PSIBLAST alignment of GI: 255764495 and protein with PDB id: 1ute

>gi|6137386|pdb|1UTE|A Chain A, Pig Purple Acid Phosphatase Complexed With Phosphate Length = 313
 Score = 64.6 bits (155), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 36/274 (13%), Positives = 79/274 (28%), Gaps = 27/274 (9%)

Query: 22  YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIV-----N 76
            +P    ++     G+ N  F+  +  +      +   +     D +   GD       +
Sbjct: 3   PTPILRFVAVGDWGGVPNAPFHTAREMANA--KAIATTVKTLGADFILSLGDNFYFTGVH 60

Query: 77  FTCNREIFTSTH--WLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
              ++    +    +           ++ GNHD   + + + +          +      
Sbjct: 61  DAKDKRFQETFEDVFSDPSLRNVPWHVLAGNHDHLGNVSAQIAYSKISK--RWNFPSPYY 118

Query: 135 KKLFPYLRIRNNIALIGCSTAI----------ATPPFSANGYFGQEQAHATSKLLRKANK 184
           +  F   R   ++A+    T              P    N    + Q     K L  A +
Sbjct: 119 RLRFKIPRSNVSVAIFMLDTVTLCGNSDDFVSQQPERPRNLALARTQLAWIKKQLAAAKE 178

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
                +++  H PV   +        +++   ++        L GH H       +N   
Sbjct: 179 D---YVLVAGHYPVWSIAEHGPTHCLVKQLLPLLTTHKVTAYLCGHDHNLQYLQDENGLG 235

Query: 245 LIPVVGIASA--SQKVHSNKPQASYNLFYIEKKN 276
            + + G  +     K H  K    Y  F+   +N
Sbjct: 236 FV-LSGAGNFMDPSKKHLRKVPNGYLRFHFGAEN 268