PSIBLAST alignment of GI: 255764495 and protein with PDB id: 2xmo

>gi|323714329|pdb|2XMO|A Chain A, The Crystal Structure Of Lmo2642 Length = 443
>gi|323714330|pdb|2XMO|B Chain B, The Crystal Structure Of Lmo2642 Length = 443
 Score = 82.3 bits (201), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 50/319 (15%), Positives = 93/319 (29%), Gaps = 26/319 (8%)

Query: 13  AHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITG 72
              +D+H          + K     V     ++  +S E+ +  + D+     D + I+G
Sbjct: 43  VVTTDVHYFAP--SLTDNGKAFEKYVAAGDGKQLAYSDEITDAFLADVESKKTDVLIISG 100

Query: 73  DIVNFTCNREIFT-STHWLRSIGNPHDISIVPGNHDAYISGAKE---------------K 116
           D+ N          +    +   N   + +VPGNHD     A++                
Sbjct: 101 DLTNNGEKTSHEELAKKLTQVEKNGTQVFVVPGNHDINNPWARKFEKDKQLPTDTISPTD 160

Query: 117 SLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA-----NGYFGQEQ 171
               + D+   D   S    L       + + L+   TAI             G      
Sbjct: 161 FSKIYSDFGYEDAISSDEFSLSYLAAPSSKVWLLMLDTAIYKTNMQQGNPTTEGGLTAGT 220

Query: 172 AHATSKLLRKANKKGFFRIIMMHHPPVLDTS--SLYNRMFGIQRFQKMIWHEGADLILHG 229
                +    A K G   I ++HH              +   Q+    +     D  L G
Sbjct: 221 LDWIKESSALAKKNGAKLIPVLHHNLTDHNDVIQKGYTINYNQQVIDALTEGAMDFSLSG 280

Query: 230 HTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
           H H  ++   K+         + +A           +Y+        +   L+ + +  +
Sbjct: 281 HIHTQNIRSAKSTDGKEITDIVTNALSVFPHKYGNITYSAKNKNFTYQSQKLDMEAWAKA 340

Query: 290 PDSLSIQKDYSDIF-YDTL 307
             S        D F Y+T 
Sbjct: 341 QGSTDENLLNFDQFDYETF 359