PSIBLAST alignment of GI: 255764495 and protein with PDB id: 2hyp

>gi|122920487|pdb|2HYP|A Chain A, Crystal Structure Of Rv0805 D66a Mutant Length = 280
 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/281 (14%), Positives = 76/281 (27%), Gaps = 52/281 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           +VL HISD HL                +           + +    L+  +       D 
Sbjct: 16  YVLLHISDTHL----------------IGGDRRLYGAVDADDRLGELLEQLNQSGLRPDA 59

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYI 125
           +  TGD+               +          +  V GNHD               +  
Sbjct: 60  IVFTGDLAAKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDR------------AELR 107

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 +        + + + + +I   T++   P   +G     Q    ++ L      
Sbjct: 108 KFLLDEAPSMAPLDRVCMIDGLRIIVLDTSV---PGHHHGEIRASQLGWLAEELATPAPD 164

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           G   I+ +HHPP+     +   +         +++       IL GH H ++        
Sbjct: 165 GT--ILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVG-- 220

Query: 244 KLIPVVGIASASQK---------VHSNKPQASYNLFYIEKK 275
             IPV   ++                       NL ++   
Sbjct: 221 --IPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPD 259