   + F  ++      D IL GH H +    +      
Sbjct: 150 VVIVMHHPPFMTGIPYLDIYGLRNAEAFAAVLARHDNVDRILAGHVHRSMQTRL----GR 205

Query: 246 IPVVGIASA 254
           +PV+   S 
Sbjct: 206 VPVLTCPST 214


>gi|120612140|ref|YP_971818.1| metallophosphoesterase [Acidovorax citrulli AAC00-1]
 gi|120590604|gb|ABM34044.1| metallophosphoesterase [Acidovorax citrulli AAC00-1]
          Length = 256

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 49/292 (16%), Positives = 89/292 (30%), Gaps = 43/292 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M VL H+SD+H                                V   +        V  +
Sbjct: 1   MGVLMHLSDLHFGA-------------------------HDPCVCAAVQKLARALPVSVL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+       +   +  ++ ++   H   ++PGNHD  +    E+   A++ Y    
Sbjct: 36  VVSGDLTQRATAAQFDAAHDFIAALPARH-TLVMPGNHDLPLFAWWERIGGAYRRYARW- 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G    P         ++G  T        A+    + Q    +  L  A     +
Sbjct: 94  ----WGDDREPVCDA-GGFFVVGVDTTRPWRHRRAS--LSRGQIDRAALRLAGAPPD-RW 145

Query: 189 RIIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           RI+  HHP          +R              GA+L+L GH H   L  ++    L  
Sbjct: 146 RIVASHHPLVARHPGDADHRPHHAAEALARWRAAGAELLLSGHAHAPGL--VEALPGLRA 203

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
                + S ++ +  P +   L  +    +   L   R+    +      D 
Sbjct: 204 AQAGTAVSVRLRAEAPNS---LLTLRAGPQGRQLT--RWDFDRERGEFVPDN 250


>gi|169794983|ref|YP_001712776.1| putative 3',5'-cyclic-nucleotide phosphodiesterase [Acinetobacter
           baumannii AYE]
 gi|213158353|ref|YP_002320404.1| probable phosphodiesterase [Acinetobacter baumannii AB0057]
 gi|215482533|ref|YP_002324723.1| Calcineurin-like phosphoesterase family protein [Acinetobacter
           baumannii AB307-0294]
 gi|332855141|ref|ZP_08435724.1| Ser/Thr phosphatase family protein [Acinetobacter baumannii
           6013150]
 gi|332869608|ref|ZP_08438821.1| Ser/Thr phosphatase family protein [Acinetobacter baumannii
           6013113]
 gi|169147910|emb|CAM85773.1| putative 3',5'-cyclic-nucleotide phosphodiesterase [Acinetobacter
           baumannii AYE]
 gi|213057513|gb|ACJ42415.1| probable phosphodiesterase [Acinetobacter baumannii AB0057]
 gi|213986682|gb|ACJ56981.1| Calcineurin-like phosphoesterase family protein [Acinetobacter
           baumannii AB307-0294]
 gi|332727644|gb|EGJ59063.1| Ser/Thr phosphatase family protein [Acinetobacter baumannii
           6013150]
 gi|332732683|gb|EGJ63914.1| Ser/Thr phosphatase family protein [Acinetobacter baumannii
           6013113]
          Length = 252

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 93/257 (36%), Gaps = 26/257 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +K   KE    + +  +    + + ++GDI       + F    +L S
Sbjct: 1   MLLHLSDLHFGTEK---KECLEAIRDFCIQQQPEVIVVSGDITQRAKYEQFFKCRQYLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y        +  +   +        ++G 
Sbjct: 58  LNIP--YLVVPGNHDIPLYHVWNRFFSPFTRYRYFFGELESTLETEHFY-------IVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   G+   EQ  AT + L +   K   ++++ H P      + +  +    
Sbjct: 109 NSIR--RRYHTRGHISIEQIQATYEHLDR-GPKNKIKLVVFHQPFYTPPDNKH-GIKDCP 164

Query: 213 RFQKMIWHE----GADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              K+   +    G   +LHGH H  +++ +           I  +   +A+     +  
Sbjct: 165 VLGKIALEKWSTTGLFGMLHGHLHKTAIYDLTQIYSLKIDHPIFDIHAGTATSTRLYHHN 224

Query: 264 QASYNLFYIEKK-NEYW 279
             S+N    E K   YW
Sbjct: 225 PNSFNTISNEGKIQHYW 241


>gi|189347350|ref|YP_001943879.1| metallophosphoesterase [Chlorobium limicola DSM 245]
 gi|189341497|gb|ACD90900.1| metallophosphoesterase [Chlorobium limicola DSM 245]
          Length = 288

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 99/294 (33%), Gaps = 70/294 (23%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
              +AHISD+HL+                      R    S    + ++       +DH+
Sbjct: 5   TVTVAHISDLHLA---------------------GRHDRRSLASLDRMLRHFNERKIDHL 43

Query: 69  SITGDIVNFTCNREIFTSTHWLRS--IGNPHDISIVPGNHDA--------------YISG 112
            ITGD+ +     E       LR     +    +++PGNHD                  G
Sbjct: 44  VITGDLFDTYMPAEWPVMREKLREHDFCSWERTTLIPGNHDLITIEEEMRIYNALNPFPG 103

Query: 113 AKEKS--------LHAWKDYITSDTTCSTGKKLFPYLRI----RNNIALIGCSTAIATP- 159
           +++++           + D +  D     G   FPY+++    R ++A +G ++      
Sbjct: 104 SRKRALQERLSGFCALFGDLMGGDGEIKKG---FPYVKVMRFPRVSLAFVGVNSVWPWHR 160

Query: 160 ---PFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--------PVLDTSSLYNRM 208
              P  A G+    +  A S+       +G F I + HH         P+         +
Sbjct: 161 SDNPLGARGFIDPAEFRALSQPSVAEALRGSFVIGLCHHALRVYGTSSPIDQAFDWTMEL 220

Query: 209 FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNK 262
                +  ++     ++I+HGH H    + +        V  +   S +   ++
Sbjct: 221 INRDEYLAVMQELRTNVIVHGHFHRFQTYAMGG------VQIVNGGSFRYGPDR 268


>gi|315427294|dbj|BAJ48906.1| calcineurin superfamily phosphohydrolase [Candidatus Caldiarchaeum
           subterraneum]
 gi|315428201|dbj|BAJ49785.1| calcineurin superfamily phosphohydrolase [Candidatus Caldiarchaeum
           subterraneum]
          Length = 252

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/248 (17%), Positives = 84/248 (33%), Gaps = 27/248 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVSITGDIVNFTCNREIFTSTHWL 90
           R++ + + H +R   F  +  +  I  +         V  TGD+ ++    +   +   +
Sbjct: 3   RLVHISDTHISRFGMFLPDRLDACIRIVNSLDPAPQFVIHTGDLTDYGILMDYEMAVEKM 62

Query: 91  RSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALI 150
                  DI  VPGNHD              K+Y   D+           L     I ++
Sbjct: 63  DEFEP--DIIYVPGNHDE-------------KNY--GDSLFREMVSQVDVLNSFGKIVVL 105

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMF 209
              +AI   P S NG  G+ +     + +R         +   HH  PV       + + 
Sbjct: 106 TLGSAI---PDSDNGRLGRGRQQMIKQRMRGFGDDILKIVAFHHHLIPVPFAGREKDILE 162

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
                 ++I   G +++L GH H+ +   +        +V   + S      +   S+N+
Sbjct: 163 DAGDVLRIILESGVNMVLMGHRHVRNAIKV----GETLLVNAGTVSCVRTRGRLGNSFNI 218

Query: 270 FYIEKKNE 277
             +     
Sbjct: 219 IDLYSDGS 226


>gi|118589028|ref|ZP_01546435.1| Ser/Thr protein phosphatase family protein [Stappia aggregata IAM
           12614]
 gi|118438357|gb|EAV44991.1| Ser/Thr protein phosphatase family protein [Stappia aggregata IAM
           12614]
          Length = 272

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/229 (22%), Positives = 79/229 (34%), Gaps = 33/229 (14%)

Query: 16  SDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIV 75
           +D+HL            R  GL  +  +     ++     L +  L    D + ITGDI 
Sbjct: 2   TDLHL------------RPRGLACYRVSDTNMLAERAIRSLQS--LTPKPDALVITGDIT 47

Query: 76  NFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGK 135
           +    RE   +   L  +  P  + +VPGNHD      +E +          D  C T  
Sbjct: 48  DGNDPREYALARSILSRVDMP--VFLVPGNHDGTQVMRRELAGFPGLAGSLDDKICYTAD 105

Query: 136 KLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH 195
                     +I LI   T I   P    G  GQ Q       L++++K     +I +HH
Sbjct: 106 IA--------DIRLIALDTHIPGDP---RGRLGQAQLDWLDGQLKESSK---TTLIALHH 151

Query: 196 PPVLDTSSLYNR--MFGIQRFQKMIW-HEGADLILHGHTHLNSLHWIKN 241
           PP L      +   +       +++  H      L GH H   +     
Sbjct: 152 PPALSGIRHMDDIGLVDADALAEVVSPHRHVARFLCGHLHRPIIASFAG 200


>gi|167044836|gb|ABZ09503.1| putative calcineurin-like phosphoesterase [uncultured marine
           crenarchaeote HF4000_APKG8D22]
          Length = 212

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/228 (22%), Positives = 78/228 (34%), Gaps = 26/228 (11%)

Query: 34  IIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSI 93
           I+ L + H      F +E    +I++I     D V ITGD+ N     +       +  I
Sbjct: 3   IVQLSDIHVG--SQFREETFQKVIDEINSLKPDVVVITGDLTNEGLIEQYEKCKKLISQI 60

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCS 153
            +     +V GNHD   +G        +K Y         G          ++  L+   
Sbjct: 61  -DVEKKIVVSGNHDYRNTGYL-----LFKKYFPISAENKLG----------DDTILVTIG 104

Query: 154 TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP-PVLDTSSLYNRMFGIQ 212
           +A    P    G  G  Q     + L+K + K    + M HH   + DT S    +    
Sbjct: 105 SAR---PDRDEGEVGHHQNLWLERTLKKYDDK-LKIVAMHHHLISIPDTGSDRLTVIDAG 160

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHS 260
              + I      L+L GH H             I   G AS S++V  
Sbjct: 161 DVLRTILDSNVSLVLCGHKHRP--WIWDFNTLSIANAGTAS-SERVRG 205


>gi|194333398|ref|YP_002015258.1| metallophosphoesterase [Prosthecochloris aestuarii DSM 271]
 gi|194311216|gb|ACF45611.1| metallophosphoesterase [Prosthecochloris aestuarii DSM 271]
          Length = 290

 Score =  116 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 51/265 (19%), Positives = 86/265 (32%), Gaps = 65/265 (24%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
              +AH SD+HLS                      R+          L+  I     DH+
Sbjct: 5   TVKVAHFSDLHLS---------------------GRRDRSQIARLERLLEAIKAARYDHI 43

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIG--NPHDISIVPGNHD---------AYIS------ 111
            ITGDIV+     +       L   G  +   ++++PGNHD          Y +      
Sbjct: 44  VITGDIVDSAAPSDWKVLRDILVRQGLYSWDKVTVIPGNHDLINLEEELRVYNAINPDFA 103

Query: 112 -------GAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRN----NIALIGCSTAIAT-- 158
                      +    + + IT +   +     FP+++I       ++L+  +T      
Sbjct: 104 GRKRRLRRRLLEFCEVFSELITGNEPVTG----FPFIKILQYEDLTLSLVMVNTVYPWMH 159

Query: 159 --PPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--------PVLDTSSLYNRM 208
              P  A GY    +  A       +  +G F I + HH         P+         +
Sbjct: 160 LENPLGARGYVNPGELTALEGSDVASVLEGSFVIGVCHHAFRIYGTGFPIDQAFDWTMEL 219

Query: 209 FGIQRFQKMIWHEGADLILHGHTHL 233
              +    ++    A +ILHGH H 
Sbjct: 220 INRKELINVMRRLDARVILHGHFHR 244


>gi|20093732|ref|NP_613579.1| phosphohydrolase [Methanopyrus kandleri AV19]
 gi|19886629|gb|AAM01509.1| Predicted phosphohydrolase [Methanopyrus kandleri AV19]
          Length = 290

 Score =  116 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 53/285 (18%), Positives = 102/285 (35%), Gaps = 35/285 (12%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           +   +AH+SD+HL  S                          K V    I  +   + D 
Sbjct: 1   MDLRIAHVSDLHLDES------------------------RDKSVLEAAIERVKELHPDV 36

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAW----KD 123
           V ++GDIV     R    +    R++     +++VP NHD    G      H +      
Sbjct: 37  VVVSGDIVKGWRPRHYGETERIFRALDVGKLLAVVPDNHDEMRGGEVVFRKHPYFRRKYR 96

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
             T  +       ++P +   + + +I   +  A     ++G  G +Q     +L+R+  
Sbjct: 97  EFTVKSPSFGELLMYPIILEGDGLCVIALDSTEA---DRSDGEVGLDQLLRAEELIREIE 153

Query: 184 KKGFFRIIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
            + F  + M HH  P      +   +      ++     G DL+L GH H+  + +  ++
Sbjct: 154 PE-FIVLTMHHHVTPFPGLIDVSTVL-DAGNLREFCVANGVDLVLVGHKHIPRVDYFASK 211

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
           +    V    +   +V    P A +N+  +E+      +   R  
Sbjct: 212 EGGCAVSHAGTLCPEVARYVPPA-FNVVDVERGEVVVQVLEYREG 255


>gi|317049093|ref|YP_004116741.1| metallophosphoesterase [Pantoea sp. At-9b]
 gi|316950710|gb|ADU70185.1| metallophosphoesterase [Pantoea sp. At-9b]
          Length = 276

 Score =  116 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 46/242 (19%), Positives = 85/242 (35%), Gaps = 38/242 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-- 63
           +  M ++A ISD+H+                        KK  ++     +I  +     
Sbjct: 2   SEAMTLIAQISDLHIKAQGRLSY----------------KKVDTQAALLRVIETLNRLQP 45

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D V ITGD+V+F    E  T    L  +  P    ++PGNHD        +       
Sbjct: 46  RPDVVVITGDLVDFGLAEEYQTLRQALAELQLP--YLLMPGNHD---DRQALRDAFPEHR 100

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           Y+    T    + +         + L+   +++   P+   GY  + Q     + L++A 
Sbjct: 101 YLQQGETLHWQQHV-------KGVNLLALDSSVPQQPW---GYVDEAQLQWLDEKLKQAP 150

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIK 240
                 ++M+HHPP +      +R  +   +    +I      + +L GH H +      
Sbjct: 151 HTPA--LVMLHHPPFMTGIGHMDRQPLRNPEALAAVISQYPQVERVLSGHLHRSIQARFA 208

Query: 241 NE 242
             
Sbjct: 209 GT 210


>gi|197295117|ref|YP_002153658.1| putative calcineurin-like phosphoesterase family protein
           [Burkholderia cenocepacia J2315]
 gi|195944596|emb|CAR57200.1| putative calcineurin-like phosphoesterase family protein
           [Burkholderia cenocepacia J2315]
          Length = 266

 Score =  116 bits (291), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 50/266 (18%), Positives = 91/266 (34%), Gaps = 42/266 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M V+A +SDIH+            R  G++               + L    +    D V
Sbjct: 1   MTVIAQLSDIHV------------RPHGVLYQDAVDSNVMFSAAVDSLNR--IRPEPDLV 46

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+ +     E       L  +  P    ++PGNHD   +       HAW       
Sbjct: 47  VISGDLTDEGTEDEYRKLRELLVELRRP--FVVLPGNHDDRGNLRAAFPDHAWLP----- 99

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 +    +      + ++   T++   P   +G    E        L +   +   
Sbjct: 100 -----DEGALSFALDVGELRVVALDTSV---PGLHHGELDAETLAWLDTELAEH--RNRT 149

Query: 189 RIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKL 245
            +I+MHHPP +      +   +   + F  ++      D IL GH H +    +      
Sbjct: 150 VVIVMHHPPFMTGIPYLDIYGLRNAEAFAAVLARHSNVDRILAGHVHRSMQTRL----GR 205

Query: 246 IPVVGIASAS----QKVHSNKPQASY 267
           +PV+   S +     +V ++   AS+
Sbjct: 206 VPVLTCPSTTTQIALRVEADAQPASF 231


>gi|301513305|ref|ZP_07238542.1| Calcineurin-like phosphoesterase family protein [Acinetobacter
           baumannii AB058]
          Length = 233

 Score =  116 bits (290), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 41/248 (16%), Positives = 89/248 (35%), Gaps = 25/248 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  +K   KE    + +  +    + + ++GDI       + F    +L S
Sbjct: 1   MLLHLSDLHFGTEK---KECLEAIRDFCIQQQPEVIVVSGDITQRAKYEQFFKCRQYLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y        +  +   +        ++G 
Sbjct: 58  LNIP--YLVVPGNHDIPLYHVWNRFFSPFTRYRYFFGELESTLETEHFY-------IVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ 212
           ++      +   G+   EQ  AT + L +   K   ++++ H P      + +  +    
Sbjct: 109 NSIR--RRYHTRGHISIEQIQATYEHLDR-GPKNKIKLVVFHQPFYTPPDNKH-GIKDCP 164

Query: 213 RFQKMIWHE----GADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              K+   +    G   +LHGH H  +++ +           I  +   +A+     +  
Sbjct: 165 VLGKIALEKWSTTGLFGMLHGHLHKTAIYDLTQIYSLKIDHPIFDIHAGTATSTRLYHHN 224

Query: 264 QASYNLFY 271
             S+N   
Sbjct: 225 PNSFNTIS 232


>gi|304398354|ref|ZP_07380228.1| metallophosphoesterase [Pantoea sp. aB]
 gi|304354220|gb|EFM18593.1| metallophosphoesterase [Pantoea sp. aB]
          Length = 276

 Score =  116 bits (290), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 51/290 (17%), Positives = 95/290 (32%), Gaps = 42/290 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHV 68
           ++A ISD+H+                        K+  +      +I+ +       D V
Sbjct: 7   LIAQISDLHIKAHGRLSY----------------KQVDTHAALLQVIDTLNSLQPRPDAV 50

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD+V+F    E  T    L+ +  P    ++ GNHD        ++      Y+ S 
Sbjct: 51  VITGDLVDFGRPDEYQTLREALQRLQPP--FYLMAGNHD---DREALRAAFPDHGYLQSG 105

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
            T +    +         + LI   +++   P+   G   +EQ     + L  +  +   
Sbjct: 106 PTLNWQLSV-------GGVRLIALDSSVPQQPW---GEVDEEQLEWLDQALGMSADQP-- 153

Query: 189 RIIMMHHPPVLD--TSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
            ++M+HHPP           R+   Q F+ +I      + +L GH H +           
Sbjct: 154 TLVMLHHPPFACGIAHMDRQRLRHPQAFEAIIARHPQVERVLCGHLHRSLQTRFAGTLAC 213

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           +        S +V  +        F +E              +     +I
Sbjct: 214 V----APGVSHQVALDLHPEGPAHFILEPPGYLLHCWQPGEGMVTHQCAI 259


>gi|330874790|gb|EGH08939.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. morsprunorum str. M302280PT]
          Length = 277

 Score =  114 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 53/244 (21%), Positives = 82/244 (33%), Gaps = 40/244 (16%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD--YI 125
           V I+GD+V+F    E       L  +  P    +VPGNHD      +E  L A+ D  Y+
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHD-----DRENLLAAFADQVYL 101

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                      +  Y      + LIG  T   T P    G     Q    +  L  + + 
Sbjct: 102 PLSAGGPLDWVVEQY-----PLRLIGMDT---TIPGEHGGRLDYCQLDWLNAQL--SRRP 151

Query: 186 GFFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNE 242
               +I++HHPP +      +R         +++I      + +L GH H          
Sbjct: 152 DVPTVIVLHHPPFITGIGHMDREPFGNAAALERVIAQHPQVERLLCGHLHRPMQRRFGGS 211

Query: 243 KKLI 246
              I
Sbjct: 212 VACI 215


>gi|110597032|ref|ZP_01385321.1| Metallophosphoesterase [Chlorobium ferrooxidans DSM 13031]
 gi|110341223|gb|EAT59688.1| Metallophosphoesterase [Chlorobium ferrooxidans DSM 13031]
          Length = 288

 Score =  114 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 55/264 (20%), Positives = 95/264 (35%), Gaps = 58/264 (21%)

Query: 7   TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           T    +AH+SD+H+S                      RK +   E  + +++ +     D
Sbjct: 3   TGEVKIAHLSDLHVS---------------------GRKDHRQLEDLDRMLDHLNTAGFD 41

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGN--PHDISIVPGNHDA---------YI----- 110
           H+ I+GD+ N   + +       L   G       +++ GNHD          Y      
Sbjct: 42  HLVISGDLSNTANSGDWGVVKEKLEKHGRYHWEKTTVIAGNHDLINLEEEMRFYNALNPL 101

Query: 111 ----SGAKEKSLHAWKDYITSD-TTCSTGKKLFPYLRIRN----NIALIGCSTAIAT--- 158
                 A ++ L  +  Y     T    G  ++P+++I N     IA+   ++       
Sbjct: 102 PLLRKKAFDRKLANFCRYFRELITGEEGGTPIYPFVKIINYPSVRIAITAFNSVFPWYPA 161

Query: 159 -PPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH-PPVLDTSSLYN-------RMF 209
             P  A G   Q+Q  A S     +  +  F I + HH   V  T SL +        + 
Sbjct: 162 DNPLGARGEVDQKQLDAFSSESLLSTLRECFVIGLCHHAYKVYGTDSLIDQAFDWTMELK 221

Query: 210 GIQRFQKMIWHEGADLILHGHTHL 233
             + F  ++    A ++LHGH H 
Sbjct: 222 NREAFLDLMITLHARVVLHGHFHR 245


>gi|78189741|ref|YP_380079.1| hypothetical protein Cag_1785 [Chlorobium chlorochromatii CaD3]
 gi|78171940|gb|ABB29036.1| conserved hypothetical protein [Chlorobium chlorochromatii CaD3]
          Length = 286

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 58/258 (22%), Positives = 87/258 (33%), Gaps = 55/258 (21%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +AHISDIHLS                                  L+  +     DH+ 
Sbjct: 5   LKIAHISDIHLS---------------------GANDRSHAARLTRLLQHLRNEQFDHLV 43

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIG--NPHDISIVPGNHDA--------------YISGA 113
           ITGD+ N     E       L+     +    +I+PGNHD                I   
Sbjct: 44  ITGDLGNHADPDEWRVVQQLLKQTEWYHWERCTILPGNHDLMNLEEEMRLYNALNPIQWF 103

Query: 114 KEKSLHAWKDYITSDTTCSTGKKL--FPYLRIRN----NIALIGCSTAIA----TPPFSA 163
           ++K+    +           G K   FP+L+I N     +AL+   +  A    T P  A
Sbjct: 104 RQKAFQRKRQLFCELFYEIMGGKNQTFPFLKILNYPTLRLALVALDSVAAWHPSTNPLGA 163

Query: 164 NGYFGQEQAHATSKLLRKANKKGFFRIIMMHH-PPVLDTSSLYN-------RMFGIQRFQ 215
            G+   +Q  A  +       +    I + HH   V  T SL +        +     F 
Sbjct: 164 RGFIEPQQLTALQQPQIAEALRSCVVIGLCHHAYKVYGTDSLIDQAFDWTMELQNRDAFF 223

Query: 216 KMIWHEGADLILHGHTHL 233
            ++   GA ++LHGH H 
Sbjct: 224 SLMQQLGASIVLHGHFHR 241


>gi|213967739|ref|ZP_03395886.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato T1]
 gi|301382376|ref|ZP_07230794.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato Max13]
 gi|302062353|ref|ZP_07253894.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato K40]
 gi|302130671|ref|ZP_07256661.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|213927515|gb|EEB61063.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato T1]
          Length = 277

 Score =  113 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 53/244 (21%), Positives = 83/244 (34%), Gaps = 40/244 (16%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GMVDTL---------GALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD--YI 125
           V I+GD+V+F    E       L  +  P    +VPGNHD      +E  L A+ D  Y+
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHD-----DRENLLAAFADQVYL 101

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
               +      +  Y      + LIG  T   T P    G     Q    +  L  + + 
Sbjct: 102 PLAASGPLDWVVEQY-----PLRLIGMDT---TIPGEHGGRLDYCQLDWLNAQL--SRRP 151

Query: 186 GFFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNE 242
               +I++HHPP +      +R         +++I      + +L GH H          
Sbjct: 152 DVPTVIVLHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGS 211

Query: 243 KKLI 246
              I
Sbjct: 212 VASI 215


>gi|28867720|ref|NP_790339.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|28850955|gb|AAO54034.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|331015037|gb|EGH95093.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 277

 Score =  113 bits (284), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 53/244 (21%), Positives = 83/244 (34%), Gaps = 40/244 (16%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD--YI 125
           V I+GD+V+F    E       L  +  P    +VPGNHD      +E  L A+ D  Y+
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHD-----DRENLLAAFADQVYL 101

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
               +      +  Y      + LIG  T   T P    G     Q    +  L  + + 
Sbjct: 102 PLAASGPLDWVVEQY-----PLRLIGMDT---TIPGEHGGRLDYCQLDWLNAQL--SRRP 151

Query: 186 GFFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNE 242
               +I++HHPP +      +R         +++I      + +L GH H          
Sbjct: 152 DVPTVIVLHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGS 211

Query: 243 KKLI 246
              I
Sbjct: 212 VASI 215


>gi|330965501|gb|EGH65761.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. actinidiae str. M302091]
          Length = 277

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 53/247 (21%), Positives = 83/247 (33%), Gaps = 46/247 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL-----HN 64
           F++A ISD+HL                       R  Y   +    L   ++        
Sbjct: 5   FLIAQISDLHLKAD-------------------GRLTYGVVDTLGALRRAVVHINASKQR 45

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD- 123
            D V I+GD+V+F    E       L  +  P    +VPGNHD      +E  L A+ D 
Sbjct: 46  PDIVVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHD-----DRENLLAAFADQ 98

Query: 124 -YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
            Y+    +      +  Y      + LIG  T   T P    G     Q    +  L  +
Sbjct: 99  VYLPLSASGPLDWVVEQY-----PLRLIGMDT---TIPGEHGGRLDYCQLDWLNAQL--S 148

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWI 239
            +     +I++HHPP +      +R         +++I      + +L GH H       
Sbjct: 149 RRPDVPTVIVLHHPPFITGIGHMDREPFGNAAALERVIAQHPQVERLLCGHLHRPMQRRF 208

Query: 240 KNEKKLI 246
                 I
Sbjct: 209 GGSVACI 215


>gi|304393767|ref|ZP_07375693.1| metallophosphoesterase [Ahrensia sp. R2A130]
 gi|303294110|gb|EFL88484.1| metallophosphoesterase [Ahrensia sp. R2A130]
          Length = 269

 Score =  113 bits (282), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 51/293 (17%), Positives = 103/293 (35%), Gaps = 39/293 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV-DH 67
           M  +  ISD H+               G + +          E    +   +      D 
Sbjct: 1   MTKIIQISDPHIVPH------------GQLAYGQVDTASALAECVETINRRLPDIGPIDM 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
             +TGD+ +F    E       +  +  P+    VPGNHD     +  ++  + +D++ +
Sbjct: 49  AIVTGDLTDFGTEEEYQRFRELMSPLAIPYR--AVPGNHD---DVSLMRACFSDEDWMPA 103

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D   +       ++    N+ LIG  +++   P  A+G+   +        L  A + G 
Sbjct: 104 DGPIN-------WISDFENLTLIGLDSSV---PDMAHGHLVDDTLAFLKSAL--AARTGN 151

Query: 188 FRIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHEGADLIL-HGHTHLNSLHWIKNEKK 244
             I+ +HHPP++      +   +   ++ Q ++     +L L  GH H N +        
Sbjct: 152 PVIVALHHPPIMTGIEKMDIQNLRESRKLQSILSDHEHELRLICGHVHRNIVAHFGGAI- 210

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
                     S  V  +  + + N     K+   + L   R  +   S+ + +
Sbjct: 211 ---CQVAPGISHAVTMDLREGAANCLS--KEPGGFMLHETRNGIVSHSIPVGR 258


>gi|78187448|ref|YP_375491.1| hypothetical protein Plut_1594 [Chlorobium luteolum DSM 273]
 gi|78167350|gb|ABB24448.1| conserved hypothetical protein [Chlorobium luteolum DSM 273]
          Length = 287

 Score =  112 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 51/307 (16%), Positives = 100/307 (32%), Gaps = 74/307 (24%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISD+H++                      R      +  + ++       +DH+ 
Sbjct: 5   VKIVHISDLHIA---------------------GRGDRRQLQDLDRMLGHFSRSGIDHLV 43

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIG--NPHDISIVPGNHDA--------------YISGA 113
           I+GD+ +     +       L   G  +    +++PGNHD                + G 
Sbjct: 44  ISGDLSDRAKEADWEIVRELLLRHGWYHWARTTVIPGNHDIINLEEEMRFYNALNPLPGM 103

Query: 114 KEKSLHA--------WKDYITSDTTCSTGKKLFPYLRIRN----NIALIGCSTAIATP-- 159
           ++++  A        +++ +T D     G   FP++++       +A+   ++  A    
Sbjct: 104 RDRACTAKAARFCRFFQELVTGD---ELGDAAFPFIKVLRFPTLKLAIAAFNSVNAWSAT 160

Query: 160 --PFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--------PVLDTSSLYNRMF 209
             P  + GY    +  A S         G F + + HH          +         + 
Sbjct: 161 DNPLGSRGYIEPSELRAVSSPAVMKALDGCFILGLCHHALKVYGTDSLLDQAFDWTMELK 220

Query: 210 GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
             Q F  ++   GA ++LHGH H    + +      I  +   S             Y+L
Sbjct: 221 NRQEFLGVMREIGAQVVLHGHFHRFQSYTLGG----IRFINGGSF------RYSPNRYSL 270

Query: 270 FYIEKKN 276
             IE   
Sbjct: 271 LEIEASG 277


>gi|269128492|ref|YP_003301862.1| metallophosphoesterase [Thermomonospora curvata DSM 43183]
 gi|268313450|gb|ACY99824.1| metallophosphoesterase [Thermomonospora curvata DSM 43183]
          Length = 270

 Score =  112 bits (281), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 50/249 (20%), Positives = 86/249 (34%), Gaps = 33/249 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++A +SDIHL+              G V+      +     V++LL    L    D V
Sbjct: 1   MTIIAQLSDIHLAAG----------ADGRVDDRSGPVRALRSAVSSLL---ALPQRPDCV 47

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ +     E       L  +  P  +  +PGNHD      +     A+ D  T+ 
Sbjct: 48  VLTGDLADRGLPVEYERLRALLSPL--PMPVFPLPGNHD-----DRAALREAFAD-RTAA 99

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 +  F Y      + L+ C T +   P  ++G   +E+       L  A      
Sbjct: 100 CAAPDPQAPFQYAVQVRGVRLVCCDTTV---PGESHGELDEERLQWLDAALAAAPDVP-- 154

Query: 189 RIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
            ++  HHPP        +   +        ++      + ++ GH H  ++  I      
Sbjct: 155 TVVATHHPPFPIGVRFLDEAGLRDAAALGAVLARHPQVERVISGHVHRAAVGRI----GE 210

Query: 246 IPVVGIASA 254
           I  V   S 
Sbjct: 211 ITAVTCPST 219


>gi|332663664|ref|YP_004446452.1| metallophosphoesterase [Haliscomenobacter hydrossis DSM 1100]
 gi|332332478|gb|AEE49579.1| metallophosphoesterase [Haliscomenobacter hydrossis DSM 1100]
          Length = 628

 Score =  112 bits (280), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 53/290 (18%), Positives = 96/290 (33%), Gaps = 58/290 (20%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH-- 67
           F  AHISD H+                            + E     + DI   + D   
Sbjct: 24  FKFAHISDTHIG-----------------------SGATAAEDLERTVRDINAQD-DIAF 59

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V  +GD+  F  + E+  + + L  +  P  + IVPGNHD     + E   ++++     
Sbjct: 60  VIHSGDVTEFGSDAELRQAKNILSQLNKP--LYIVPGNHD--TKWS-ESGCNSFRAIFGG 114

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D      +  F Y         IGC++        A G   +E       ++   + +  
Sbjct: 115 D------RFAFDY----GGYRFIGCNS--GPNMRMAPGLVPREDLVWLDSIVSATSPQ-- 160

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
             II ++H P+         +    +   ++      + L GH H N           IP
Sbjct: 161 LPIIFVNHYPLDAG------LANWDQVIDILKKRNTQVALCGHGHRNKYMDAAG----IP 210

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
            V   S    + +  P   YNL  ++    Y+       +   + + + +
Sbjct: 211 NVMGRS---NLRAKDPVGGYNLVSMQFDTMYYAERRPLRSQPNEGIQVME 257


>gi|283798658|ref|ZP_06347811.1| serine/threonine protein phosphatase family protein [Clostridium
           sp. M62/1]
 gi|291073643|gb|EFE11007.1| serine/threonine protein phosphatase family protein [Clostridium
           sp. M62/1]
          Length = 566

 Score =  111 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/258 (17%), Positives = 90/258 (34%), Gaps = 25/258 (9%)

Query: 16  SDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIV 75
           SDIH   SP   +   +     V W   +   +   + +  + +      D + ++GD+ 
Sbjct: 113 SDIHY-QSPKMTDFVGEAFCQFVRWDDGKVIPYLDTITDAFLEEAAEKQPDALILSGDLT 171

Query: 76  NFTC---NREIFTSTHWLRSIGNPHDISIVPGNHDA------YISGAKEKS--------L 118
                  + E+      +   G P  + ++PGNHD       Y  GA+ K          
Sbjct: 172 QNGELVNHEELAEKLRKVEEQGVP--VLVIPGNHDINHPEASYFEGAERKKADNITADDF 229

Query: 119 HAWKDYITSDTTCSTGKKLFPYL-RIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSK 177
           ++       D      +    Y+ R  +   L+   +    P     G   +E     S 
Sbjct: 230 YSIYREFGYDEAMDRDEASLSYMYRADDRYWLMMLDSCQYDPENKVGGRIRKETLAWMSG 289

Query: 178 LLRKANKKGFFRIIMMHHPPVLDTS--SLYNRMFGIQRFQKMIWHEGADLILHGHTHLNS 235
            L KA ++    I + HH  + +++       +    +  +++   G  + + GH HL  
Sbjct: 290 WLEKAREENVLVIPIAHHNLLKESTLYPEDCTLENSSQAAELLESYGLPVYISGHLHLQR 349

Query: 236 L--HWIKNEKKLIPVVGI 251
           +  +      +  P+ GI
Sbjct: 350 IKKNINGGPSQTEPLYGI 367


>gi|308187731|ref|YP_003931862.1| Protein icc [Pantoea vagans C9-1]
 gi|308058241|gb|ADO10413.1| Protein icc [Pantoea vagans C9-1]
          Length = 276

 Score =  111 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/238 (19%), Positives = 83/238 (34%), Gaps = 34/238 (14%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +A ISD+H+           K++                +  N L         D V IT
Sbjct: 8   IAQISDLHIKAHGRLSY---KQVDTYAALL------QVIDTLNAL-----QPRPDVVVIT 53

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+V+F    E  T    L+ +  P    ++ GNHD   +       HA+          
Sbjct: 54  GDLVDFGRAEEYQTLREALQRLQLP--FYLMAGNHDDREALRAAFPDHAY---------L 102

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
             G  L   LR+  ++ L+   +++   P+   G   + Q     + L  A  +    ++
Sbjct: 103 QAGPTLNWQLRV-GDVRLLALDSSVPQQPW---GELDEPQLQWLDQALSAAADQP--TLV 156

Query: 192 MMHHPPVLD--TSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           M+HHPP           R+   +  + +I      + +L GH H +           +
Sbjct: 157 MLHHPPFACGIAHMDRQRLRHPEALEAIIARHPQVERVLCGHLHRSLQTRFAGTLACV 214


>gi|307151271|ref|YP_003886655.1| metallophosphoesterase [Cyanothece sp. PCC 7822]
 gi|306981499|gb|ADN13380.1| metallophosphoesterase [Cyanothece sp. PCC 7822]
          Length = 365

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/242 (18%), Positives = 90/242 (37%), Gaps = 22/242 (9%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           + F  A ISD H++ S +   +  +    LV          S     L++  +   ++D 
Sbjct: 2   MNFRFAVISDPHIAISETIRNVPNR--FHLV--------EVSIPALELVLTHLERLDLDF 51

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAW-KDYIT 126
           + + GD+               L ++  P  + +VPGNHD       ++S+      Y  
Sbjct: 52  LLLPGDLTQDGEPENHQWLRQRLEALPFP--VYVVPGNHDVPTLFPTDQSIGLKDFPYYY 109

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            +      ++L+ +  +   + LIG ++          GY  ++Q     K L +   K 
Sbjct: 110 PNFGYHNPQQLYYHCELLPGVQLIGLNSNQFNQEGQQIGYLDEQQLTWLEKTLAEV--KD 167

Query: 187 FFRIIMMHHPPVLD-TSSLYNR------MFGIQRFQKMIWHEGADLILHGHTHLNSLHWI 239
              ++M+HH  +       ++       +       K++   G  LI  GH H+  + + 
Sbjct: 168 QLVMVMIHHNVIEHLPGQSHHILGRRYMLSNAPALFKLLHKYGVKLIFTGHLHVQDVAYQ 227

Query: 240 KN 241
           + 
Sbjct: 228 QG 229


>gi|295090678|emb|CBK76785.1| Predicted phosphohydrolases [Clostridium cf. saccharolyticum K10]
          Length = 566

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/258 (17%), Positives = 90/258 (34%), Gaps = 25/258 (9%)

Query: 16  SDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIV 75
           SDIH   SP   +   +     V W   +   +   + +  + +      D + ++GD+ 
Sbjct: 113 SDIHY-QSPKMTDFVGEAFCQFVRWDDGKVIPYLDTITDAFLEEAAEKQPDALILSGDLT 171

Query: 76  NFTC---NREIFTSTHWLRSIGNPHDISIVPGNHDA------YISGAKEKS--------L 118
                  + E+      +   G P  + ++PGNHD       Y  GA+ K          
Sbjct: 172 QNGELVNHEELAEKLRKVEEQGVP--VLVIPGNHDINHPEASYFEGAERKKADNITADDF 229

Query: 119 HAWKDYITSDTTCSTGKKLFPYL-RIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSK 177
           ++       D      +    Y+ R  +   L+   +    P     G   +E     S 
Sbjct: 230 YSIYREFGYDEAMDRDEASLSYMYRADDRYWLMMLDSCQYDPENKIGGRIRKETLAWMSG 289

Query: 178 LLRKANKKGFFRIIMMHHPPVLDTS--SLYNRMFGIQRFQKMIWHEGADLILHGHTHLNS 235
            L KA ++    I + HH  + +++       +    +  +++   G  + + GH HL  
Sbjct: 290 WLEKAREENVLVIPIAHHNLLKESTLYPEDCTLENSSQAAELLESYGLPVYISGHLHLQR 349

Query: 236 L--HWIKNEKKLIPVVGI 251
           +  +      +  P+ GI
Sbjct: 350 IKKNINGGPSQTEPLYGI 367


>gi|218441067|ref|YP_002379396.1| metallophosphoesterase [Cyanothece sp. PCC 7424]
 gi|218173795|gb|ACK72528.1| metallophosphoesterase [Cyanothece sp. PCC 7424]
          Length = 364

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 54/274 (19%), Positives = 100/274 (36%), Gaps = 34/274 (12%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           + F  A ISD H++ S +   +  +    LV          S     L++  I   ++D 
Sbjct: 1   MNFRFAVISDPHIAISQTIRNIPNR--FHLV--------EVSIPALELVLKHIEQLDLDF 50

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKS--LHAWKDYI 125
           + + GD+               L ++  P  + +VPGNHD         S  L  + +Y 
Sbjct: 51  LLLPGDLTQDGEPENHHWLRQRLEALPFP--VYVVPGNHDVPTPFPTASSIGLKDFPNYY 108

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           +     +  +  +    +   I LIG ++ +        G   +EQ     K L +   K
Sbjct: 109 SPFGYYNPQQLYY-TCEVLPGIQLIGLNSNLFDGEGKQLGCLDEEQLIWLEKTLSEV--K 165

Query: 186 GFFRIIMMHHPPV--LDTSSLY---NR--MFGIQRFQKMIWHEGADLILHGHTHLNSLHW 238
             F I+M+HH  +  L   S +    R  +       +++   G  LI  GH H+  + +
Sbjct: 166 EQFVIVMIHHNVIEHLPGQSDHVLGRRYMLDNAPMVLQLLEKYGVKLIFTGHLHIQDIAY 225

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYI 272
            +       +  I + S   + +     Y +  I
Sbjct: 226 HQG------IYEITTGSLVSYPHP----YRIIDI 249


>gi|330898831|gb|EGH30250.1| metallophosphoesterase [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 277

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRQNLLAAFAEQEYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|322371756|ref|ZP_08046299.1| metallophosphoesterase [Haladaptatus paucihalophilus DX253]
 gi|320548641|gb|EFW90312.1| metallophosphoesterase [Haladaptatus paucihalophilus DX253]
          Length = 341

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/263 (18%), Positives = 89/263 (33%), Gaps = 37/263 (14%)

Query: 47  YFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNH 106
           + +++    +I D     VD V   GD+       +  T    L  +  PH    VPGNH
Sbjct: 68  HRTRDRFETVIADANAREVDAVVFAGDLTEDGSVADFETVRSLLSDLDAPH--VAVPGNH 125

Query: 107 DAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAI---ATPPFSA 163
           D        KS  + +    S    +     FP+      + +IG ++A     T     
Sbjct: 126 DVP------KSFDSHETPPLSSFESAFTPDGFPFHERVGGVDVIGLNSASTPDGTLSDCH 179

Query: 164 NGYFGQEQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYN-----RMFGIQRFQK 216
           +G    +Q       L K +      I++ HH  P + D +  ++      +        
Sbjct: 180 DGRISADQLAWLDDTLPKTDAP----IVVSHHNLPGLCDETDAHSWRSSFPIRNATDVAD 235

Query: 217 MIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           ++      L + GH H+ ++   +  ++L+      S            +Y LF I    
Sbjct: 236 VLSEHDVPLHVSGHLHVPAIAETRGVRELV----APSLCSFPQ------AYLLFEIGPLG 285

Query: 277 EYWTLEGKRYTLSPDSLSIQKDY 299
                   R+  + D    ++ Y
Sbjct: 286 -----TAVRFVPTADPAGTREAY 303


>gi|94969892|ref|YP_591940.1| metallophosphoesterase [Candidatus Koribacter versatilis Ellin345]
 gi|94551942|gb|ABF41866.1| metallophosphoesterase [Candidatus Koribacter versatilis Ellin345]
          Length = 235

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 63/257 (24%), Positives = 99/257 (38%), Gaps = 40/257 (15%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVSITGDIVNFTCNREIFTSTHWL 90
           RI  L + HF  + Y      + +   +       D + + GD+ NF    EI +  + L
Sbjct: 2   RIAALADIHFTPQSY------DRIREQMNRVREEADILVLAGDLTNFGKPEEIESMLNSL 55

Query: 91  RSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY---------ITSDTTCSTGKKLFPYL 141
             I  P  I  V GNHD Y SG  E+ +                  D     G K FP  
Sbjct: 56  VRIRIP--IVAVLGNHD-YESGKSEQLMKMLVQEGVKLLDGTGYERDGVGFAGTKGFPGG 112

Query: 142 RIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK-KGFFRIIMMHHPPVLD 200
             R  +      TA   P   A   F Q     + KL R  ++ +   RI+++H+ P+  
Sbjct: 113 FGRGAL------TAFGEPEVKA---FVQAAIDESLKLERALSQLRTPKRIVVIHYAPIGG 163

Query: 201 T-----SSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASAS 255
           T     + +Y  + G  R  ++I   GADL+LHGH H  +          +  V +    
Sbjct: 164 TVQGEPTEIYPYL-GSSRLMEVIDRHGADLVLHGHAHHGAADGKTTAGCPVHNVALP--- 219

Query: 256 QKVHSNKPQASYNLFYI 272
             + +  P  +Y +F +
Sbjct: 220 -ILQAMTPPRAYRIFDV 235


>gi|300309937|ref|YP_003774029.1| cAMP phosphodiesterase [Herbaspirillum seropedicae SmR1]
 gi|300072722|gb|ADJ62121.1| cAMP phosphodiesterase protein [Herbaspirillum seropedicae SmR1]
          Length = 273

 Score =  110 bits (276), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/239 (19%), Positives = 79/239 (33%), Gaps = 43/239 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL-----HNVD 66
           L  ISD+H+                       +K Y   + A  L   +          D
Sbjct: 3   LGQISDLHIKTD-------------------GKKSYRVVDTAESLRRCVAQVNGLKQRPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            + ITGD+V+F    E       L  +  P    ++PGNHD   +       HA+     
Sbjct: 44  ALVITGDLVDFGKPSEYACLRELLAPLAMP--YYLLPGNHDERNALRAAFPDHAY----- 96

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                  G +   Y+   + + +I   T I   P  + G    +      ++L +  ++ 
Sbjct: 97  ----LQQGGERIEYVIEDHPVRIIALDTVI---PRQSGGALSPQSLQWLDEVLAQQAQRP 149

Query: 187 FFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNE 242
              +I MHHPP        +   +   Q  + ++      + IL GH H +        
Sbjct: 150 --TVIAMHHPPFTTGIGHMDDMGLADPQALEAVVRKHPQVERILCGHLHRSIQRRFGGT 206


>gi|237802410|ref|ZP_04590871.1| metallophosphoesterase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331025267|gb|EGI05323.1| metallophosphoesterase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 277

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 78/242 (32%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +  +  S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDNRENLLAAFADQVYLPFSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  ++          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEQY--------PVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTLIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|330954919|gb|EGH55179.1| metallophosphoesterase [Pseudomonas syringae Cit 7]
          Length = 277

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRHNLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDRESFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|319795890|ref|YP_004157530.1| metallophosphoesterase [Variovorax paradoxus EPS]
 gi|315598353|gb|ADU39419.1| metallophosphoesterase [Variovorax paradoxus EPS]
          Length = 264

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/259 (18%), Positives = 91/259 (35%), Gaps = 37/259 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           ++A ISD H+  +   ++       G+V+          +E    L    L    D V +
Sbjct: 2   LIAQISDPHVRPAGQLYQ-------GVVD-----SNRMFEEAIAHL--HALDRRPDLVLL 47

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+V+   + E   +   L  +  P    ++PGNHD      +E    A+      D  
Sbjct: 48  TGDLVDEGRSEEYAEARRLLAKLSIP--YLVIPGNHD-----HRENFRTAFA-----DHA 95

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                    Y    + + ++   + I   P   +G+   E      + L    +K    +
Sbjct: 96  YLPATGALHYCIDTHPVRIVALDSCI---PGLHHGHVDAEGLAWLQRTLEADREKP--TL 150

Query: 191 IMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           +M+HHPP        +  R       + ++   G  + +L GH H   L         + 
Sbjct: 151 LMLHHPPFTSGIPYMDSYRYIDTAPLEAIVRSVGNIERVLCGHVHRTMLKRWAGT---VV 207

Query: 248 VVGIASASQKVHSNKPQAS 266
               +S ++      P A+
Sbjct: 208 CSCPSSTTEIALQLAPDAA 226


>gi|330985853|gb|EGH83956.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. lachrymans str. M301315]
          Length = 277

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------SALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHNLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGRLDYGQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|66047915|ref|YP_237756.1| metallophosphoesterase [Pseudomonas syringae pv. syringae B728a]
 gi|63258622|gb|AAY39718.1| Metallophosphoesterase [Pseudomonas syringae pv. syringae B728a]
 gi|330970896|gb|EGH70962.1| metallophosphoesterase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 277

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRHNLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|29827788|ref|NP_822422.1| cyclic nucleotide phosphodiesterase [Streptomyces avermitilis
           MA-4680]
 gi|15824262|dbj|BAB69418.1| putative cyclic nucleotide phosphodiesterase [Streptomyces
           avermitilis]
 gi|29604889|dbj|BAC68957.1| putative cyclic nucleotide phosphodiesterase [Streptomyces
           avermitilis MA-4680]
          Length = 257

 Score =  110 bits (275), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 53/232 (22%), Positives = 84/232 (36%), Gaps = 38/232 (16%)

Query: 13  AHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITG 72
           AH+SD HL+              GL+    +R   FS+ +  +L  D        V +TG
Sbjct: 2   AHLSDPHLT-------------TGLLA--VDRVAAFSRALRCVLALD---PRPACVVVTG 43

Query: 73  DIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCS 132
           D+V+     E       +     P  + +VPGNHD          L A+          +
Sbjct: 44  DLVDRGEAEEYEVLREVIARFPLP--VHLVPGNHDDP-----GTLLEAF-----GGGPHT 91

Query: 133 TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIM 192
            G + FPY     N  ++  S+ +   P   +G  G EQ     +LL +  +   F  + 
Sbjct: 92  GGARAFPYAVEYPNATVVVLSSTVPGAP---SGRLGDEQLDRLEELLSRRPEVPAF--VC 146

Query: 193 MHHPPVLDTSSLYN--RMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
           +HHPPV       +   +     F ++I        +L GH H         
Sbjct: 147 LHHPPVDIGIPYLDGMNLADADAFGEVIGRHPQVVRVLAGHVHRAVTGEFAG 198


>gi|330891283|gb|EGH23944.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. mori str. 301020]
          Length = 277

 Score =  109 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHNLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGRLDYGQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|320326426|gb|EFW82479.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. glycinea str. B076]
 gi|320331602|gb|EFW87540.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330872327|gb|EGH06476.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 277

 Score =  109 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/242 (20%), Positives = 76/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD         +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHDLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGRLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|307824049|ref|ZP_07654276.1| metallophosphoesterase [Methylobacter tundripaludum SV96]
 gi|307734833|gb|EFO05683.1| metallophosphoesterase [Methylobacter tundripaludum SV96]
          Length = 543

 Score =  109 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 68/336 (20%), Positives = 120/336 (35%), Gaps = 62/336 (18%)

Query: 5   YTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
            + ++  + H+SDIH                G             + V + L+  +L   
Sbjct: 4   DSNVIATVVHLSDIHFG------------FTG------------PEPVWDELVRFVLDIK 39

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISG--------AKEK 116
              + ITGDIVN   N+    +   L+  G+   + I PGNHD +  G           +
Sbjct: 40  PAAILITGDIVNTPGNKLFNLAQSELKKFGDV-PVLICPGNHDRHWLGNALGSLQLPFTR 98

Query: 117 SLHAW-KDYITSDTTCSTGKKLFPYLRIRNNIALIGCS---TAIATPPFSANGYFGQEQA 172
             + + KD+                 RI   +  I  S   +  A     A+      QA
Sbjct: 99  DFYYFLKDWFRGAPHYEVLDLGA---RIVARVTAIDSSDKCSYFARSFVDADTLKNLAQA 155

Query: 173 HATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFG-----------IQRFQKMIW 219
               K   K   K   RI+M HH   PV+   + Y+++ G                K + 
Sbjct: 156 VDNKKQDDKEKGKLNIRIVMTHHHLLPVVSLEAKYDQLIGPFQTATTLTVNAGTVLKTLS 215

Query: 220 HEGADLILHGHTH---LNSLHWIKNEKKLIPVVGIASASQKVHSNKP---QASYNLFYIE 273
               DL+LHGH H   +     I+N    + ++G  S++  +        +AS+N+  + 
Sbjct: 216 EGHVDLVLHGHEHEKNIAKYTTIENRLGNVTIIGAGSSTGTITGKGWYFSKASFNVIEVC 275

Query: 274 KKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLVL 309
           + +  W    + Y  S  + S   +   + ++ + L
Sbjct: 276 EDDSIW---LRTYFGSGKTFSSSTENRHLLFEAVDL 308


>gi|302185787|ref|ZP_07262460.1| metallophosphoesterase [Pseudomonas syringae pv. syringae 642]
          Length = 277

 Score =  109 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQIP--FYLVPGNHDDRHNLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|71734668|ref|YP_276826.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|71555221|gb|AAZ34432.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. phaseolicola 1448A]
          Length = 277

 Score =  109 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 49/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHNLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGRLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|289674360|ref|ZP_06495250.1| metallophosphoesterase [Pseudomonas syringae pv. syringae FF5]
          Length = 277

 Score =  109 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRHNLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|153825070|ref|ZP_01977737.1| Ser/Thr protein phosphatase family protein [Vibrio cholerae MZO-2]
 gi|149741395|gb|EDM55429.1| Ser/Thr protein phosphatase family protein [Vibrio cholerae MZO-2]
          Length = 423

 Score =  109 bits (273), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 49/308 (15%), Positives = 105/308 (34%), Gaps = 59/308 (19%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN------ 64
            +  ISD+H+  +    E +    +G            +  V N  ++++          
Sbjct: 15  KIIIISDLHVGDAAVSNEFA----VGSS----------TNAVKNRFLDELRQLAKHEKIC 60

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNP-----HDISIVPGNHDAYISGAKEKSLH 119
            D++ + GDI N     E   ++  L+ I         ++  VPGNHD      +E S+ 
Sbjct: 61  ADYIVVAGDITNRATKEEFELASRRLKEIATIVGVEQSNVFFVPGNHDG-NWSEEEISMT 119

Query: 120 A----------------WKDYITSDTTCSTGKKLF--PYLRI--RNNIALIGCSTAIATP 159
           A                + D+       +     +  PY  I     + +IG +++    
Sbjct: 120 AQENINITIERKYNNLRFNDFFKECLERAHWGCYYKEPYFAIWSDEKLNVIGVNSSAFDH 179

Query: 160 PFSA--NGYFGQEQAHATSKLLRKANKKGFFRI---IMMHH----PPVLDTSSLYNRMFG 210
                 +G   ++        L++       +I   ++ HH    P +    + ++ +  
Sbjct: 180 YDKKPHHGVIRKQDLKVLDAKLQELQIANSDKINLMVVHHHPIQQPDLPFDRADHSILQN 239

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNE-KKLIPVVGIASASQKVHSN---KPQAS 266
                ++      + I+HGH H+  L    +E    I ++   S S ++          +
Sbjct: 240 AAILMEIASKHNVNFIVHGHKHIPRLAQYSDEYLHPINILCAGSFSARLDDRWFQGVPNT 299

Query: 267 YNLFYIEK 274
            +   I+K
Sbjct: 300 IHQIEIDK 307


>gi|330979913|gb|EGH78213.1| metallophosphoesterase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 277

 Score =  109 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRHNLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|330938554|gb|EGH42133.1| metallophosphoesterase [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 277

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 50/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------SALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREGEYAVLKPELERLQMP--FYLVPGNHDDRHNLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPYITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|257483054|ref|ZP_05637095.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|331011712|gb|EGH91768.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 277

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 49/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHNLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGRLDYGQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|312958297|ref|ZP_07772818.1| hypothetical protein PFWH6_0194 [Pseudomonas fluorescens WH6]
 gi|311287361|gb|EFQ65921.1| hypothetical protein PFWH6_0194 [Pseudomonas fluorescens WH6]
          Length = 416

 Score =  109 bits (272), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 52/310 (16%), Positives = 99/310 (31%), Gaps = 49/310 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDH 67
             +A ISD+H+       + SP+            +    +       + +       D+
Sbjct: 6   LKVAVISDLHIGDMAKGKDFSPE----------KTENASVENYLQEFSDFVVRERLAADY 55

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNP-----HDISIVPGNHDAYISG---------- 112
           + +TGDI N     E   ++  +  I          +   PGNHD               
Sbjct: 56  LLVTGDISNKAKESEFSLASDLITKIAQILGVDRKRVLFCPGNHDMNWPAITSQQDAGAS 115

Query: 113 ----AKEKSLHAWKDYITSDTTCSTGKKLF---PY--LRIRNNIALIGCSTAIATPPFSA 163
                K K  +  K  +    T + G   F   PY  +   ++  +   ++AI   P + 
Sbjct: 116 VEVILKAKYWNLLKPGLIFSETQAQGVGRFDDAPYFVVWNYDDFNVFSLNSAIYDGPDTK 175

Query: 164 N--GYFGQEQAHATSKLLRKANKKGFFRI-IMMHHPPVLDTSSLYN----RMFGIQRFQK 216
              G    EQ      LL     K    + I+ HHP      +        M        
Sbjct: 176 PHCGEIKSEQLLDLEVLLDSHVDKSKLNVFILHHHPKQYHDRTFREGDTSGMINADGLMH 235

Query: 217 MIWHEGADLILHGHTHLNSLHW-IKNEKKLIPVVGIASASQKVHSNK---PQASYNLFYI 272
           ++  +  D I+HGH H+      I ++   + ++   S S ++           +++   
Sbjct: 236 LLSKKEIDFIVHGHKHIPRFDMEINSDGHPLWILCSGSFSSRLDDRHFGGVGNFFHIIDF 295

Query: 273 EK--KNEYWT 280
               ++  W+
Sbjct: 296 HSRCQDNGWS 305


>gi|289624786|ref|ZP_06457740.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|330871183|gb|EGH05892.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. aesculi str. 0893_23]
          Length = 277

 Score =  108 bits (271), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 49/242 (20%), Positives = 77/242 (31%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------GALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +     S
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHNLLAAFAEQVYLPLSAS 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +K          + LIG  T   T P    G     Q       L  + +   
Sbjct: 107 GPLDWVVEKY--------PVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|330956970|gb|EGH57230.1| metallophosphoesterase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 277

 Score =  108 bits (271), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 51/242 (21%), Positives = 82/242 (33%), Gaps = 36/242 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL               G+V+                 +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLTY-------GVVDTL---------AALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD      +E  L A+ D +  
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHD-----DREHLLAAFADQVY- 100

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 101 --LPLSASAPLDWVVEKYPVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LI 246
            I
Sbjct: 214 SI 215


>gi|262371999|ref|ZP_06065278.1| phosphohydrolase [Acinetobacter junii SH205]
 gi|262312024|gb|EEY93109.1| phosphohydrolase [Acinetobacter junii SH205]
          Length = 256

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 43/248 (17%), Positives = 87/248 (35%), Gaps = 26/248 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            ++ L + HF  ++         + +   LH  + V ++GD+      ++ F    +L S
Sbjct: 1   MLLHLSDLHFGTEREVC---IQAIRDFCELHRPEAVIVSGDLTQRARLKQFFDCRQFLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y        T  +        +N  ++G 
Sbjct: 58  LDLP--YLVVPGNHDIPLFHVWNRFFSPFVRYQAFFGRLETTLET-------SNFYIVGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP----PVLDTSSLYNRM 208
           ++      +   G+   EQ H  ++ LR A      ++++ H P    P          +
Sbjct: 109 NSIR--RRYHTRGHVSLEQIHEVAEKLRNA-PNNKTKLVVFHQPFYTFPHDHGDKDCPVL 165

Query: 209 FGIQRFQKMIWHEGADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
              +   +     G   +LHGH H  ++H +           I  +   +A         
Sbjct: 166 --AKIALEQWGKTGLWGLLHGHLHKVAIHDLNQVFNLGFDHSIYDIHAGTAISNRLRFGL 223

Query: 264 QASYNLFY 271
             S+N+  
Sbjct: 224 SNSFNIIS 231


>gi|167045137|gb|ABZ09799.1| putative calcineurin-like phosphoesterase [uncultured marine
           microorganism HF4000_APKG8K5]
          Length = 245

 Score =  108 bits (269), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/198 (19%), Positives = 66/198 (33%), Gaps = 21/198 (10%)

Query: 60  ILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
            L    D V  TGD+       E       L  +     + ++PGNHD    GA  ++  
Sbjct: 11  ALDPQPDIVVATGDLTYLGSPEEYAYLRELLAPLE--CSVFLIPGNHDG--RGALREAFA 66

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRN-NIALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
               +       S G + F    + +  + LI   T +   P    G+  + Q     + 
Sbjct: 67  DQGYF----PEPSGGDRDFLNYTVEDYPLRLIALDTVVPGKP---GGWLDETQIAWLDEC 119

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNS 235
           L ++  +    +I+MHHPP +   +  + M          ++      + I+ GH H   
Sbjct: 120 LGESPSRP--TMILMHHPPYVSGIAHMDAMMCGNSDALGAVVARHPQVERIICGHLHRPV 177

Query: 236 LHWIKNEKKLIPVVGIAS 253
                       V    S
Sbjct: 178 HLRWHG----TVVCTAPS 191


>gi|255262657|ref|ZP_05341999.1| metallophosphoesterase [Thalassiobium sp. R2A62]
 gi|255104992|gb|EET47666.1| metallophosphoesterase [Thalassiobium sp. R2A62]
          Length = 269

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/295 (16%), Positives = 97/295 (32%), Gaps = 47/295 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--- 65
           M  +  ISD H+               G V+           E     +  I        
Sbjct: 1   MTRIIQISDPHIVPHGQLAY-------GQVDT---------AEALTNCVETINASLPQIG 44

Query: 66  --DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D V + GD+ +F    E       +  +  P+    VPGNHD     A  ++  + + 
Sbjct: 45  PIDMVIVAGDLTDFGTEEEYQRFRKLMEPLNLPYR--AVPGNHD---DVAVMRTSFSDQP 99

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           ++  +   +       ++   +++ +IG  +++      A+G+         S  L    
Sbjct: 100 WMPVEGPIN-------WIEDFDDLVVIGLDSSV---EGKAHGHLSDATLSFLSTSLD--V 147

Query: 184 KKGFFRIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHEGADLIL-HGHTHLNSLHWIK 240
           + G   I+ +HHPPVL      +   +    + Q ++     +L L  GH H N +    
Sbjct: 148 QDGKPTIVTIHHPPVLTGIEKMDIQNLRESTQLQAILSGYKGELRLTCGHIHRNIVAPFG 207

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
                +        S  V  +    + N     K+   + L   R  +    + +
Sbjct: 208 G----VICQISPGVSHAVTMDLRTGAPNCLT--KEPGGFLLHEMRDGIMSHHIPV 256


>gi|282865934|ref|ZP_06274983.1| metallophosphoesterase [Streptomyces sp. ACTE]
 gi|282559258|gb|EFB64811.1| metallophosphoesterase [Streptomyces sp. ACTE]
          Length = 262

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 58/278 (20%), Positives = 93/278 (33%), Gaps = 42/278 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M VLAH+SD HL                        ++  ++    +     L   VD V
Sbjct: 1   MTVLAHLSDPHLD---------------------GTEESAARAHRAVAHLAGLPGRVDAV 39

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGDIV+     E   +   L  +   H++ + PGNHD+     +E  L        S 
Sbjct: 40  LITGDIVDRGTAEEYHQAREVLAPLYERHEVLLCPGNHDSRAP-YREVLLGGGGGGSGSG 98

Query: 129 TTCSTGKKLFPY--LRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                G    P   +R    + ++ C +++   P    G             L  A  + 
Sbjct: 99  GGDDGGGGTAPVNEVRDVGGVRVLMCDSSVPGRP---EGLLEAATLSWLDDALAAAPDRP 155

Query: 187 FFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKN-- 241
            F  + +HHPPV       +R  +       K++        +L GH H  +        
Sbjct: 156 AF--VALHHPPVPLGLPYIDRIGLREPDALAKVLARHAQVVAVLCGHAHTAAATSFAGLP 213

Query: 242 --------EKKLIPVVGIASASQKVHSNKPQASYNLFY 271
                      L+P      AS K H   P  +++L+ 
Sbjct: 214 LLCAPGIASTALLPWEQGPDASWKTHGAPPALAFHLYE 251


>gi|330809700|ref|YP_004354162.1| cAMP phosphodiesterase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327377808|gb|AEA69158.1| putative cAMP phosphodiesterase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 276

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 59/280 (21%), Positives = 101/280 (36%), Gaps = 39/280 (13%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F++A ISD+HL               G+V+     +   + +  N       +   D V 
Sbjct: 5   FLIAQISDLHLKAGEKLTY-------GVVDTLAALR--HAVDHLNA-----RVPRPDIVV 50

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+V+F    E       L  +  P    +VPGNHD       E    A+ D+   D 
Sbjct: 51  ISGDLVDFGRPDEYAVLHPELARLHMP--CYLVPGNHDNR-----EHLRAAFADH---DY 100

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             S       ++   + + LIG  +   T P    G     Q     + L  A +     
Sbjct: 101 LPSVAGAPLDWVVDEHPLRLIGLDS---TIPGGHGGRLLDSQLSWLDEQL--AGRPDVPT 155

Query: 190 IIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++++HHPP +      +R         +++I      + +L GH H             +
Sbjct: 156 LLVLHHPPFISGIGHMDREPFINASALEQVIARHPQVERLLCGHLHRPMQRRF---GGSL 212

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKN---EYWTLEG 283
             V   ++ Q V   +P A  + F +E       +W  +G
Sbjct: 213 SCVCPGTSHQIVLDLQPTAPAH-FNLEPPGYLLHHWHGQG 251


>gi|262368757|ref|ZP_06062086.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316435|gb|EEY97473.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 258

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/247 (16%), Positives = 82/247 (33%), Gaps = 25/247 (10%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRS 92
            I+ L + HF  ++    +    L  +   H  + V ++GD+       + +    +L S
Sbjct: 1   MILHLSDLHFGTEREVCLQAIRQLCEE---HPFEAVVVSGDLTQRARFIQFYACRQFLDS 57

Query: 93  IGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGC 152
           +  P    +VPGNHD  +     +    +  Y           +   +        +IG 
Sbjct: 58  LKLP--YLVVPGNHDIPLYHVWNRFFSPFARYQLFFGGMENTLETERFY-------VIGV 108

Query: 153 STAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH----PPVLDTSSLYNRM 208
           ++      +   G+    Q       L++A      ++I  H     PP          M
Sbjct: 109 NSIR--RRYHTRGHISLNQIQEIDLKLQQAPAH-KIKLIAAHQPFYTPPDHSHGVKDCPM 165

Query: 209 FGIQRFQKMIWHEGADLILHGHTHLNSLHWIK-----NEKKLIPVVGIASASQKVHSNKP 263
            G    ++     G + +LHGH H  +++ +           +  +   +A+        
Sbjct: 166 LGRIALEQ-WSQHGLNGLLHGHLHHAAVYDLNQIYQLGVSHPVLDIHAGTATSYRLHAGL 224

Query: 264 QASYNLF 270
             S N+ 
Sbjct: 225 PNSLNII 231


>gi|145220189|ref|YP_001130898.1| metallophosphoesterase [Prosthecochloris vibrioformis DSM 265]
 gi|145206353|gb|ABP37396.1| metallophosphoesterase [Chlorobium phaeovibrioides DSM 265]
          Length = 288

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/259 (16%), Positives = 89/259 (34%), Gaps = 58/259 (22%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +AHISD+H++ S    +L                        + ++  + +   DH+ I+
Sbjct: 7   IAHISDLHIAGSGEGRQLQD---------------------LDRMLEYLNVSGYDHLVIS 45

Query: 72  GDIVNFTCNREIFTSTHWLRSIG--NPHDISIVPGNHDA--------------YISGAKE 115
           GD+ +     +       L   G  +    ++V GNHD                + G +E
Sbjct: 46  GDLSDRGRTEDWAIVKDKLVRHGWYHWERTTVVAGNHDLIRLEEEMRFYNAMNPLQGLRE 105

Query: 116 KSLHA-----WKDYITSDTTCSTGKKLFPYLRIR----NNIALIGCSTAIATP----PFS 162
           ++         + +    T     +  FP++++       ++++ C++  A      P  
Sbjct: 106 RACRQRAESFCRFFRELVTGGDDTEPAFPFIKVMRFPAATLSIVACNSVHAWSPTDNPLG 165

Query: 163 ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--------PVLDTSSLYNRMFGIQRF 214
           A G     +  A +    +    G F I + HH          +         +     F
Sbjct: 166 ARGVIDPSELRAIASPAVRKALSGSFVIGLCHHALKVYGTDRLLDQAFDWTMELKNRDDF 225

Query: 215 QKMIWHEGADLILHGHTHL 233
            +++    A ++LHGH H 
Sbjct: 226 LQVMREIDARVVLHGHFHR 244


>gi|116695543|ref|YP_841119.1| phosphohydrolase [Ralstonia eutropha H16]
 gi|113530042|emb|CAJ96389.1| predicted phosphohydrolase [Ralstonia eutropha H16]
          Length = 281

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 41/239 (17%), Positives = 82/239 (34%), Gaps = 30/239 (12%)

Query: 7   TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           T  +++AHI+D+H+            +  G +++             + L+        D
Sbjct: 3   TAPYLVAHITDLHI------------KAGGKLSYRLVDTAGALHRCIDTLLA--APQQPD 48

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+V+F    E       L+ +  P  + ++PGNHD+   GA  +      DY+ 
Sbjct: 49  AVIVTGDLVDFGAESEYQFLRQILQRLSMP--VRLLPGNHDS--RGALRRVFAD-HDYLF 103

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                 +G+    Y      + L+     +   P    G             L     + 
Sbjct: 104 ---ATGSGEDPVHYSIDSGPLRLVAFDCTVPGQP---GGRVDPGALPWLEAALSADPARP 157

Query: 187 FFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNE 242
              ++++HHPP        +   +      + ++      + +L GH H +        
Sbjct: 158 --TLLLLHHPPFFTGIGHMDEQGLANADALEAIVRRHPQVERVLCGHLHRHITRRFGGT 214


>gi|312132083|ref|YP_003999423.1| metallophosphoesterase [Leadbetterella byssophila DSM 17132]
 gi|311908629|gb|ADQ19070.1| metallophosphoesterase [Leadbetterella byssophila DSM 17132]
          Length = 604

 Score =  106 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/276 (16%), Positives = 85/276 (30%), Gaps = 58/276 (21%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDH 67
           +F  A +SD H+               G  +                 + D+ L  ++D 
Sbjct: 21  IFRYAQVSDTHVGG-----------ATGADDLR-------------ATVKDLNLQKDIDF 56

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V  TGDI  F    E+  +   L S+  P    ++PGNHD             W +   +
Sbjct: 57  VLFTGDITEFGAEEELRLAKRILDSLNLP--WYVIPGNHD-----------SNWSESGAN 103

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G + F + R +     +G  +        + G   +E       + +    +  
Sbjct: 104 DFRRVFGGETF-FFRHKG-FQFMGTVS--GPNMRMSPGQIPRENLVWMDSVFQAVPNEPL 159

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
              I ++H P+       N +       + I        + GH H+N  +       ++ 
Sbjct: 160 ---IFINHYPL------DNGLNNWYEAIERIKRRNILFAMCGHGHINKRYDWDGITGVM- 209

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
                     + +  P   YNL  I      + +  
Sbjct: 210 ------GRSNLRAKDPVGGYNLIDIYPDKAVYQVRV 239


>gi|194289541|ref|YP_002005448.1| metallophosphoesterase [Cupriavidus taiwanensis LMG 19424]
 gi|193223376|emb|CAQ69381.1| putative Metallophosphoesterase [Cupriavidus taiwanensis LMG 19424]
          Length = 289

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 84/240 (35%), Gaps = 27/240 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           +++AHI+D+H+            +  G +++         ++  + L+   L    D   
Sbjct: 11  YLVAHITDLHI------------KAGGRLSYRRVDTAGALRQCIDTLLA--LPQRPDVAV 56

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+V+F    E       L S+  P  +   PGNHD+   GA  +      D+     
Sbjct: 57  VTGDLVDFGIEDEYRFLRGILESLPMPVRLM--PGNHDS--RGALRRVFADHADHAYLFA 112

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                  +  Y      + LI     +   P  + G    +        L  A ++    
Sbjct: 113 AGDADAPVH-YRIDAGPLTLIAFDCTV---PGHSGGRVDPDALPWLEAALAAAPQRP--T 166

Query: 190 IIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++M+HHPP        +R  +      + ++      + +L GH H +          + 
Sbjct: 167 LLMLHHPPFHTGIGHMDRQGLENAALLEVVVRRHPQVERVLCGHLHRHITRRFGGTIAMT 226


>gi|220926509|ref|YP_002501811.1| metallophosphoesterase [Methylobacterium nodulans ORS 2060]
 gi|219951116|gb|ACL61508.1| metallophosphoesterase [Methylobacterium nodulans ORS 2060]
          Length = 275

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 50/240 (20%), Positives = 82/240 (34%), Gaps = 34/240 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           ++A I+D+H+                   +         +   + LI   L    D V +
Sbjct: 2   LIAQITDLHVRPRGRPA------------YRVAETNMLVERAIDALIA--LQPRPDVVLV 47

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ +     E       L  +  P  I +VPGNHD      +     AW    T D  
Sbjct: 48  TGDLTDCGLPEEYALLRSLLGRLPIP--IFVVPGNHDRRE-ALRAGLPAAWLPDATQDFV 104

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                    Y+     + LIG  T +   P S++G   + +       L     +    +
Sbjct: 105 Q--------YVVDDWPMRLIGLDTLV---PGSSHGELCERRLAFLEDALAAGRDRP--TL 151

Query: 191 IMMHHPPVLDTSSLYNRMF---GIQRFQKMI-WHEGADLILHGHTHLNSLHWIKNEKKLI 246
           + MHHPP        +R+    G  RF+ ++  H   + I+ GH H            L+
Sbjct: 152 LFMHHPPFACGMEDMDRIRLIDGEARFRALVGAHANIERIVCGHHHRPIQARYAGTLALV 211


>gi|94313766|ref|YP_586975.1| putative metallophosphoesterase [Cupriavidus metallidurans CH34]
 gi|93357618|gb|ABF11706.1| putative metallophosphoesterase [Cupriavidus metallidurans CH34]
          Length = 290

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 86/240 (35%), Gaps = 30/240 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           +++A ++D+H+            +  G +++         +   + L+        D V 
Sbjct: 15  YLVAQLTDLHI------------KAGGKLSYRRVDTAGALRTAIDTLLA--APQQPDIVI 60

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+V+F    E       L+ +  P  + ++PGNHD        +++ A  DY+ ++ 
Sbjct: 61  VTGDLVDFGSESEYRFLRDLLQPL--PMPVRLLPGNHD---HRPSLRAVFADHDYLFANG 115

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
               G     Y      + L+G    +   P    G             L  A K+    
Sbjct: 116 D---GDAPVHYAIDAGPLRLVGFDCTVPGKP---GGRAEDAGLAWLDATLAAAPKQP--T 167

Query: 190 IIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++M+HHPP        +   +     F+ +I      + ++ GH H +          + 
Sbjct: 168 LVMLHHPPFHTGIGHMDDQGLENAPAFEAIIARHPQVERVVCGHLHRHITRRFGGTIAMT 227


>gi|193213169|ref|YP_001999122.1| metallophosphoesterase [Chlorobaculum parvum NCIB 8327]
 gi|193086646|gb|ACF11922.1| metallophosphoesterase [Chlorobaculum parvum NCIB 8327]
          Length = 290

 Score =  105 bits (263), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 46/269 (17%), Positives = 93/269 (34%), Gaps = 58/269 (21%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +AH+SD+H++                      +           +  + +    DH+ 
Sbjct: 7   VTIAHLSDLHIA---------------------GKSDRHQLARLERMFEEFVHRGYDHLV 45

Query: 70  ITGDIVNFTCNREIFTSTHWLRS--IGNPHDISIVPGNHDA--------------YISGA 113
           +TGD+++     +       L    + + +  +++PGNHD                I G+
Sbjct: 46  MTGDLIDTASPADWEILREALERNGLFDWNKTTLIPGNHDLINLEEEMRIYNALNPIDGS 105

Query: 114 KEKSLH--------AWKDYITSDTTCSTGKKLFPYLRIRN-NIALIGCSTAIATP----P 160
           ++K            ++  I+ D     G      +R    +I+ +  +T         P
Sbjct: 106 RKKRAEGRIRAFDAIFRPLISGDGEAGAGLPFVKVMRFGEMSISFVAVNTVDPWSPTDNP 165

Query: 161 FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH-PPVLDTSSLYNRMFGI-------Q 212
             A G    +   A S         G F I + HH   V  T ++ ++ F          
Sbjct: 166 LGARGSVWPQTLQALSDPQVAQALDGSFVIGLCHHAYKVYGTGAMIDQAFDWTMQFRNRD 225

Query: 213 RFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            + +M+   G++L+LHGH H   ++ +  
Sbjct: 226 DYLRMMKMLGSNLVLHGHFHRFQVYSVGG 254


>gi|33603905|ref|NP_891465.1| putative cAMP phosphodiesterase [Bordetella bronchiseptica RB50]
 gi|33568881|emb|CAE35295.1| putative cAMP phosphodiesterase [Bordetella bronchiseptica RB50]
          Length = 273

 Score =  105 bits (263), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 82/236 (34%), Gaps = 34/236 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           ++A ISD+H+            R+ G   +       +       L    L    D V +
Sbjct: 2   LIAQISDLHI------------RMPGQKAYRVVETDRYLPPAVAALNR--LEPAPDLVIV 47

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+ +F   +E       L ++  P+ +   PGNHD  +  A   + H +         
Sbjct: 48  SGDLTDFGRPQEYAHLKQMLDALRAPYHVL--PGNHDDRVQLAATFADHPY--------- 96

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                +   Y      +  I   T +   P  ++G   + +    ++ L  A + G   +
Sbjct: 97  LREAGEFVQYTIEDQPLRFIVLDTVV---PQQSHGALCERRLQWLAQRL--AEQPGRPTV 151

Query: 191 IMMHHPPVLDTSSLYNR---MFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           I+MHHPP     +  +    + G    + ++      + I+ GH H          
Sbjct: 152 IVMHHPPFRTGIAHMDAIGLLAGAPELEALVARHSNVERIMCGHLHRTIFQRFGGT 207


>gi|300717918|ref|YP_003742721.1| Metallophosphoesterase [Erwinia billingiae Eb661]
 gi|299063754|emb|CAX60874.1| Metallophosphoesterase [Erwinia billingiae Eb661]
          Length = 277

 Score =  105 bits (263), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 81/237 (34%), Gaps = 35/237 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            +LA ISD+H+            +  G +++         ++V   L   +     D V 
Sbjct: 6   VLLAQISDLHI------------KAHGKLSYRKVDTLGALRQVIARLNALL--PRPDAVV 51

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+V+F    E  T    L  +  P+ +    GNHD                 I +D 
Sbjct: 52  ITGDLVDFGHEEEYLTLKEALSHLELPYWLMA--GNHD----------DRQMMRKIFADQ 99

Query: 130 TCSTGKKLFPYLRIR-NNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           T       F         + L+   + +   P    G   +E+    S  L++   +   
Sbjct: 100 THLFQHHEFIEWEGECGPLRLLALDSTVPQQP---QGELCEERLGWLSDRLKEQPLRP-- 154

Query: 189 RIIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNE 242
            I+M+HHPP +         R+   Q    +I      + +L GH H +        
Sbjct: 155 TIVMLHHPPFISGIDHMDRQRLRNPQPLAAVIKGHPQVERVLCGHLHRSMQVRFAGT 211


>gi|167845119|ref|ZP_02470627.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei B7210]
 gi|217423699|ref|ZP_03455200.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 576]
 gi|217393557|gb|EEC33578.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 576]
          Length = 275

 Score =  105 bits (262), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 85/262 (32%), Gaps = 36/262 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M +LAHISD+H+           KR  G + +               L  + L    D V
Sbjct: 1   MMLLAHISDLHI-----------KRP-GALAYRRVDTAAHLARCVARL--NALEPRPDAV 46

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ +F  + E       L  +  P+ + +  GNHD     A  ++  A  +  + +
Sbjct: 47  LVTGDLTDFGDDDEYAHLKALLAPLAMPYYLLV--GNHD--DRAALRRAFPARVELQSGE 102

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      Y      + +I   + I   P ++ G     +    +  L  A  +   
Sbjct: 103 FVQ--------YALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDRPV- 150

Query: 189 RIIMMHHPPVLDTSSLYNRMF----GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
            I+ +HHPP        + M        R   ++      + +L GH H  +        
Sbjct: 151 -IVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTTFARFGGTI 209

Query: 244 KLIPVVGIASASQKVHSNKPQA 265
                      +  +    P +
Sbjct: 210 ASAVPAPAHQVTFDLRDGGPSS 231


>gi|66045781|ref|YP_235622.1| metallophosphoesterase [Pseudomonas syringae pv. syringae B728a]
 gi|63256488|gb|AAY37584.1| Metallophosphoesterase [Pseudomonas syringae pv. syringae B728a]
          Length = 265

 Score =  105 bits (262), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 48/262 (18%), Positives = 87/262 (33%), Gaps = 37/262 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHV 68
           ++AHISD H+      ++       G+V+         S  +    ++ I       D +
Sbjct: 2   LIAHISDTHVRPRGQLYQ-------GVVD---------SNAMLAAAVDTINTLDPAPDLI 45

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             +GD+V+     E   +   L+ +     + ++PGNHD         +     DY  +D
Sbjct: 46  LFSGDLVDEGRPEEYAMARELLQPLRQ--KLLMIPGNHD--HRQNLRDAFAE-HDYFIND 100

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
             CS              + +IG   ++       +G             L     K   
Sbjct: 101 QDCSF------VYSGSAPVRIIGLDISVPE---QHHGDMTDTAIRWLDSTLALEPDKP-- 149

Query: 189 RIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHEGA-DLILHGHTHLNSLHWIKNEKKL 245
            +IMMH PP        +  R    +R  +++    A + I+ GH H             
Sbjct: 150 TLIMMHQPPFSSGIPYIDAYRCERGERLAEVVSRYPAIERIVCGHIHRFMQLRFGGTLMC 209

Query: 246 IPVVGIASASQKVHSNKPQASY 267
                  + + ++H     ASY
Sbjct: 210 TAPSTTTAIALRLHPEAADASY 231


>gi|126642700|ref|YP_001085684.1| putative 3'5'-cyclic-nucleotide phosphodiesterase [Acinetobacter
           baumannii ATCC 17978]
          Length = 221

 Score =  105 bits (262), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 81/223 (36%), Gaps = 23/223 (10%)

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            + ++GDI       + F    +L S+  P    +VPGNHD  +     +    +  Y  
Sbjct: 1   MIVVSGDITQRAKYEQFFKCRQYLDSLNIP--YLVVPGNHDIPLYHVWNRFFSPFTRY-- 56

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    +L P L    N  ++G ++      +   G+   EQ  AT + L +   K 
Sbjct: 57  ----RYFFGELEPTLE-TENFYIVGVNSIR--RRYHTRGHISIEQIQATYERLDR-GPKN 108

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE----GADLILHGHTHLNSLHWIK-- 240
             ++++ H P      + +  +       K+   +    G   +LHGH H  +++ +   
Sbjct: 109 KIKLVVFHQPFYTPPDNKH-GIKDCPVLGKIALEKWSTTGLFGMLHGHLHKTAIYDLTQI 167

Query: 241 ---NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKK-NEYW 279
                   I  +   +A+     +    S+N    E K   YW
Sbjct: 168 YSLKIDHPIFDIHAGTATSTRLYHHNPNSFNTISNEGKIQHYW 210


>gi|33598830|ref|NP_886473.1| putative cAMP phosphodiesterase [Bordetella parapertussis 12822]
 gi|33574960|emb|CAE39624.1| putative cAMP phosphodiesterase [Bordetella parapertussis]
          Length = 273

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 82/236 (34%), Gaps = 34/236 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           ++A ISD+H+            R+ G   +       +       L    L    D V +
Sbjct: 2   LIAQISDLHI------------RMPGQKAYRVVETDRYLPPAVAALNR--LEPAPDLVIV 47

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+ +F   +E       L ++  P+ +   PGNHD  +  A   + H +         
Sbjct: 48  SGDLTDFGRPQEYTHLKQMLDALRAPYHVL--PGNHDDRVQLAATFADHPY--------- 96

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                +   Y      +  I   T +   P  ++G   + +    ++ L  A + G   +
Sbjct: 97  LREAGEFVQYTIEDQPLRFIVLDTVV---PQQSHGALCERRLQWLAQRL--AEQPGRPTV 151

Query: 191 IMMHHPPVLDTSSLYNR---MFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           I+MHHPP     +  +    + G    + ++      + I+ GH H          
Sbjct: 152 IVMHHPPFRTGIAHMDAIGLLAGAPELEALVARHSNVERIMCGHLHRTIFQRFGGT 207


>gi|107028312|ref|YP_625407.1| metallophosphoesterase [Burkholderia cenocepacia AU 1054]
 gi|116686307|ref|YP_839554.1| metallophosphoesterase [Burkholderia cenocepacia HI2424]
 gi|105897476|gb|ABF80434.1| metallophosphoesterase [Burkholderia cenocepacia AU 1054]
 gi|116652022|gb|ABK12661.1| metallophosphoesterase [Burkholderia cenocepacia HI2424]
          Length = 239

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/211 (19%), Positives = 74/211 (35%), Gaps = 28/211 (13%)

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D V I+GD+ +     E       L  +  P    ++PGNHD   +       HAW  
Sbjct: 15  EPDLVVISGDLTDEGTEDEYRKLRELLVELRRP--FVVLPGNHDDRGNLRAAFPDHAWLP 72

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                      +    +      + L+   T++   P   +G    E        L +  
Sbjct: 73  ----------DEGALSFALDVGELRLVALDTSV---PGLHHGDLDAETLAWLDTELAEH- 118

Query: 184 KKGFFRIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIK 240
            +    +I+MHHPP +      +   +   + F  ++      D IL GH H +    + 
Sbjct: 119 -RNRTVVIVMHHPPFMTGIPYLDIYGLRNAEAFAAVLARHDNVDRILAGHVHRSMQTRL- 176

Query: 241 NEKKLIPVVGIASAS----QKVHSNKPQASY 267
                +PV+   S +     +V ++   AS+
Sbjct: 177 ---GRVPVLTCPSTTTQIALRVEADAQPASF 204


>gi|33863822|ref|NP_895382.1| Serine/threonine specific protein phosphatase [Prochlorococcus
           marinus str. MIT 9313]
 gi|33635405|emb|CAE21730.1| Serine/threonine specific protein phosphatase [Prochlorococcus
           marinus str. MIT 9313]
          Length = 263

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 52/282 (18%), Positives = 95/282 (33%), Gaps = 46/282 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            L  +SD HL           +R++   N   N             +     H+ D + I
Sbjct: 2   RLVQLSDPHLVA-------FNQRLVRGQNPLLN---------FQCALQHGASHSPDLLLI 45

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ +           H L+++     ++++PGNHD  +        HA+         
Sbjct: 46  TGDLCHDETWCGYILLRHELQNLSPSIKVAVLPGNHDNPLFIKAALGRHAFTA------- 98

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                   P     + + LI  S+ +   P    G  G+ Q       L    + G   +
Sbjct: 99  --------PADLNVDGVRLILLSSHV---PGRTAGQLGESQLQWLDARLSDFQQSGRPLV 147

Query: 191 IMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEGAD---LILHGHTHLNSLHWIKNEKKL 245
           + +HHPP+   SS  +   +   +   K++     D    ++ GH H +    +   K  
Sbjct: 148 VAVHHPPLPIGSSWLDAIGLVDGEALIKLL--TPVDELCAVVCGHIHQHWQGGLPGRKD- 204

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
           + V+G  S      + +P     L   E +     +E     
Sbjct: 205 VLVLGCPSTLCSFKAVQPC----LLGREDEPGGRLIELDERG 242


>gi|291618369|ref|YP_003521111.1| Icc [Pantoea ananatis LMG 20103]
 gi|291153399|gb|ADD77983.1| Icc [Pantoea ananatis LMG 20103]
          Length = 276

 Score =  104 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/245 (19%), Positives = 81/245 (33%), Gaps = 44/245 (17%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN----- 64
            ++A ISD+H+                       R  Y   +  N L+  I   N     
Sbjct: 6   VLIAQISDLHIKAH-------------------GRLSYKKVDTYNALLRAIATLNGLTPR 46

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            D V ITGD+V+F    E  T    L ++  P    ++ GNHD        ++L A    
Sbjct: 47  PDAVVITGDLVDFGTAEEYQTLRQALATLALP--FYLMAGNHD------DRQALRA---- 94

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
              D           + R    + L+   +++   P+   G   ++Q       L  +  
Sbjct: 95  AFPDHPYLQQGPTLNWQREVKGVQLLALDSSVPQQPW---GELDEQQLDWLDAALTASPD 151

Query: 185 KGFFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
                ++M+HHPP +      +R  +        ++      + +L GH H         
Sbjct: 152 SPA--LVMLHHPPFVCGIDHMDRQRLRAPAALAAIVSRHPQVERVLCGHVHRAIQTRFAG 209

Query: 242 EKKLI 246
               I
Sbjct: 210 TLACI 214


>gi|33591381|ref|NP_879025.1| putative cAMP phosphodiesterase [Bordetella pertussis Tohama I]
 gi|33571023|emb|CAE40503.1| putative cAMP phosphodiesterase [Bordetella pertussis Tohama I]
 gi|332380782|gb|AEE65629.1| putative cAMP phosphodiesterase [Bordetella pertussis CS]
          Length = 273

 Score =  104 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 82/236 (34%), Gaps = 34/236 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           ++A ISD+H+            R+ G   +       +       L    L    D V +
Sbjct: 2   LIAQISDLHI------------RMPGQKAYRVVETDRYLPPAVAALNR--LEPAPDLVIV 47

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+ +F   +E       L ++  P+ +   PGNHD  +  A   + H +         
Sbjct: 48  SGDLTDFGRPQEYAHLKQMLDALRVPYHVL--PGNHDDRVQLAATFADHPY--------- 96

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                +   Y      +  I   T +   P  ++G   + +    ++ L  A + G   +
Sbjct: 97  LREAGEFVQYTIEDQPLRFIVLDTVV---PQQSHGALCERRLQWLAQRL--AEQPGRPTV 151

Query: 191 IMMHHPPVLDTSSLYNR---MFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           I+MHHPP     +  +    + G    + ++      + I+ GH H          
Sbjct: 152 IVMHHPPFRTGIAHMDAIGLLAGAPELEALVARHSNVERIMCGHLHRTIFQRFGGT 207


>gi|312961461|ref|ZP_07775963.1| Ser/Thr protein phosphatase family protein [Pseudomonas fluorescens
           WH6]
 gi|311284258|gb|EFQ62837.1| Ser/Thr protein phosphatase family protein [Pseudomonas fluorescens
           WH6]
          Length = 277

 Score =  104 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/243 (19%), Positives = 82/243 (33%), Gaps = 38/243 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRII-GLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           FV+A ISD+HL         + +R+  G+V+                 ++ +       D
Sbjct: 5   FVVAQISDLHLK--------AGQRLTYGVVDTL---------GALRRAVDHLNASHPRPD 47

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V ++GD+V+F    E       L  +  P    +VPGNHD           HA+    +
Sbjct: 48  IVVVSGDLVDFGRPDEYAVLHPELSRLHMP--CYLVPGNHDTRGPLLAAFGDHAYLP-RS 104

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           +D          P       + LIG  +   T P    G     Q     + L       
Sbjct: 105 ADGPLDWVVDEHP-------LRLIGLDS---TIPGGHGGQLLDSQLRWLDEQLALRPDAP 154

Query: 187 FFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
              ++++HHPP +      +R         ++++      + +L GH H           
Sbjct: 155 --TLLILHHPPFISGIGHMDREPFINAAALEQVVARHPQVERLLCGHLHRPMQRRFGGSL 212

Query: 244 KLI 246
             +
Sbjct: 213 SCV 215


>gi|269127362|ref|YP_003300732.1| metallophosphoesterase [Thermomonospora curvata DSM 43183]
 gi|268312320|gb|ACY98694.1| metallophosphoesterase [Thermomonospora curvata DSM 43183]
          Length = 1831

 Score =  104 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 62/315 (19%), Positives = 110/315 (34%), Gaps = 46/315 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLL--INDILLHNVDH 67
             + H+SD        F E         +     R    +  +   +  + D      D 
Sbjct: 7   VTVLHVSDTQFGKEHRFGEE-------GLTPGDRRHSSLAARILKDVRHLEDEHGLRPDL 59

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGN-----PHDISIVPGNHDA-------YISGAKE 115
           V  +GD+  +   +E      +L  + +        + +VPGNHD        Y    ++
Sbjct: 60  VVASGDLAEWGLPKEFKQVQEFLEELTDGLGLSRDRVVMVPGNHDVSRRKCRRYFEECED 119

Query: 116 KSLHAWKDYITSDTTCSTGKKLF----PYLR--------------IRNNIALIGCSTAIA 157
                   Y       S     F    P +R              +R  +A +  + A +
Sbjct: 120 NDTEPIPPYWPKWEPFSAMFADFYADVPGVRFLSDQPWTLYEMPELRTVVAALNSTMAES 179

Query: 158 TPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKM 217
                  GY G+EQ    +  LR+  ++G+ RI +MHH P +   +    +    RF ++
Sbjct: 180 HREEDHYGYCGEEQLQWFADRLRRFKEEGWLRIGVMHHNPEISDETDEAFLRDRDRFTEL 239

Query: 218 IWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKV--HSNKPQASYNLFYIEKK 275
           +      L+ HGHTH  +L  +  +   +PV+   SA  +      +    Y L  I   
Sbjct: 240 LAPSLNLLL-HGHTHQAALCSLGPDG--LPVLCAGSAGVRPQARPAEVPNQYQLIRI--T 294

Query: 276 NEYWTLEGKRYTLSP 290
             +  + G+RY  S 
Sbjct: 295 AGHLEVYGRRYNPSR 309


>gi|332709207|ref|ZP_08429173.1| putative phosphohydrolase [Lyngbya majuscula 3L]
 gi|332352016|gb|EGJ31590.1| putative phosphohydrolase [Lyngbya majuscula 3L]
          Length = 370

 Score =  104 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 44/240 (18%), Positives = 87/240 (36%), Gaps = 22/240 (9%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H+    + ++   +    LV          S  V   ++ D+    +D + 
Sbjct: 5   FRFAVVSDLHIGLPHTIWDHPNR--FHLV--------EVSIPVLERILEDLEQEALDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWK-DYITSD 128
           + GD+               L  +  P  + +VPGNHD       E S+   +  Y    
Sbjct: 55  LPGDLTQHGEPDNHAWLQKRLSQLPFP--VYVVPGNHDVPNILPNEHSIGLKEFPYYYRQ 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 ++L+    +   + LIG ++          G   Q+Q     ++L +   K   
Sbjct: 113 FGYENPEQLYYTCEVLPGVQLIGLNSNQFDTGGKQVGRLDQQQLIWLEQVLPQCQDK--L 170

Query: 189 RIIMMH-----HPPVLDTSSLYNR--MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+H     H P      L +R  +        ++   G +L+  GH H+  + + + 
Sbjct: 171 VLVMVHHNVIEHLPDQANHPLGHRYILENAPVLHNILKTAGVNLLFTGHLHVQDIAYQEG 230


>gi|254259580|ref|ZP_04950634.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1710a]
 gi|254218269|gb|EET07653.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1710a]
          Length = 275

 Score =  104 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 84/262 (32%), Gaps = 36/262 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M +LAHISD+H+           KR  G + +               L  + L    D V
Sbjct: 1   MMLLAHISDLHI-----------KRP-GALAYRRVDTAAHLARCVARL--NALEPRPDAV 46

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ +F  + E       L  +  P+ + +  GNHD     A  ++  A  +  + +
Sbjct: 47  LVTGDLTDFGDDDEYAHLKALLAPLAMPYYLLV--GNHD--DRAAMRRAFPARVELQSGE 102

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      Y      + +I   + I   P ++ G     +    +  L  A  +   
Sbjct: 103 FVQ--------YALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDRPV- 150

Query: 189 RIIMMHHPPVLDTSSLYNRMF----GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
            I+ +HHPP        + M        R   ++      + +L GH H           
Sbjct: 151 -IVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGGTI 209

Query: 244 KLIPVVGIASASQKVHSNKPQA 265
                      +  +    P +
Sbjct: 210 ASAVPAPAHQVTFDLRDGGPSS 231


>gi|17230344|ref|NP_486892.1| hypothetical protein all2852 [Nostoc sp. PCC 7120]
 gi|17131946|dbj|BAB74551.1| all2852 [Nostoc sp. PCC 7120]
          Length = 371

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 43/281 (15%), Positives = 93/281 (33%), Gaps = 34/281 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H++   + ++           +H       +       I  +   N+D + 
Sbjct: 5   FRFAVVSDLHIALPHTIWD-------HPSRFHLVEVGIPA---FESAIKHLTKLNLDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEK--SLHAWKDYITS 127
           + GD+               L  +  P    +VPGNHD  +  A E+  +   +  Y   
Sbjct: 55  LPGDLTQHGEPENHRWLQERLSKLPFP--TYVVPGNHDVPVVMANEQSIACADFPQYYRQ 112

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
               +T +  +   ++   + LIG ++          G    +Q     ++L  A  +  
Sbjct: 113 FGYDNTEQLYY-TQQLLPGVRLIGLNSNFFNEQGQQVGRLDAQQFQWLEEVLAAAVDE-- 169

Query: 188 FRIIMMHHPPV-------LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
             ++M+HH  V           +    +       +++   G  L+  GH H+  +   +
Sbjct: 170 LVLVMVHHNVVEHLPHQSRHPMASRYMLENAPELVRLLQRYGVKLVFTGHLHVQDVACAE 229

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
                  V  I + S   + +     Y +    +  +    
Sbjct: 230 G------VYDITTGSLVSYPHP----YRVLEFHRDQQGQEW 260


>gi|67643401|ref|ZP_00442147.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei GB8
           horse 4]
 gi|121601377|ref|YP_992543.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           SAVP1]
 gi|124383960|ref|YP_001026654.1| 3',5'-cyclic-nucleotide phosphodiesterase [Burkholderia mallei NCTC
           10229]
 gi|126450491|ref|YP_001080064.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           NCTC 10247]
 gi|126453145|ref|YP_001065685.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1106a]
 gi|167002455|ref|ZP_02268245.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           PRL-20]
 gi|167823575|ref|ZP_02455046.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 9]
 gi|167902113|ref|ZP_02489318.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei NCTC 13177]
 gi|167910353|ref|ZP_02497444.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 112]
 gi|237811694|ref|YP_002896145.1| 3',5'-cyclic-nucleotide phosphodiesterase [Burkholderia
           pseudomallei MSHR346]
 gi|242317579|ref|ZP_04816595.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1106b]
 gi|254180266|ref|ZP_04886865.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1655]
 gi|254197687|ref|ZP_04904109.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei S13]
 gi|254201653|ref|ZP_04908017.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           FMH]
 gi|254206985|ref|ZP_04913336.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           JHU]
 gi|254358899|ref|ZP_04975172.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           2002721280]
 gi|121230187|gb|ABM52705.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           SAVP1]
 gi|124291980|gb|ABN01249.1| 3',5'-cyclic-nucleotide phosphodiesterase [Burkholderia mallei NCTC
           10229]
 gi|126226787|gb|ABN90327.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1106a]
 gi|126243361|gb|ABO06454.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           NCTC 10247]
 gi|147747547|gb|EDK54623.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           FMH]
 gi|147752527|gb|EDK59593.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           JHU]
 gi|148028026|gb|EDK86047.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           2002721280]
 gi|169654428|gb|EDS87121.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei S13]
 gi|184210806|gb|EDU07849.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1655]
 gi|237506370|gb|ACQ98688.1| 3',5'-cyclic-nucleotide phosphodiesterase [Burkholderia
           pseudomallei MSHR346]
 gi|238524749|gb|EEP88180.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei GB8
           horse 4]
 gi|242140818|gb|EES27220.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1106b]
 gi|243061867|gb|EES44053.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           PRL-20]
          Length = 275

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 84/262 (32%), Gaps = 36/262 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M +LAHISD+H+           KR  G + +               L  + L    D V
Sbjct: 1   MMLLAHISDLHI-----------KRP-GALAYRRVDTAAHLARCVARL--NALEPRPDAV 46

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ +F  + E       L  +  P+ + +  GNHD     A  ++  A  +  + +
Sbjct: 47  LVTGDLTDFGDDDEYAHLKALLAPLAMPYYLLV--GNHD--DRAALRRAFPARVELQSGE 102

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      Y      + +I   + I   P ++ G     +    +  L  A  +   
Sbjct: 103 FVQ--------YALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDRPV- 150

Query: 189 RIIMMHHPPVLDTSSLYNRMF----GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
            I+ +HHPP        + M        R   ++      + +L GH H           
Sbjct: 151 -IVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGGTI 209

Query: 244 KLIPVVGIASASQKVHSNKPQA 265
                      +  +    P +
Sbjct: 210 ASAVPAPAHQVTFDLRDGGPSS 231


>gi|167737975|ref|ZP_02410749.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 14]
          Length = 249

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 84/262 (32%), Gaps = 36/262 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M +LAHISD+H+           KR  G + +               L  + L    D V
Sbjct: 1   MMLLAHISDLHI-----------KRP-GALAYRRVDTAAHLARCVARL--NALEPRPDAV 46

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ +F  + E       L  +  P+ + +  GNHD     A  ++  A  +  + +
Sbjct: 47  LVTGDLTDFGDDDEYAHLKALLAPLAMPYYLLV--GNHD--DRAALRRAFPARVELQSGE 102

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      Y      + +I   + I   P ++ G     +    +  L  A  +   
Sbjct: 103 FVQ--------YALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDRPV- 150

Query: 189 RIIMMHHPPVLDTSSLYNRMF----GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
            I+ +HHPP        + M        R   ++      + +L GH H           
Sbjct: 151 -IVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGGTI 209

Query: 244 KLIPVVGIASASQKVHSNKPQA 265
                      +  +    P +
Sbjct: 210 ASAAPAPAHQVTFDLRDGGPSS 231


>gi|317152355|ref|YP_004120403.1| metallophosphoesterase [Desulfovibrio aespoeensis Aspo-2]
 gi|316942606|gb|ADU61657.1| metallophosphoesterase [Desulfovibrio aespoeensis Aspo-2]
          Length = 282

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 54/254 (21%), Positives = 91/254 (35%), Gaps = 29/254 (11%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-VDHVS 69
           ++AHISD+H+            R  G   + F             L +     +  D V 
Sbjct: 2   LIAHISDLHI------------RPHGEKLYDFVDTNALISRHVATLNSIAKTTDSPDAVL 49

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGDIVN    +E   +   L  +  P  + I+PGNHD   +   E            + 
Sbjct: 50  ITGDIVNCGQKQEYAMARRILGQLTMP--LYIIPGNHDN-NANLLEALTDICPPL---EN 103

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
              TG+    Y      +  I   ++I       +G  G+EQ     K L+K   +    
Sbjct: 104 VGKTGEHTIRYTIEEFPVRFIMLDSSIGGE---LHGEIGREQMAWLEKELQKGTGRETA- 159

Query: 190 IIMMHHP-PVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           + M HHP P  +      +    +   +M+        ++ GHTH +    +      I 
Sbjct: 160 VCMHHHPLPSGNAHMDAIKCHDGEALIEMLSRYPNVTRLICGHTHRSIFQNV----GRIL 215

Query: 248 VVGIASASQKVHSN 261
           +  +  A+ +V  +
Sbjct: 216 ICTVPGAAHQVPFH 229


>gi|254298103|ref|ZP_04965556.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 406e]
 gi|157807208|gb|EDO84378.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 406e]
          Length = 318

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/264 (17%), Positives = 84/264 (31%), Gaps = 36/264 (13%)

Query: 7   TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
             M +LAHISD+H+           KR  G + +               L  + L    D
Sbjct: 42  GTMMLLAHISDLHI-----------KRP-GALAYRRVDTAAHLARCVARL--NALEPRPD 87

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ +F  + E       L  +  P+ + +  GNHD     A  ++  A  +  +
Sbjct: 88  AVLVTGDLTDFGDDDEYAHLKALLAPLAMPYYLLV--GNHD--DRAALRRAFPARVELQS 143

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            +           Y      + +I   + I   P ++ G     +    +  L  A  + 
Sbjct: 144 GEFVQ--------YALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDRP 192

Query: 187 FFRIIMMHHPPVLDTSSLYNRMF----GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              I+ +HHPP        + M        R   ++      + +L GH H         
Sbjct: 193 V--IVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGG 250

Query: 242 EKKLIPVVGIASASQKVHSNKPQA 265
                        +  +    P +
Sbjct: 251 TIASAVPAPAHQVTFDLRDGGPSS 274


>gi|76808661|ref|YP_332943.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1710b]
 gi|76578114|gb|ABA47589.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1710b]
          Length = 325

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/264 (17%), Positives = 84/264 (31%), Gaps = 36/264 (13%)

Query: 7   TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
             M +LAHISD+H+           KR  G + +               L  + L    D
Sbjct: 49  GTMMLLAHISDLHI-----------KRP-GALAYRRVDTAAHLARCVARL--NALEPRPD 94

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ +F  + E       L  +  P+ + +  GNHD     A  ++  A  +  +
Sbjct: 95  AVLVTGDLTDFGDDDEYAHLKALLAPLAMPYYLLV--GNHD--DRAAMRRAFPARVELQS 150

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            +           Y      + +I   + I   P ++ G     +    +  L  A  + 
Sbjct: 151 GEFVQ--------YALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDRP 199

Query: 187 FFRIIMMHHPPVLDTSSLYNRMF----GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              I+ +HHPP        + M        R   ++      + +L GH H         
Sbjct: 200 V--IVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGG 257

Query: 242 EKKLIPVVGIASASQKVHSNKPQA 265
                        +  +    P +
Sbjct: 258 TIASAVPAPAHQVTFDLRDGGPSS 281


>gi|53724049|ref|YP_104567.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           ATCC 23344]
 gi|52427472|gb|AAU48065.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           ATCC 23344]
          Length = 354

 Score =  104 bits (260), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/264 (17%), Positives = 84/264 (31%), Gaps = 36/264 (13%)

Query: 7   TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
             M +LAHISD+H+           KR  G + +               L  + L    D
Sbjct: 78  GTMMLLAHISDLHI-----------KRP-GALAYRRVDTAAHLARCVARL--NALEPRPD 123

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ +F  + E       L  +  P+ + +  GNHD     A  ++  A  +  +
Sbjct: 124 AVLVTGDLTDFGDDDEYAHLKALLAPLAMPYYLLV--GNHD--DRAALRRAFPARVELQS 179

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            +           Y      + +I   + I   P ++ G     +    +  L  A  + 
Sbjct: 180 GEFVQ--------YALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDRP 228

Query: 187 FFRIIMMHHPPVLDTSSLYNRMF----GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              I+ +HHPP        + M        R   ++      + +L GH H         
Sbjct: 229 V--IVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGG 286

Query: 242 EKKLIPVVGIASASQKVHSNKPQA 265
                        +  +    P +
Sbjct: 287 TIASAVPAPAHQVTFDLRDGGPSS 310


>gi|323519173|gb|ADX93554.1| phosphohydrolase [Acinetobacter baumannii TCDC-AB0715]
          Length = 221

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/223 (18%), Positives = 81/223 (36%), Gaps = 23/223 (10%)

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            + ++GDI       + F    +L S+  P    +VPGNHD  +     +    +  Y  
Sbjct: 1   MIVVSGDITQRAKYEQFFKCRQYLDSLNIP--YLVVPGNHDIPLYHVWNRFFSPFTRY-- 56

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    +L P L    +  ++G ++      +   G+   EQ  AT + L +   K 
Sbjct: 57  ----RYFFGELEPTLE-TEHFYIVGVNSIR--RRYHTRGHISIEQIQATYERLDR-GPKN 108

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE----GADLILHGHTHLNSLHWIK-- 240
             ++++ H P      + +  +       K+   +    G   +LHGH H  +++ +   
Sbjct: 109 KIKLVVFHQPFYTPPDNKH-GIKDCPVLGKIALEKWSTTGLFGMLHGHLHKTAIYDLTQI 167

Query: 241 ---NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKK-NEYW 279
                   I  +   +A+     +    S+N    E K   YW
Sbjct: 168 YSLKIDHPIFDIHAGTATSTRLYHHNPNSFNTISNEGKIQHYW 210


>gi|167836151|ref|ZP_02463034.1| Ser/Thr protein phosphatase family protein [Burkholderia
           thailandensis MSMB43]
          Length = 274

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/260 (18%), Positives = 82/260 (31%), Gaps = 36/260 (13%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           +LAHISD+H+           KR  G + +               L  + L    D V +
Sbjct: 2   LLAHISDLHI-----------KRP-GALAYRRVDTAAHLARCVARL--NALEPRPDAVLV 47

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ +F  + E       L  +  P+ + +  GNHD     A  +    W+  + S   
Sbjct: 48  TGDLTDFGDDDEYAHLKSLLAPLAMPYYLIV--GNHD---DRAALRRAFPWRAELQSGAF 102

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                 L         + +I   + I   P ++ G     +    +  L  A  +    I
Sbjct: 103 VQYALDL-------GPLRVIALDSQI---PGASGGTLCDARLAWLAGQLDAARDRPV--I 150

Query: 191 IMMHHPPVLDTSSLYNRMF----GIQRFQKMIWH-EGADLILHGHTHLNSLHWIKNEKKL 245
           + +HHPP        + M        R   ++      + +L GH H             
Sbjct: 151 VALHHPPFACGIGHMDAMRLAPDASSRLDALLRRFPNVERVLCGHVHRTMFARFGGTIAS 210

Query: 246 IPVVGIASASQKVHSNKPQA 265
                    +  +    P +
Sbjct: 211 AVPAPAHQVTFDLRDGGPSS 230


>gi|53718935|ref|YP_107921.1| putative phosphodiesterase [Burkholderia pseudomallei K96243]
 gi|126442276|ref|YP_001058448.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 668]
 gi|134283787|ref|ZP_01770484.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 305]
 gi|167718974|ref|ZP_02402210.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei DM98]
 gi|167815157|ref|ZP_02446837.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 91]
 gi|167893670|ref|ZP_02481072.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 7894]
 gi|167918381|ref|ZP_02505472.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei BCC215]
 gi|52209349|emb|CAH35294.1| putative phosphodiesterase [Burkholderia pseudomallei K96243]
 gi|126221769|gb|ABN85275.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 668]
 gi|134244775|gb|EBA44872.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 305]
          Length = 275

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 84/262 (32%), Gaps = 36/262 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M +LAHISD+H+           KR  G + +               L  + L    D V
Sbjct: 1   MMLLAHISDLHI-----------KRP-GALAYRRVDTAAHLARCVARL--NALEPRPDAV 46

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ +F  + E       L  +  P+ + +  GNHD     A  ++  A  +  + +
Sbjct: 47  LVTGDLTDFGDDDEYAHLKALLAPLAMPYYLLV--GNHD--DRAALRRAFPARVELQSGE 102

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      Y      + +I   + I   P ++ G     +    +  L  A  +   
Sbjct: 103 FVQ--------YALDLGPLRVIALDSQI---PGASGGTLCDARLAWLAGQLDAARDRPV- 150

Query: 189 RIIMMHHPPVLDTSSLYNRMF----GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
            I+ +HHPP        + M        R   ++      + +L GH H           
Sbjct: 151 -IVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGGTI 209

Query: 244 KLIPVVGIASASQKVHSNKPQA 265
                      +  +    P +
Sbjct: 210 ASAVPAPAHQVTFDLRDGGPSS 231


>gi|189499586|ref|YP_001959056.1| metallophosphoesterase [Chlorobium phaeobacteroides BS1]
 gi|189495027|gb|ACE03575.1| metallophosphoesterase [Chlorobium phaeobacteroides BS1]
          Length = 286

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 50/296 (16%), Positives = 96/296 (32%), Gaps = 65/296 (21%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           MT++Y      LAH SD+HL+                      R         + L+  I
Sbjct: 1   MTEKY----LKLAHFSDLHLA---------------------GRTARRQLGYLDELLTAI 35

Query: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRS--IGNPHDISIVPGNHD-------AYIS 111
           + +   H+ ITGD+VN     +       L+   +     ++++PGNHD         + 
Sbjct: 36  VNNGCSHIVITGDLVNSANPADWQVVKDALQKKGLYAWDKVTLIPGNHDLINLEEEIRLY 95

Query: 112 GAK-----------EKSLHAWKDYITSDTTCSTGKKLFPYLRI----RNNIALIGCSTAI 156
            +             + +  +  + +   T       FP++++       ++L+  +T  
Sbjct: 96  NSLNPLGNGRKKRFRRKMREFCRFFSELMTGEEQDTGFPFIKVLKYSDVTLSLVLVNTVS 155

Query: 157 AT----PPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--------PVLDTSSL 204
                  P  A GY    +  A +    +   K  F I + HH          +      
Sbjct: 156 HWMNIENPLGARGYVSPGEFKALATSQVQNAIKDSFVIGVFHHAYNIYGTDSLIDQAFDW 215

Query: 205 YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHS 260
              +   +     +    AD++LHGH H    +        I ++   S +     
Sbjct: 216 TMELRNRRELLVAMKKLNADMLLHGHFHRFQAYTAGG----IRIINGGSFNVNPRR 267


>gi|75907271|ref|YP_321567.1| metallophosphoesterase [Anabaena variabilis ATCC 29413]
 gi|75700996|gb|ABA20672.1| Metallophosphoesterase [Anabaena variabilis ATCC 29413]
          Length = 357

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/281 (15%), Positives = 94/281 (33%), Gaps = 34/281 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H++   + ++           +H       +       IN +   N+D + 
Sbjct: 5   FRFAVVSDLHIALPHTIWD-------HPSRFHLVEVGIPA---FENAINHLTKLNLDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEK--SLHAWKDYITS 127
           + GD+               L  +  P    +VPGNHD  +  A E+  +   +  Y   
Sbjct: 55  LPGDLTQHGEPENHRWLEERLSKLPFP--TYVVPGNHDVPVVMANEQSIACADFPQYYRQ 112

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
               +T +  +   ++   + LIG ++          G    +Q     ++L  A  +  
Sbjct: 113 FGYDNTDQLYY-TQQLLPGVRLIGLNSNFFNEQGQQMGRLDAQQFQWLEEVLAAAVDE-- 169

Query: 188 FRIIMMHHPPV-------LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
             ++M+HH  V           +    +       +++   G  L+  GH H+  +   +
Sbjct: 170 LVLVMVHHNVVEHLPHQSRHPMASRYMLENAPELVRLLQRYGVKLVFTGHLHVQDVACAE 229

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
                  V  I + S   + +     Y +    +  +    
Sbjct: 230 G------VYDITTGSLVSYPHP----YRVLEFHRDQQGQEW 260


>gi|186686614|ref|YP_001869810.1| metallophosphoesterase [Nostoc punctiforme PCC 73102]
 gi|186469066|gb|ACC84867.1| metallophosphoesterase [Nostoc punctiforme PCC 73102]
          Length = 374

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/282 (15%), Positives = 97/282 (34%), Gaps = 34/282 (12%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
            T+ F  A +SD+H++   + ++           +H              ++  +   ++
Sbjct: 1   MTLNFRFAVVSDLHVALPHTIWD-------HPSRFHLVEVSI---SAFQSVLEHLTQLDL 50

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEK--SLHAWKD 123
           D + + GD+               L  +  P  + +VPGNHD  +  A ++  +   +  
Sbjct: 51  DFLLLPGDLTQHGEPENHAWLQQCLAQLPFP--VYVVPGNHDVPVLLADQQSIAFADFPH 108

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           Y T        +  +    +   + LIG ++          G    +Q     ++L  + 
Sbjct: 109 YYTKFGYEDPQQIYYIRQLLPG-VKLIGLNSNYFNDEGEQVGCLDAKQLRWLEEVLAASV 167

Query: 184 KKGFFRIIMMH-----HPPVLDTSSLYNR--MFGIQRFQKMIWHEGADLILHGHTHLNSL 236
            +    ++M+H     H P      L NR  +       +++   G  L+  GH H+  +
Sbjct: 168 DE--LVLVMVHHNVVEHLPNQSNHPLANRYMLSNSAELLQLLRRYGVKLVFTGHLHVQDI 225

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY 278
            +         V  I + S   + +     Y +    + N+ 
Sbjct: 226 AYSDG------VYDITTGSLVSYPHP----YRVLEFHRDNQG 257


>gi|319761882|ref|YP_004125819.1| metallophosphoesterase [Alicycliphilus denitrificans BC]
 gi|330826266|ref|YP_004389569.1| metallophosphoesterase [Alicycliphilus denitrificans K601]
 gi|317116443|gb|ADU98931.1| metallophosphoesterase [Alicycliphilus denitrificans BC]
 gi|329311638|gb|AEB86053.1| metallophosphoesterase [Alicycliphilus denitrificans K601]
          Length = 279

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 46/241 (19%), Positives = 84/241 (34%), Gaps = 33/241 (13%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +T    L  I+D+H+            R  G + +       + +   + ++   L    
Sbjct: 3   STPYTFLVQITDLHI------------REPGRLAYGRIDTAPYLRRTVDSVLA--LRQKP 48

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D V ITGD+ +F    E       L  +G+   + ++PGNHD      +  + HA+    
Sbjct: 49  DAVVITGDLSDFGREAEYAHLAGLLAPLGD-LPVYLLPGNHDERAQLRRSFARHAY---- 103

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                   G +   Y      + LI   T     P  ++G    ++     + L     +
Sbjct: 104 -----LQGGGEFVQYSVRVGPLRLIALDT---VEPGQSHGTLCAQRLAWLERELAACRDE 155

Query: 186 GFFRIIMMHHPPVLDTSSLYNR---MFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKN 241
               +I MHHPP        +R   + G  +F+ ++      + I+ GH H         
Sbjct: 156 PV--VIAMHHPPFRTLIGHMDRIGLLEGAAQFEAIVARHANVERIICGHLHRAIDVRFGG 213

Query: 242 E 242
            
Sbjct: 214 T 214


>gi|167562280|ref|ZP_02355196.1| Ser/Thr protein phosphatase family protein [Burkholderia
           oklahomensis EO147]
          Length = 274

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 79/237 (33%), Gaps = 36/237 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           +LAHISD+H+           KR  G++ +               L  + L    D V +
Sbjct: 2   LLAHISDLHI-----------KRP-GMLAYKRVDTAAHFARCVARL--NALEPRPDAVLV 47

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ +F  + E       L  +  P+ + +  GNHD     A  ++  A  +    +  
Sbjct: 48  TGDLTDFGDDEEYAHLKSLLAPLEIPYYLLV--GNHD--DRAALRRAFPARAELRAGEFV 103

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                    Y      + +I   + I   P ++ G     +    +  L  A  +    I
Sbjct: 104 Q--------YALDLGPLRVIALDSQI---PGASGGTLCDARLAWLAGQLDAARDRPV--I 150

Query: 191 IMMHHPPVLDTSSLYNRMF----GIQRFQKMIWH-EGADLILHGHTHLNSLHWIKNE 242
           + +HHPP        + M        R   ++      + +L GH H          
Sbjct: 151 VALHHPPFACGIGHMDAMRLDPDASGRLDALLRRFPNVERVLCGHVHRTMFARFGGT 207


>gi|226356788|ref|YP_002786528.1| metallophosphoesterase; cAMP phosphodiesterase [Deinococcus deserti
           VCD115]
 gi|226318778|gb|ACO46774.1| putative Metallophosphoesterase; putative cAMP phosphodiesterase
           [Deinococcus deserti VCD115]
          Length = 267

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 75/237 (31%), Gaps = 43/237 (18%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHV 68
           ++A +SD H+   P                        +       ++ +L      D V
Sbjct: 2   LIAQLSDPHVMAEP---------------------DDQAAHALRRAVSHLLELPVLPDLV 40

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD        E  T    ++ +  P  + +VPGNHD   +                 
Sbjct: 41  LITGDCTEHGEVAEYETFRTLIQPL--PMPVYVVPGNHDQRAAMLSA----------LGR 88

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 +    Y+     + LIG  T +   P    G     +       L +A  +   
Sbjct: 89  PGTLGLEGFMQYVVEAGPLRLIGLDTHL---PGQDAGELCAARLDWLEDRLTEAPGRPC- 144

Query: 189 RIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
            +I MHHPP   + ++ +   +   Q F+ ++      + +L GH H+         
Sbjct: 145 -VIFMHHPPARSSLNVMDGIGLRDPQAFEALLARHSNVERVLTGHLHMAMTRRCGGT 200


>gi|172035705|ref|YP_001802206.1| hypothetical protein cce_0789 [Cyanothece sp. ATCC 51142]
 gi|171697159|gb|ACB50140.1| hypothetical protein cce_0789 [Cyanothece sp. ATCC 51142]
          Length = 365

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 48/283 (16%), Positives = 96/283 (33%), Gaps = 41/283 (14%)

Query: 8   IMFVLAHISDIHLSYS---PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           + F  A ISD H++     P+         + ++                 ++N +   N
Sbjct: 2   MNFRFAIISDPHVAVPHTIPNHSHRFHLVEVSIL-------------ALEKVLNHLEQLN 48

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRS--IGNPHDISIVPGNHDAYISGAKEKSLHAWK 122
           +D + + GD+     + E+     WL       P  + +VPGNHD       E  +   +
Sbjct: 49  LDFLLLPGDLTQ---DGEMDN-HEWLAKRLQSLPFPVFVVPGNHDVPNLNETETKIGLSQ 104

Query: 123 DYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
                       ++L+    I   + +IG ++          GY  ++Q     KLL + 
Sbjct: 105 FPSYYSHCGYESQQLYYTQEILPGVRIIGLNSNHFDEEGRQLGYLDKQQLTWLEKLLPQV 164

Query: 183 NKKGFFRIIMMH-----HPPVLDTSSLYNR--MFGIQRFQKMIWHEGADLILHGHTHLNS 235
             +    ++M+H     H P      L  R  +       K++      LI  GH H+  
Sbjct: 165 KDQLL--LVMIHHNIIEHLPEQSNHELGKRYMLDNASLLLKLLRSANCQLIFTGHLHVQD 222

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY 278
           +   +       +  I + S   + +     Y +  +++    
Sbjct: 223 IACHQG------IYEITTGSLVSYPHP----YRIIEVKRPPNG 255


>gi|167569518|ref|ZP_02362392.1| Ser/Thr protein phosphatase family protein [Burkholderia
           oklahomensis C6786]
          Length = 274

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 79/237 (33%), Gaps = 36/237 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           +LAHISD+H+           KR  G++ +               L  + L    D V +
Sbjct: 2   LLAHISDLHI-----------KRP-GMLAYKRVDTAAHFARCVARL--NALEPRPDAVLV 47

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ +F  + E       L  +  P+ + +  GNHD     A  ++  A  +    +  
Sbjct: 48  TGDLTDFGDDEEYAHLKSLLAPLEIPYYLLV--GNHD--DRAALRRAFPARAELRAGEFV 103

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                    Y      + +I   + I   P ++ G     +    +  L  A  +    I
Sbjct: 104 Q--------YALDLGPLRVIALDSQI---PGASGGTLCDARLAWLAGQLDAARDRPV--I 150

Query: 191 IMMHHPPVLDTSSLYNRMF----GIQRFQKMIWH-EGADLILHGHTHLNSLHWIKNE 242
           + +HHPP        + M        R   ++      + +L GH H          
Sbjct: 151 VALHHPPFACGIGHMDAMRLDPDASGRLDALLRRFPNVERVLCGHVHRTMFARFGGT 207


>gi|119510715|ref|ZP_01629843.1| hypothetical protein N9414_22123 [Nodularia spumigena CCY9414]
 gi|119464669|gb|EAW45578.1| hypothetical protein N9414_22123 [Nodularia spumigena CCY9414]
          Length = 376

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 83/233 (35%), Gaps = 24/233 (10%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H++   + ++           +H       +       I  +   N+D + 
Sbjct: 5   FRFAVVSDLHIALPHTIWD-------HPSRFHLVEVSIPA---FESAIEHLTQLNLDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKS--LHAWKDYITS 127
           + GD+   +           L  +  P    +VPGNHD  +  A E+S     +  Y   
Sbjct: 55  LPGDLTQHSEPENHLWLQERLAKLPFP--TYVVPGNHDVPVVIANEQSIGFADFPHYYRK 112

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
               +  +  +   ++   + LIG ++          G    EQ     ++L  A  +  
Sbjct: 113 FGYENPQQLYY-THQLLPGVRLIGLNSNFFNEDGEQVGRLDAEQLKWLEEVLAAAGDE-- 169

Query: 188 FRIIMMH-----HPPVLDTSSLYNR--MFGIQRFQKMIWHEGADLILHGHTHL 233
             ++M+H     H P      L  R  +    +  +++   G  L+  GH H+
Sbjct: 170 LVLVMVHHNVVEHLPEQSRHPLGKRYMLENSAQLLEILRRYGVKLVFTGHLHI 222


>gi|116621954|ref|YP_824110.1| metallophosphoesterase [Candidatus Solibacter usitatus Ellin6076]
 gi|116225116|gb|ABJ83825.1| metallophosphoesterase [Candidatus Solibacter usitatus Ellin6076]
          Length = 664

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 55/349 (15%), Positives = 103/349 (29%), Gaps = 82/349 (23%)

Query: 4   RYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           R       + H+SD+H            +R++G                    +  I   
Sbjct: 7   RALGSQVRILHLSDLHSRGDRESETWRRRRVLG--------------PPWERNLETIRED 52

Query: 64  NV-DHVSITGDIVNFTCNREIFTSTHW----LRSIGNP-HDISIVPGNHDAY---ISGAK 114
              D V  TGD  ++    E   ++ +    L  +  P     ++PGNHD       GA 
Sbjct: 53  GPIDLVFFTGDAADWGLPNEFTAASDFFLSILDKLKVPRERFFVIPGNHDVRRDVEPGAW 112

Query: 115 E----------------------------------KSLHAWKDYITSDTTCSTGKKLFPY 140
           +                                  + L   + Y    +      +L P 
Sbjct: 113 QKMRALLGSANDPLDVARWAAGGRPPFGAEADLLDRVLERLQPYSEWVSNSLGRPELAPR 172

Query: 141 -----------LRIRNNIALIGCSTAIATPPFSANGYF--GQEQAHATSKLLRKANKKGF 187
                      L +   + +IG +TA      S  G      +Q        R    +G 
Sbjct: 173 KGTLGFHSELDLGLGYPVHIIGLNTAWMCGDDSDAGKLWALDDQLMRLVSDARGGPLQGL 232

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            RI++MHHP        ++++      + ++     DL+L GH H   +    +    I 
Sbjct: 233 -RILLMHHP--------FDQLADGAECRALLA-GRVDLVLRGHLHKEEVGTWSDPGNTIR 282

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYW--TLEGKRYTLSPDSLS 294
            +      +   ++    S ++  I+         ++ +    SP S  
Sbjct: 283 QLAAGCLYEGWRADYWPNSCHVLGIDSSPAGQPHRIQLRFRAFSPHSGQ 331


>gi|119356431|ref|YP_911075.1| metallophosphoesterase [Chlorobium phaeobacteroides DSM 266]
 gi|119353780|gb|ABL64651.1| metallophosphoesterase [Chlorobium phaeobacteroides DSM 266]
          Length = 288

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 40/261 (15%), Positives = 79/261 (30%), Gaps = 58/261 (22%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +AHISD+HL+                      R      +  + ++       VDH+ 
Sbjct: 6   IKIAHISDLHLA---------------------GRNDRRLLQYLDGMLEHFKKVKVDHLI 44

Query: 70  ITGDIVNFTCNREIFTSTHWL--RSIGNPHDISIVPGNHDA---------YIS------- 111
           I+GD+ +    ++       L    +     ++++ GNHD          Y         
Sbjct: 45  ISGDLTDTAEPKDWQILKDRLIAHDLYEWQKVTVIAGNHDLINLEEEMRFYNVLNPLPGI 104

Query: 112 ------GAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRN-NIALIGCSTAIATP----P 160
                 G   +    + + I S+     G      L++   + AL+  ++         P
Sbjct: 105 RNRSFSGKVSRFCTMFSELIVSEDASVAGFPFVKILKVDGFSFALVAVNSVWPWHPADNP 164

Query: 161 FSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP--------PVLDTSSLYNRMFGIQ 212
             A G     +             +  F + + HH          +         +    
Sbjct: 165 LGARGCISPSELRVLRIPDVVDVLRESFVVGLCHHAYKVYSTESVIDQAFDWTMELTNRN 224

Query: 213 RFQKMIWHEGADLILHGHTHL 233
            + +++   GA + LHGH H 
Sbjct: 225 EYLEVLKLLGARIALHGHFHR 245


>gi|120612111|ref|YP_971789.1| metallophosphoesterase [Acidovorax citrulli AAC00-1]
 gi|120590575|gb|ABM34015.1| metallophosphoesterase [Acidovorax citrulli AAC00-1]
          Length = 285

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 42/246 (17%), Positives = 83/246 (33%), Gaps = 34/246 (13%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           T    +L  +SD+H+            R  G + +       + ++    ++   +    
Sbjct: 9   TAPTTLLLQLSDLHI------------REPGRLAYGRLDTAPYLRQAVETVLR--MPQRP 54

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D +  TGD+ +F    E       L  +G    + ++PGNHD     A+ ++      Y+
Sbjct: 55  DAIVATGDLTDFGRPEEYGHLRKLLAPLGAI-PLYLLPGNHD---DRAQLRASFPGHGYL 110

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            +D        +         + LI   T +   P ++ G    E+    +  L     +
Sbjct: 111 GTDGFVQFSVSV-------GGLQLIALDTVV---PGASEGSLCAERLEWLAAQLD--ASR 158

Query: 186 GFFRIIMMHHPPVL---DTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
           G   +I MHHPP             + G Q  + ++      + ++ GH H +       
Sbjct: 159 GRPVVIAMHHPPFRTLIGHMDEIGLLEGAQALEALVARHPNVERVICGHLHRSIQVRFGG 218

Query: 242 EKKLIP 247
                 
Sbjct: 219 TIAATV 224


>gi|288871144|ref|ZP_06410033.1| serine/threonine protein phosphatase family protein [Clostridium
           hathewayi DSM 13479]
 gi|288864633|gb|EFC96931.1| serine/threonine protein phosphatase family protein [Clostridium
           hathewayi DSM 13479]
          Length = 457

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 45/330 (13%), Positives = 105/330 (31%), Gaps = 49/330 (14%)

Query: 6   TTIMFVLAHISDIH-LSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
            T  F +   +D+H LS   + +     R+    +    +   ++ E+ +  + D+    
Sbjct: 55  ETSSFTIVTATDLHYLSPELTDYGTGFMRMAANGD---GKLVQYAPEIVDAFVTDMAKLR 111

Query: 65  VDHVSITGDIV---NFTCNREIFTSTHWLRSIGNPHDISIVPGNHDA-YISGAK------ 114
            D V ++GD+        + E+      L+  G P  + ++PGNHD  Y   A       
Sbjct: 112 PDAVILSGDLSFNGEKASHEELAEKLSCLQEQGIP--VLVLPGNHDISYPFAASFEAETV 169

Query: 115 --------EKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGY 166
                    +    +K     D   + G  L    ++   + ++         P    G 
Sbjct: 170 TRTERVNGVEFRDLYKQLGYRDAAETDGDSLSFLYQLSERVWILLLDANTEDAP----GR 225

Query: 167 FGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEGAD 224
                     + + +A + G   I + H   +     L     +   +  ++++   G  
Sbjct: 226 IKDSTLQWAERQMERAEEAGAAVITVTHQNVLAQNKLLSRGFLLDNHEELERLLKGHGVV 285

Query: 225 LILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN-------- 276
           L + GH H+  +     E   +  +   S +           Y +  +            
Sbjct: 286 LNVSGHVHIQHI----AENGGLYDIATGSLTVAP------NRYGVLTVGSDGSTSYETRK 335

Query: 277 -EYWTLEGKRYTLSPDSLSIQKDYSDIFYD 305
                 + ++  ++ D  + ++     F +
Sbjct: 336 VHVGRWDREKTGIAGDFENFEELSQAYFDE 365


>gi|289523113|ref|ZP_06439967.1| alkaline phosphatase [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503656|gb|EFD24820.1| alkaline phosphatase [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 750

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 39/225 (17%), Positives = 80/225 (35%), Gaps = 25/225 (11%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI-LLHNVDHVSITGD 73
           +SD+HL+ +        K              ++++++    I++I    +VD V + GD
Sbjct: 455 LSDLHLALNEPENTW--KMF------------HYNQDILAWAIDEINKRQDVDFVLVPGD 500

Query: 74  IVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA--WKDYITSDTTC 131
           +   +      +    L  +  P    ++PGNHD       + +     +  Y       
Sbjct: 501 LTKDSEPYNHRSVKAMLDKLNVP--YYVIPGNHDVKKDWMPQGNFGVVDFARYYEGHGYD 558

Query: 132 STGKKLFPYLRIRNNIALIGCSTA-IATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            +G+  +    +   + LIG  +A       S  G    EQ     + L      G   I
Sbjct: 559 GSGRSWYSVDPVSG-LHLIGLDSASHPKFSNSWGGAVADEQIKWLEQDL--MANSGKEVI 615

Query: 191 IMMHHPPVL--DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
           +M+HH  +         N +      ++++       ++ GH H+
Sbjct: 616 VMVHHALIKHEGKDDPRNYVENADAVKEILRKYRIKTVITGHLHV 660


>gi|284050230|ref|ZP_06380440.1| hypothetical protein AplaP_02015 [Arthrospira platensis str.
           Paraca]
 gi|291570724|dbj|BAI92996.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 363

 Score =  102 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 52/293 (17%), Positives = 108/293 (36%), Gaps = 37/293 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A  SD+H++   + ++  PKR   LV          S      +   +   ++D + 
Sbjct: 5   FRFAIASDLHIALPDTIWD-HPKRF-HLV--------EVSIAALEQVFEHLERLDIDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKS--LHAWKDYITS 127
           + GD+            +  L+++  P    +VPGNHD  ++  +     L  + +Y   
Sbjct: 55  LPGDLTQHGERDNHAWLSDRLKNLPYPA--YVVPGNHDVPLAVGEGSLIGLSEFPEYYPH 112

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                     +    +R+ + LIG ++       +  GY  ++Q      +L K+  +  
Sbjct: 113 CGYQDRSCLYY-TCELRSGVRLIGLNSNGFDEQGNQIGYVDEKQLDWLRDVLAKSTDE-- 169

Query: 188 FRIIMMHH-----PPVLDTSSLYNR--MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
             ++M+HH      P   T+ L  R  +    +  +++   G  L+  GH H+  +   +
Sbjct: 170 LVLVMIHHNIIEHLPGQSTNPLGRRYMLSNAPQLLEVLERGGVQLVFTGHLHVQDIAKWR 229

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYW---TLEGKRYTLSP 290
                  V  I + S   + +     Y +    + ++      +E  R    P
Sbjct: 230 G------VYDITTGSLVSYPHP----YRILNFSRDDQGQQRLEIESHRIVSVP 272


>gi|229591016|ref|YP_002873135.1| putative cAMP phosphodiesterase [Pseudomonas fluorescens SBW25]
 gi|229362882|emb|CAY49792.1| putative cAMP phosphodiesterase [Pseudomonas fluorescens SBW25]
          Length = 277

 Score =  102 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 44/243 (18%), Positives = 83/243 (34%), Gaps = 38/243 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRII-GLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           F++A ISD+HL         + +R+  G+V+                 ++ +       D
Sbjct: 5   FLVAQISDLHLK--------AGQRLTYGVVDTL---------GALRRAVDHLNASHPRPD 47

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V I+GD+V+F    E       L  +  P    +VPGNHD      +    H +     
Sbjct: 48  IVVISGDLVDFGRADEYAVLHPELARLQMP--CYLVPGNHDTRGPLLEAFRDHPYLP--- 102

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                ++      ++   + + LIG  +   T P    G     Q     + L       
Sbjct: 103 -----ASADGPLDWVVDDHPLRLIGLDS---TIPGGHGGQLLDSQLQWLDEQLALRPHAP 154

Query: 187 FFRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
              ++++HHPP +      +R         ++++      + +L GH H           
Sbjct: 155 --TLLILHHPPFISGIGHMDREPFINAAALEQVVARHPQVERLLCGHLHRPMQRRFGGSV 212

Query: 244 KLI 246
             +
Sbjct: 213 SCV 215


>gi|322834175|ref|YP_004214202.1| metallophosphoesterase [Rahnella sp. Y9602]
 gi|321169376|gb|ADW75075.1| metallophosphoesterase [Rahnella sp. Y9602]
          Length = 275

 Score =  102 bits (254), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 64/273 (23%), Positives = 98/273 (35%), Gaps = 53/273 (19%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           MF LA ISD+H             R  G   + F      + EV + L  + L    D V
Sbjct: 1   MF-LAQISDMHF------------RSHGRKLYDFIDVNGCNAEVVSQL--NALEEQPDAV 45

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGDIVN    +E   +   L ++  P  + I+PGNHD        ++LH     + +D
Sbjct: 46  VITGDIVNCGLPQEYEVARRTLGNLRYP--LFIIPGNHD--DKAQFLEALHPLCPQLGTD 101

Query: 129 TTC-STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                     FP +R      L+   +++A     + GY   E        L +   K  
Sbjct: 102 PQNMRYAIDDFP-MR------LLFVDSSLAGE---SKGYLTLETLAWLEGQLEQGGDKPT 151

Query: 188 FRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADL-ILHGHTHL--------NSL 236
              + MHHPPV   S+  + +      +   +I    + + +  GHTH           +
Sbjct: 152 A--VFMHHPPVKVGSAQMDAISCENGDQLLALIDRFPSLVRVFCGHTHRLIFTQYKQAII 209

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNKPQASYNL 269
             I      +P             + P   YNL
Sbjct: 210 TTIPGTVHQVPYY----------HHNPAPFYNL 232


>gi|170744696|ref|YP_001773351.1| metallophosphoesterase [Methylobacterium sp. 4-46]
 gi|168198970|gb|ACA20917.1| metallophosphoesterase [Methylobacterium sp. 4-46]
          Length = 275

 Score =  102 bits (254), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 76/240 (31%), Gaps = 34/240 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           ++A I+D+HL                   +         +   + L +  L    D V +
Sbjct: 2   LIAQITDLHLRPRGRPA------------YRVAETNMLVERAVDALAS--LQPRPDVVLV 47

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ +     E   +         P  + +VPGNHD      +     AW         
Sbjct: 48  TGDLTDCGLPEEY--ALLRGLLGRLPLPVFVVPGNHDRRE-ALRAALPAAWLP------- 97

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               ++   Y+     + LIG  T +A     ++G     +     + L     +    +
Sbjct: 98  -GAMEEFVQYVVDDWPVRLIGLDTLVAGA---SHGALCARRLAFLEEALAAGGDRP--TL 151

Query: 191 IMMHHPPVL---DTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           + +HHPP     +       + G  R + +I      + IL GH H             +
Sbjct: 152 VFLHHPPFACGMEGMDRIRLLDGEPRLRALIEAHPNVERILCGHHHRPIQVRYAGTIAQV 211


>gi|254188310|ref|ZP_04894821.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|157935989|gb|EDO91659.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei Pasteur 52237]
          Length = 274

 Score =  101 bits (253), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 46/260 (17%), Positives = 83/260 (31%), Gaps = 36/260 (13%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
           +LAHISD+H+           KR  G + +               L  + L    D V +
Sbjct: 2   LLAHISDLHI-----------KRP-GALAYRRVDTAAHLARCVARL--NALEPRPDAVLV 47

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ +F  + E       L  +  P+ + +  GNHD     A  ++  A  +  + +  
Sbjct: 48  TGDLTDFGDDDEYAHLKALLAPLAMPYYLLV--GNHD--DRAALRRAFPARVELQSGEFV 103

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                    Y      + +I   + I   P ++ G     +    +  L  A  +    I
Sbjct: 104 Q--------YALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDRPV--I 150

Query: 191 IMMHHPPVLDTSSLYNRMF----GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
           + +HHPP        + M        R   ++      + +L GH H             
Sbjct: 151 VALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGGTIAS 210

Query: 246 IPVVGIASASQKVHSNKPQA 265
                    +  +    P +
Sbjct: 211 AVPAPAHQVTFDLRDGGPSS 230


>gi|295090670|emb|CBK76777.1| Predicted phosphohydrolases [Clostridium cf. saccharolyticum K10]
          Length = 496

 Score =  101 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/258 (17%), Positives = 88/258 (34%), Gaps = 34/258 (13%)

Query: 16  SDIHLSYSPSFFELSPKRIIGLVNWHFN---RKKYFSKEVANLLINDILLHNVDHVSITG 72
           +D+H        EL+ KR    V   +    R   +  EV +  + D+     D V ++G
Sbjct: 96  TDMHYLAE----ELAGKRCQSFVQMTYGSDGRVLLYGWEVMDAFVEDMKEKRPDLVVLSG 151

Query: 73  DIVNFTCNREIFTSTHWLRSI-GNPHDISIVPGNHDAYISGAK---------------EK 116
           D+               LR +      + +VPGNHD     A+               E+
Sbjct: 152 DLTLNGERASHEELASILRELDEEDIPVLVVPGNHDINNPNARRFSGTQSYLVESVSPEE 211

Query: 117 SLHAWKD--YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHA 174
               + D  Y+ +D+   +        ++ +++ L+   +    P     G         
Sbjct: 212 FADIYADFGYVAADSRDPSSLSYL--YKVDDSLWLLMLDS