PSIBLAST alignment of GI: 255764495 and protein with PDB id: 3dsd

>gi|209447466|pdb|3DSD|A Chain A, Crystal Structure Of P. Furiosus Mre11-H85s Bound To A Branched Dna And Manganese Length = 349
>gi|209447467|pdb|3DSD|B Chain B, Crystal Structure Of P. Furiosus Mre11-H85s Bound To A Branched Dna And Manganese Length = 349
 Score = 60.8 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 39/248 (15%), Positives = 67/248 (27%), Gaps = 27/248 (10%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
              AH++DIHL                   +H  +++    E     +   +  NVD + 
Sbjct: 1   MKFAHLADIHLG---------------YEQFHKPQREEEFAEAFKNALEIAVQENVDFIL 45

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNP----HDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           I GD+ + +      T    +  +  P      +  + GN D    G    +L      +
Sbjct: 46  IAGDLFHSSRP-SPGTLKKAIALLQIPKEHSIPVFAIEGNSDRTQRGPSVLNLLEDFGLV 104

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                     +       R                     Y       A  ++L++   +
Sbjct: 105 YVIGMRKEKVENEYLTSERLGNGEYLVKGVYKDLEIHGMKYMSSAWFEANKEILKRLF-R 163

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
                I+M H  V + S      +       +   EG      GH H             
Sbjct: 164 PTDNAILMLHQGVREVSEARGEDYFEIGLGDL--PEGYLYYALGHIHKRYETSYSGS--- 218

Query: 246 IPVVGIAS 253
            PVV   S
Sbjct: 219 -PVVYPGS 225