PSIBLAST alignment of GI: 255764495 and protein with PDB id: 2q8u

>gi|151567968|pdb|2Q8U|A Chain A, Crystal Structure Of Mre11 From Thermotoga Maritima Msb8 (Tm1635) At 2.20 A Resolution Length = 336
>gi|151567969|pdb|2Q8U|B Chain B, Crystal Structure Of Mre11 From Thermotoga Maritima Msb8 (Tm1635) At 2.20 A Resolution Length = 336
 Score = 67.7 bits (163), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 38/228 (16%), Positives = 69/228 (30%), Gaps = 21/228 (9%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + H SD HL             +    +     ++   K+  + ++ +     VD + 
Sbjct: 19  LKILHTSDWHLG------------VTSWTSSRPVDRREELKKALDKVVEEAEKREVDLIL 66

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNP---HDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           +TGD+++   N  +      L  +        + ++PGNHD        K    +   I+
Sbjct: 67  LTGDLLHSRNNPSVVALHDLLDYLKRXXRTAPVVVLPGNHDW----KGLKLFGNFVTSIS 122

Query: 127 SDTTCSTGKKLFPYLRIRNN-IALIGCSTAIAT-PPFSANGYFGQEQAHATSKLLRKANK 184
           SD T     +       R   + ++       +       G F        +KL  +A K
Sbjct: 123 SDITFVXSFEPVDVEAKRGQKVRILPFPYPDESEALRKNEGDFRFFLESRLNKLYEEALK 182

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
           K  F I   H                     + +     D    GH H
Sbjct: 183 KEDFAIFXGHFTVEGLAGYAGIEQGREIIINRALIPSVVDYAALGHIH 230