BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764495|ref|YP_003065022.2| putative phosphoesterase
protein [Candidatus Liberibacter asiaticus str. psy62]
         (309 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|255764495|ref|YP_003065022.2| putative phosphoesterase protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254547846|gb|ACT57082.2| putative phosphoesterase protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 309

 Score =  252 bits (644), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 309/309 (100%), Positives = 309/309 (100%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI
Sbjct: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60

Query: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
           LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA
Sbjct: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
           WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR
Sbjct: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
           KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK
Sbjct: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
           NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS
Sbjct: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300

Query: 301 DIFYDTLVL 309
           DIFYDTLVL
Sbjct: 301 DIFYDTLVL 309


>gi|254500795|ref|ZP_05112946.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
 gi|222436866|gb|EEE43545.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
          Length = 308

 Score =  247 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 105/303 (34%), Positives = 163/303 (53%), Gaps = 8/303 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH+SD HL     P   +L  KR++G +NW  NR K         LI D+     D
Sbjct: 1   MFKLAHLSDPHLGPLPDPKLLQLFSKRLLGYLNWQRNRSKIMGGNHLEQLIEDMKAQAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WL  +G P  +S+VPGNHDAY+ GA +K+  AW  Y+ 
Sbjct: 61  HIAVTGDLVNIALPLEISGARAWLDELGAPDQVSVVPGNHDAYVRGAVKKARTAWWPYMR 120

Query: 127 SDTTCSTGKK------LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
            D       +       FPY+R R +IA+IG +T  AT P+ A+G  G +Q      +L 
Sbjct: 121 GDGEDDVPSEKVGSEATFPYVRKRGDIAIIGVTTGRATAPWFASGRVGTKQTRRLRAILE 180

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
           +  ++  FR++++HHPP  + +  + R+    R + ++   GA+LILHGHTH++S   I+
Sbjct: 181 ELAEEKLFRVVLIHHPPFKNATKWHKRLSDASRLRTVVKRAGAELILHGHTHIDSFENIE 240

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
                +PV+G+ SA+     +KP A YNLF I ++N+ WT + + +        ++    
Sbjct: 241 GPNGPVPVIGVPSATSAPGGHKPAARYNLFSIARENDGWTCQMEEHGYDESGGPVKPLSQ 300

Query: 301 DIF 303
              
Sbjct: 301 RDI 303


>gi|153008931|ref|YP_001370146.1| metallophosphoesterase [Ochrobactrum anthropi ATCC 49188]
 gi|151560819|gb|ABS14317.1| metallophosphoesterase [Ochrobactrum anthropi ATCC 49188]
          Length = 303

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 129/302 (42%), Positives = 186/302 (61%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
            +MF LAHISDIHLS  P   + EL+ KRI G +NW  NRK      V + LI+D+    
Sbjct: 2   GLMFRLAHISDIHLSPLPRVRYRELASKRITGYINWLRNRKNAMHGTVLDTLIDDMQAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL  +G+P D+S+VPGNHDAY+ GA +KS   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLSKLGSPDDVSVVPGNHDAYVPGALDKSCRKWEPW 121

Query: 125 ITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   +   +  FPY+R+R  +ALIG S+A AT PF A+G F  EQ    + +L +A 
Sbjct: 122 MRGDGIDNKDNRPQFPYMRVRGPVALIGVSSARATAPFMASGDFRSEQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FRI+M+HHPP+   +  + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRIVMIHHPPIYGATPAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPN 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY-WTLEGKRYTLSPDSLSIQKDYSDI 302
             IPV+ + SASQ    +KP A YN+F I+K+ +  W+   + + +S  S  I K    +
Sbjct: 242 GKIPVISVPSASQNFGGHKPAARYNIFNIDKRPDGSWSCLMEEHGVSDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|306844563|ref|ZP_07477152.1| phosphohydrolase, Icc family protein [Brucella sp. BO1]
 gi|306275174|gb|EFM56930.1| phosphohydrolase, Icc family protein [Brucella sp. BO1]
          Length = 303

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 129/302 (42%), Positives = 184/302 (60%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADLLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGKRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACTMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|148559695|ref|YP_001259438.1| hypothetical protein BOV_1512 [Brucella ovis ATCC 25840]
 gi|148370952|gb|ABQ60931.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 303

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 128/302 (42%), Positives = 184/302 (60%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVYGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|265984605|ref|ZP_06097340.1| metallophosphoesterase [Brucella sp. 83/13]
 gi|306837914|ref|ZP_07470774.1| phosphohydrolase, Icc family protein [Brucella sp. NF 2653]
 gi|264663197|gb|EEZ33458.1| metallophosphoesterase [Brucella sp. 83/13]
 gi|306407002|gb|EFM63221.1| phosphohydrolase, Icc family protein [Brucella sp. NF 2653]
          Length = 303

 Score =  236 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 129/302 (42%), Positives = 184/302 (60%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGKRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNADGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|307944145|ref|ZP_07659486.1| metallophosphoesterase [Roseibium sp. TrichSKD4]
 gi|307772491|gb|EFO31711.1| metallophosphoesterase [Roseibium sp. TrichSKD4]
          Length = 306

 Score =  235 bits (599), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 110/300 (36%), Positives = 165/300 (55%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           M  LAH+SD HL   P+    +L  KRI+G +NW  +R K         L+ D+     D
Sbjct: 1   MLKLAHLSDPHLGPLPNPKLIQLFSKRILGYLNWWQHRSKNMGGNHLEQLVADMQDQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ITGD+VN     EI  +  WL  +G+P  +++VPGNHDAY+ GA +K+  AW  Y++
Sbjct: 61  HVAITGDLVNIALPLEIIGARTWLEGVGSPEHVTVVPGNHDAYVPGALKKARDAWLPYMS 120

Query: 127 SDTT---CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +D         +  FP++R R NIAL+G STA AT P+ A G  G +Q+ A    L++  
Sbjct: 121 ADNGLAADHPDEASFPFVRRRKNIALVGVSTARATGPWFATGRVGSKQSRALRDTLKELG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPP    ++ + R+    R + MI   GA+L+LHGHTH++S   I+   
Sbjct: 181 DEGLFRVVMIHHPPFPKATNWHKRLSDASRVRAMIKRVGAELVLHGHTHIDSFKEIEGPN 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +PV+G+ SA+      KP A YN+F I+     W ++      +     I+K  S   
Sbjct: 241 GPVPVIGVPSATSAPGGKKPAARYNIFEIDGSARNWNVQMTERGFTGSDSQIEKIRSRDL 300


>gi|17986735|ref|NP_539369.1| Icc family phosphohydrolase [Brucella melitensis bv. 1 str. 16M]
 gi|189024678|ref|YP_001935446.1| phosphohydrolase, Icc family [Brucella abortus S19]
 gi|225628004|ref|ZP_03786040.1| Icc family phosphohydrolase [Brucella ceti str. Cudo]
 gi|237815956|ref|ZP_04594953.1| Icc family phosphohydrolase [Brucella abortus str. 2308 A]
 gi|256255496|ref|ZP_05461032.1| putative phosphohydrolase, Icc family protein [Brucella ceti B1/94]
 gi|260546983|ref|ZP_05822722.1| metallophosphoesterase [Brucella abortus NCTC 8038]
 gi|260565215|ref|ZP_05835699.1| metallophosphoesterase [Brucella melitensis bv. 1 str. 16M]
 gi|260755281|ref|ZP_05867629.1| metallophosphoesterase [Brucella abortus bv. 6 str. 870]
 gi|260758502|ref|ZP_05870850.1| metallophosphoesterase [Brucella abortus bv. 4 str. 292]
 gi|260762326|ref|ZP_05874669.1| metallophosphoesterase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884296|ref|ZP_05895910.1| metallophosphoesterase [Brucella abortus bv. 9 str. C68]
 gi|261214545|ref|ZP_05928826.1| metallophosphoesterase [Brucella abortus bv. 3 str. Tulya]
 gi|261219690|ref|ZP_05933971.1| metallophosphoesterase [Brucella ceti M13/05/1]
 gi|261222702|ref|ZP_05936983.1| metallophosphoesterase [Brucella ceti B1/94]
 gi|261318172|ref|ZP_05957369.1| metallophosphoesterase [Brucella pinnipedialis B2/94]
 gi|261322579|ref|ZP_05961776.1| metallophosphoesterase [Brucella ceti M644/93/1]
 gi|261325623|ref|ZP_05964820.1| metallophosphoesterase [Brucella neotomae 5K33]
 gi|261758741|ref|ZP_06002450.1| metallophosphoesterase [Brucella sp. F5/99]
 gi|265989203|ref|ZP_06101760.1| metallophosphoesterase [Brucella pinnipedialis M292/94/1]
 gi|265991617|ref|ZP_06104174.1| metallophosphoesterase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995455|ref|ZP_06108012.1| metallophosphoesterase [Brucella melitensis bv. 3 str. Ether]
 gi|265998666|ref|ZP_06111223.1| metallophosphoesterase [Brucella ceti M490/95/1]
 gi|265999369|ref|ZP_05466008.2| metallophosphoesterase [Brucella melitensis bv. 2 str. 63/9]
 gi|297248833|ref|ZP_06932551.1| icc family phosphohydrolase [Brucella abortus bv. 5 str. B3196]
 gi|17982361|gb|AAL51633.1| putative phosphohydrolases, icc family [Brucella melitensis bv. 1
           str. 16M]
 gi|189020250|gb|ACD72972.1| putative phosphohydrolase, Icc family [Brucella abortus S19]
 gi|225617167|gb|EEH14213.1| Icc family phosphohydrolase [Brucella ceti str. Cudo]
 gi|237789254|gb|EEP63465.1| Icc family phosphohydrolase [Brucella abortus str. 2308 A]
 gi|260096033|gb|EEW79910.1| metallophosphoesterase [Brucella abortus NCTC 8038]
 gi|260151283|gb|EEW86377.1| metallophosphoesterase [Brucella melitensis bv. 1 str. 16M]
 gi|260668820|gb|EEX55760.1| metallophosphoesterase [Brucella abortus bv. 4 str. 292]
 gi|260672758|gb|EEX59579.1| metallophosphoesterase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675389|gb|EEX62210.1| metallophosphoesterase [Brucella abortus bv. 6 str. 870]
 gi|260873824|gb|EEX80893.1| metallophosphoesterase [Brucella abortus bv. 9 str. C68]
 gi|260916152|gb|EEX83013.1| metallophosphoesterase [Brucella abortus bv. 3 str. Tulya]
 gi|260921286|gb|EEX87939.1| metallophosphoesterase [Brucella ceti B1/94]
 gi|260924779|gb|EEX91347.1| metallophosphoesterase [Brucella ceti M13/05/1]
 gi|261295269|gb|EEX98765.1| metallophosphoesterase [Brucella ceti M644/93/1]
 gi|261297395|gb|EEY00892.1| metallophosphoesterase [Brucella pinnipedialis B2/94]
 gi|261301603|gb|EEY05100.1| metallophosphoesterase [Brucella neotomae 5K33]
 gi|261738725|gb|EEY26721.1| metallophosphoesterase [Brucella sp. F5/99]
 gi|262553290|gb|EEZ09124.1| metallophosphoesterase [Brucella ceti M490/95/1]
 gi|262766568|gb|EEZ12357.1| metallophosphoesterase [Brucella melitensis bv. 3 str. Ether]
 gi|263002401|gb|EEZ14976.1| metallophosphoesterase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093500|gb|EEZ17534.1| metallophosphoesterase [Brucella melitensis bv. 2 str. 63/9]
 gi|264661400|gb|EEZ31661.1| metallophosphoesterase [Brucella pinnipedialis M292/94/1]
 gi|297176002|gb|EFH35349.1| icc family phosphohydrolase [Brucella abortus bv. 5 str. B3196]
          Length = 303

 Score =  235 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 128/302 (42%), Positives = 184/302 (60%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|90418313|ref|ZP_01226225.1| putative metallophophoesterase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337985|gb|EAS51636.1| putative metallophophoesterase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 319

 Score =  234 bits (597), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 122/289 (42%), Positives = 176/289 (60%), Gaps = 2/289 (0%)

Query: 9   MFVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH+SDIHL   P     EL+ KR+ G VNWH NR++    +    LI D+     D
Sbjct: 4   MFRLAHLSDIHLGPLPELSIRELASKRVTGYVNWHRNRRRVMFGDTLANLIQDLQQEAPD 63

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     E   +  WL  +G PHD+S+VPGNHDAY+ GA ++S   W +Y+ 
Sbjct: 64  HIAVTGDLVNLATKVETMAARIWLEELGKPHDVSVVPGNHDAYVPGALKRSYREWYEYMI 123

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   +     FPY+R+R  +A+ G STA AT PF A G F + QA A +K L  A   G
Sbjct: 124 GDNPLNAIGNSFPYVRVRGPVAIFGVSTAEATAPFFATGTFRRRQAMALAKQLEHAGAHG 183

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++++HHPP+  +++ + R+ G Q F K+I   GA+L+LHGHTHL++LHW+K  + ++
Sbjct: 184 QFRVVLIHHPPISGSTAWHKRLIGKQFFSKVIHEMGAELVLHGHTHLDTLHWLKGPQGMV 243

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           PVVG+ SASQ   S+ P + YNLF I+ +   W+L  +      +   I
Sbjct: 244 PVVGVPSASQAPGSSHPASRYNLFEIDGEPGKWSLIQRERGAREERPGI 292


>gi|239832447|ref|ZP_04680776.1| metallophosphoesterase [Ochrobactrum intermedium LMG 3301]
 gi|239824714|gb|EEQ96282.1| metallophosphoesterase [Ochrobactrum intermedium LMG 3301]
          Length = 300

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 129/300 (43%), Positives = 186/300 (62%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISDIHLS  P   + EL+ KRI G +NW  NRK      V + LI D+   + D
Sbjct: 1   MFRLAHISDIHLSPLPRVRYRELASKRITGYINWLRNRKNAMHGTVLDSLIADMQAQSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL  +GNP+D+S+VPGNHDAY+ GA +KS   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLTRLGNPNDVSVVPGNHDAYVPGALDKSCRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   ++G +  FPY+R+R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGIDNSGNRPQFPYMRVRGPVALIGVSSARATAPFMASGDFRSAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FRI+M+HHPP+   +  + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRIVMIHHPPIHGATPAHKRLYGIRRFQKIIRKHGAELVLHGHTHLVTHYEIDGPNGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PVV + SASQ    +KP A YN+F I+++    W+   + + +S  S  I K    + Y
Sbjct: 241 VPVVSVPSASQNFGGHKPAARYNIFGIDRRPEGGWSCLMEEHGVSDASEKITKLNERVLY 300


>gi|254719597|ref|ZP_05181408.1| putative phosphohydrolase, Icc family protein [Brucella sp. 83/13]
          Length = 300

 Score =  234 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 129/300 (43%), Positives = 182/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGKRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNADGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|240850132|ref|YP_002971525.1| hypothetical protein Bgr_05230 [Bartonella grahamii as4aup]
 gi|240267255|gb|ACS50843.1| hypothetical protein Bgr_05230 [Bartonella grahamii as4aup]
          Length = 296

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 125/282 (44%), Positives = 178/282 (63%), Gaps = 3/282 (1%)

Query: 9   MFVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P    FELS KR+ G +NW   RK      V   LI+ +     D
Sbjct: 1   MFYLAHISDVHLSPLPQPSLFELSGKRLTGYLNWQRKRKSQMVTNVLETLIDALNKKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN   ++E   +  WL ++G P DIS+  GNHDAY+ GA +K+   +K +IT
Sbjct: 61  HLVISGDLVNLALDKEFEQAHRWLLNLGQPQDISLTFGNHDAYVRGAFQKACTLFKPWIT 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D    +   LFPY+RIR N+A+I  S+AIATPPF A+GYFG+ QA      L++A ++ 
Sbjct: 121 GDVPQKSAF-LFPYMRIRKNVAIIATSSAIATPPFQASGYFGKMQAQTLPLFLKEAAQRN 179

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP    +S + ++  I+RF  +I + G +LILHGHTHL +L++I+   K I
Sbjct: 180 LFRVVMIHHPPFPKATSWHKKLRDIKRFLDVIKYHGCELILHGHTHLPTLNYIEGPIKKI 239

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG+ SASQ     KP A +NLF IE+    W  + +RY++
Sbjct: 240 PIVGVPSASQAFGDKKPPAGFNLFSIERLQNQWHCQLQRYSI 281


>gi|261752852|ref|ZP_05996561.1| metallophosphoesterase [Brucella suis bv. 5 str. 513]
 gi|261742605|gb|EEY30531.1| metallophosphoesterase [Brucella suis bv. 5 str. 513]
          Length = 303

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 128/302 (42%), Positives = 183/302 (60%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR +M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRAVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|261315734|ref|ZP_05954931.1| metallophosphoesterase [Brucella pinnipedialis M163/99/10]
 gi|261304760|gb|EEY08257.1| metallophosphoesterase [Brucella pinnipedialis M163/99/10]
          Length = 303

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 128/302 (42%), Positives = 184/302 (60%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLVLNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|62290448|ref|YP_222241.1| hypothetical protein BruAb1_1553 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700371|ref|YP_414945.1| metallo-phosphoesterase [Brucella melitensis biovar Abortus 2308]
 gi|225853042|ref|YP_002733275.1| metallophosphoesterase [Brucella melitensis ATCC 23457]
 gi|254689750|ref|ZP_05153004.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           6 str. 870]
 gi|254694239|ref|ZP_05156067.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           3 str. Tulya]
 gi|254697895|ref|ZP_05159723.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254710601|ref|ZP_05172412.1| putative phosphohydrolase, Icc family protein [Brucella
           pinnipedialis B2/94]
 gi|254714784|ref|ZP_05176595.1| putative phosphohydrolase, Icc family protein [Brucella ceti
           M644/93/1]
 gi|254717845|ref|ZP_05179656.1| putative phosphohydrolase, Icc family protein [Brucella ceti
           M13/05/1]
 gi|254730785|ref|ZP_05189363.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           4 str. 292]
 gi|256032095|ref|ZP_05445709.1| putative phosphohydrolase, Icc family protein [Brucella
           pinnipedialis M292/94/1]
 gi|256045187|ref|ZP_05448086.1| putative phosphohydrolase, Icc family protein [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256061617|ref|ZP_05451758.1| putative phosphohydrolase, Icc family protein [Brucella neotomae
           5K33]
 gi|256114138|ref|ZP_05454892.1| putative phosphohydrolase, Icc family protein [Brucella melitensis
           bv. 3 str. Ether]
 gi|256160291|ref|ZP_05457985.1| putative phosphohydrolase, Icc family protein [Brucella ceti
           M490/95/1]
 gi|256258003|ref|ZP_05463539.1| putative phosphohydrolase, Icc family protein [Brucella abortus bv.
           9 str. C68]
 gi|256369980|ref|YP_003107491.1| hypothetical protein BMI_I1578 [Brucella microti CCM 4915]
 gi|260169230|ref|ZP_05756041.1| putative phosphohydrolase, Icc family protein [Brucella sp. F5/99]
 gi|294852882|ref|ZP_06793555.1| icc family phosphohydrolase [Brucella sp. NVSL 07-0026]
 gi|62196580|gb|AAX74880.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616472|emb|CAJ11537.1| Metallo-phosphoesterase [Brucella melitensis biovar Abortus 2308]
 gi|225641407|gb|ACO01321.1| metallophosphoesterase [Brucella melitensis ATCC 23457]
 gi|256000143|gb|ACU48542.1| hypothetical protein BMI_I1578 [Brucella microti CCM 4915]
 gi|294821471|gb|EFG38470.1| icc family phosphohydrolase [Brucella sp. NVSL 07-0026]
 gi|326409584|gb|ADZ66649.1| putative phosphohydrolase, Icc family [Brucella melitensis M28]
 gi|326539288|gb|ADZ87503.1| metallophosphoesterase [Brucella melitensis M5-90]
          Length = 300

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 182/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|118593631|ref|ZP_01551007.1| Metallo-phosphoesterase [Stappia aggregata IAM 12614]
 gi|118433742|gb|EAV40403.1| Metallo-phosphoesterase [Stappia aggregata IAM 12614]
          Length = 312

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 110/300 (36%), Positives = 161/300 (53%), Gaps = 8/300 (2%)

Query: 10  FVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL     P   +L  KRI+G +NW  NR +         L++D+     DH
Sbjct: 4   FRLAHLSDPHLGPLPDPKLLQLFSKRILGYLNWRRNRSRIMGGSYLEQLVDDMKRQAPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     EI  +  WL  IG P ++S+VPGNHDAY+ GA  ++  AW  Y+  
Sbjct: 64  IAVTGDLVNIALPLEISGARTWLEEIGAPENVSVVPGNHDAYVPGAVRRARAAWWPYMRG 123

Query: 128 DTTCSTGKKL------FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
           D               FPY+R R+ IAL+G +T  A+ P+ A G  G +Q+      L  
Sbjct: 124 DGAGDVPPNGTKSQATFPYVRKRDGIALVGVTTGRASGPWFATGRAGSKQSKRLRATLDD 183

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
             + GFFR++M+HHPP    +  + R+    R + ++   GA+LILHGHTH++S   I+ 
Sbjct: 184 LGRDGFFRVVMLHHPPFPHATHWHKRLSDASRVRAVVKRAGAELILHGHTHIDSFEHIEG 243

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
               +PVVG+ SA+      KP A YNLF IEK NE WT + + +  S  +  ++     
Sbjct: 244 PDGRVPVVGVPSATSAPGGKKPAARYNLFRIEKTNEGWTCQMEEHGFSAPNEPVKLLSER 303


>gi|15889538|ref|NP_355219.1| hypothetical protein Atu2263 [Agrobacterium tumefaciens str. C58]
 gi|15157419|gb|AAK88004.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 316

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 139/304 (45%), Positives = 199/304 (65%), Gaps = 7/304 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P   F EL+ KRI G VNWH NR+K+   +    L++D+   + D
Sbjct: 1   MFKLAHISDVHLGPLPKLTFRELASKRITGFVNWHRNRRKHLFTDTLEKLLDDLETKSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN     EI  +  WL  +G+P   S+VPGNHDAY+SGA +K++ AW  Y+ 
Sbjct: 61  HLAITGDLVNLATGIEIRAAADWLEEVGDPEKTSVVPGNHDAYVSGAHDKAMQAWYPYVR 120

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   +        FPY+R+R  +ALIGCST+IATPPFSA GYFG  QA AT++LL+KA 
Sbjct: 121 GDGDPAEWDDDRKIFPYMRVRGPVALIGCSTSIATPPFSATGYFGNRQARATAELLKKAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           ++G FR++M+HHPP+   ++ + RMFG++RF   +   GA+L+LHGHTHLN+++W+    
Sbjct: 181 EQGLFRVVMIHHPPIRGAAAAHKRMFGMRRFAAALGVGGAELVLHGHTHLNTVYWLNTHH 240

Query: 244 K--LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
               IPVVGI+SASQ     KP+A+YNLF+I      W +  +R++L+     +  +   
Sbjct: 241 GEDHIPVVGISSASQGPGGEKPRAAYNLFHISGGPGTWNVACERHSLNETGTGVALEDIR 300

Query: 302 IFYD 305
           +FY+
Sbjct: 301 VFYE 304


>gi|260565941|ref|ZP_05836411.1| metallophosphoesterase [Brucella suis bv. 4 str. 40]
 gi|261755510|ref|ZP_05999219.1| metallophosphoesterase [Brucella suis bv. 3 str. 686]
 gi|260155459|gb|EEW90539.1| metallophosphoesterase [Brucella suis bv. 4 str. 40]
 gi|261745263|gb|EEY33189.1| metallophosphoesterase [Brucella suis bv. 3 str. 686]
          Length = 303

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 128/302 (42%), Positives = 184/302 (60%), Gaps = 4/302 (1%)

Query: 7   TIMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           ++MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L   
Sbjct: 2   SVMFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQT 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ +
Sbjct: 62  PDHIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPW 121

Query: 125 ITSDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +  D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A 
Sbjct: 122 MRGDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAG 181

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I    
Sbjct: 182 ARGLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPD 241

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    +
Sbjct: 242 GKVPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNERV 301

Query: 303 FY 304
            Y
Sbjct: 302 LY 303


>gi|325293623|ref|YP_004279487.1| hypothetical protein AGROH133_07855 [Agrobacterium sp. H13-3]
 gi|325061476|gb|ADY65167.1| hypothetical protein AGROH133_07855 [Agrobacterium sp. H13-3]
          Length = 316

 Score =  232 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 143/304 (47%), Positives = 200/304 (65%), Gaps = 7/304 (2%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P   F EL+ KRI G VNWH NR+K+   +    L++D+   + D
Sbjct: 1   MFKLAHISDVHLGPLPKLTFRELASKRITGFVNWHRNRRKHLFTDTLEKLLDDLEAKSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN     EI  +  WL  +G+P  IS+VPGNHDAY+SGA +K++ AW  Y+ 
Sbjct: 61  HLAITGDLVNLATGIEIRAAADWLEEVGDPEKISVVPGNHDAYVSGAHDKAMRAWYPYVR 120

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   +        FPY+R+R  +ALIGCST+IATPPFSA GYFG  QA AT++LL+KA 
Sbjct: 121 GDGDPAEWDDDRKIFPYMRVRGPVALIGCSTSIATPPFSATGYFGNRQARATAELLKKAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           ++G FR++M+HHPP+   ++ + RMFGI+RF   +   GA+L+LHGHTHLN+++W+    
Sbjct: 181 EQGLFRVVMIHHPPIRGAAAAHKRMFGIRRFAAALGVGGAELVLHGHTHLNTVYWLNTHH 240

Query: 244 K--LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
               IPVVGIASASQ     KP+A+YNLF+I      W +  +R++L+     I  +   
Sbjct: 241 GQEHIPVVGIASASQGPGGEKPRAAYNLFHISGGPGTWNVACERHSLNDTGTGIGLEDIR 300

Query: 302 IFYD 305
           +FY+
Sbjct: 301 VFYE 304


>gi|306843090|ref|ZP_07475712.1| phosphohydrolase, Icc family protein [Brucella sp. BO2]
 gi|306286695|gb|EFM58248.1| phosphohydrolase, Icc family protein [Brucella sp. BO2]
          Length = 300

 Score =  232 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 129/300 (43%), Positives = 182/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPSDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + GK+  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGKRPQFPYMRQRGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIRKHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNMFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|254702285|ref|ZP_05164113.1| putative phosphohydrolase, Icc family protein [Brucella suis bv. 5
           str. 513]
          Length = 300

 Score =  231 bits (589), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 181/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR +M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRAVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|254708232|ref|ZP_05170060.1| putative phosphohydrolase, Icc family protein [Brucella
           pinnipedialis M163/99/10]
          Length = 300

 Score =  231 bits (589), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 182/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLVLNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRNPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|75676818|ref|YP_319239.1| metallophosphoesterase [Nitrobacter winogradskyi Nb-255]
 gi|74421688|gb|ABA05887.1| metallophosphoesterase [Nitrobacter winogradskyi Nb-255]
          Length = 301

 Score =  231 bits (588), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 99/302 (32%), Positives = 155/302 (51%), Gaps = 6/302 (1%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
             LAH+SD HL   P     +L+ KR IG +NW   R     ++V + L+ DI   + DH
Sbjct: 4   LTLAHLSDPHLGPLPPLRLHQLAGKRAIGYLNWKRGRHAIHRRDVLDALVADIKAQSPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD++N     E   +  WL  +G PH++++VPGNHDAY+    +K +  W+DY+  
Sbjct: 64  IAVTGDLINLALPDEFTQARAWLSQVGAPHNVTLVPGNHDAYVR-PTQKQISEWEDYMRG 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FP+LR R  + LIG S+++ T PF A G  G +Q  A  + L +      
Sbjct: 123 DNAGEGTPLSFPFLRRRGPLTLIGASSSVPTRPFMATGRLGPKQLDALDRGLSQLESDPN 182

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP    +   Y R+        ++   G +LILHGH H++S  W    +  IP
Sbjct: 183 FRVLLIHHPL--SSKDSYKRLTDADALLDLLKRRGVNLILHGHDHIHSTMWFDGPQGRIP 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTL 307
            +G+ SAS   H + P A+YNLF I      W  E +    + D  +I++        T 
Sbjct: 241 AIGVPSASAMPHRHYPPAAYNLFSITPDGNGWRCEQQVRGFA-DQAAIERKEVSELQRTQ 299

Query: 308 VL 309
           ++
Sbjct: 300 LI 301


>gi|49475919|ref|YP_033960.1| hypothetical protein BH11990 [Bartonella henselae str. Houston-1]
 gi|49238727|emb|CAF27982.1| hypothetical protein BH11990 [Bartonella henselae str. Houston-1]
          Length = 300

 Score =  231 bits (587), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 129/284 (45%), Positives = 183/284 (64%), Gaps = 3/284 (1%)

Query: 7   TIMFVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           T MF LAHISD+HLS  P    FEL  KR+ G +NW   RK   +      LI  +   N
Sbjct: 3   TPMFCLAHISDMHLSPLPKPSFFELFGKRLTGYLNWQKKRKGQMATNTLETLIEALKKKN 62

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+ I+GD+VN   ++E   + +WL + G P +IS+  GNHDAY+ GA +K+   ++ +
Sbjct: 63  PDHLVISGDLVNLALDKEFEQARNWLLNQGQPQNISLTFGNHDAYVRGAFQKACTLFQPW 122

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
           IT D         FPY+RIR N+A+IG S+AIATPPF A+GYFG+ QA A S+LL +A +
Sbjct: 123 ITGDFPQKNAP-PFPYIRIRKNVAIIGASSAIATPPFQASGYFGKMQAQALSQLLNEAAR 181

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +  FR+IM+HHPP    +S + +++GI+RF ++I H G +LILHGHTHL +L+ IK +  
Sbjct: 182 RNLFRVIMIHHPPFHHATSWHKKLWGIERFLEVIKHHGCELILHGHTHLPTLNIIKGKMG 241

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
            IP+VG+ASA+Q      P A +N F IE+ N+ W  + +RY+L
Sbjct: 242 KIPIVGVASAAQAFGDTPPPAGFNFFSIEQFNQQWHCQLQRYSL 285


>gi|163843817|ref|YP_001628221.1| metallophosphoesterase [Brucella suis ATCC 23445]
 gi|163674540|gb|ABY38651.1| metallophosphoesterase [Brucella suis ATCC 23445]
          Length = 300

 Score =  231 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 181/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P     EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYCELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|161619507|ref|YP_001593394.1| metallophosphoesterase [Brucella canis ATCC 23365]
 gi|254704817|ref|ZP_05166645.1| metallophosphoesterase [Brucella suis bv. 3 str. 686]
 gi|161336318|gb|ABX62623.1| metallophosphoesterase [Brucella canis ATCC 23365]
          Length = 300

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 182/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V + LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLDSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|49474499|ref|YP_032541.1| hypothetical protein BQ09400 [Bartonella quintana str. Toulouse]
 gi|49240003|emb|CAF26417.1| hypothetical protein BQ09400 [Bartonella quintana str. Toulouse]
          Length = 300

 Score =  229 bits (584), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 124/284 (43%), Positives = 178/284 (62%), Gaps = 3/284 (1%)

Query: 7   TIMFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           T MF LAHISD+HLS  P     EL  KR  G +NW   RK   +      LI+ +    
Sbjct: 3   TPMFYLAHISDVHLSPLPQPSLVELLGKRFTGYLNWQKKRKNQMATNALETLIDTLKKKK 62

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            DH+ I+GD++N   ++E   + +WL + G P +IS+  GNHDAY+ GA +K+   ++ +
Sbjct: 63  PDHLVISGDLINLALDKEFEQARNWLLNQGQPQNISLTFGNHDAYVRGAFQKACTLFQPW 122

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
           IT D         FPY+RIR N+A+IG S+AIATPPF A+GYFG+ QA   ++LL +   
Sbjct: 123 ITGDFPQKNA-LPFPYMRIRKNVAIIGASSAIATPPFQASGYFGKMQAQTLAQLLNETAA 181

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +  FR+IM+HHPP    +S + +++GI+RF K+I H G DL+LHGHTHL +L+ ++    
Sbjct: 182 RNLFRVIMIHHPPFHHATSWHKKLWGIERFLKVIKHHGCDLVLHGHTHLPTLNIVEGTMG 241

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
            IP+VG+ASASQ    N P A +NLF IE+ +  W  + +RY+L
Sbjct: 242 KIPIVGVASASQAFGDNPPPAGFNLFSIERFHHQWHCQLQRYSL 285


>gi|23502428|ref|NP_698555.1| hypothetical protein BR1564 [Brucella suis 1330]
 gi|23348417|gb|AAN30470.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 300

 Score =  229 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 128/300 (42%), Positives = 181/300 (60%), Gaps = 4/300 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P   + EL+ KRI G +NW  NRK      V   LI D+L    D
Sbjct: 1   MFRLAHISDVHLSPLPRVRYRELASKRITGYINWLRNRKSAMHGTVLGSLIADMLAQTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   N EI  +  WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++ 
Sbjct: 61  HIAVTGDLVNLALNLEIDIAHDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMR 120

Query: 127 SDTTCSTGKKL-FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D   + G++  FPY+R R  +ALIG S+A AT PF A+G F   Q    + +L +A  +
Sbjct: 121 GDGVDNKGRRPQFPYMRERGPVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDEAGAR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR++M+HHPPV   +S + R++GI+RFQK+I   GA+L+LHGHTHL + + I      
Sbjct: 181 GLFRVVMIHHPPVHGATSAHKRLYGIRRFQKIIREHGAELVLHGHTHLITHYEIDGPDGK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKN-EYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +PV+ + SASQ     KP A YN+F I++     W    + + +S  S  I K    + Y
Sbjct: 241 VPVISVPSASQSFGGRKPAARYNIFNIDRHPDGGWACIMEEHGISDASEKITKLNERVLY 300


>gi|15966127|ref|NP_386480.1| hypothetical protein SMc02712 [Sinorhizobium meliloti 1021]
 gi|307305682|ref|ZP_07585429.1| metallophosphoesterase [Sinorhizobium meliloti BL225C]
 gi|307317685|ref|ZP_07597124.1| metallophosphoesterase [Sinorhizobium meliloti AK83]
 gi|15075397|emb|CAC46953.1| Hypothetical protein SMc02712 [Sinorhizobium meliloti 1021]
 gi|306896843|gb|EFN27590.1| metallophosphoesterase [Sinorhizobium meliloti AK83]
 gi|306902385|gb|EFN32981.1| metallophosphoesterase [Sinorhizobium meliloti BL225C]
          Length = 300

 Score =  228 bits (580), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 149/300 (49%), Positives = 198/300 (66%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL+ KRI G VNWH NR ++      + L+ DI + N D
Sbjct: 1   MFKLAHISDVHLGPLPDLSLRELASKRITGFVNWHRNRVRHLFPGTLDCLMKDIEVRNPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN   + EI   T WL   G+P++IS+VPGNHDAY+ GA EK  HAW  ++ 
Sbjct: 61  HLAITGDLVNLASSLEIEAVTEWLAEAGDPNEISVVPGNHDAYVPGAYEKITHAWYPFMR 120

Query: 127 SDTTCSTG---KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   S        FPY+R+R  +ALIGCSTA+ATPPF+A+GYFG  QA AT  LLR+A 
Sbjct: 121 GDDGPSGWMKKHACFPYMRVRGKVALIGCSTAVATPPFAASGYFGPRQARATVNLLRQAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FRI+M+HHPP+   +S++ RM GI+RF   I   GA+L+LHGHTHLN+LHW+K   
Sbjct: 181 EAGLFRIVMIHHPPIRGATSMHKRMIGIRRFAATISAGGAELVLHGHTHLNTLHWLKGHT 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +PVVGIASASQ    +KP A+YNLF ++ +   W L  +RY ++PD+  +    +  F
Sbjct: 241 GPVPVVGIASASQGPGGSKPVAAYNLFSVDGEPGDWRLTRERYAINPDATGVVLAETTYF 300


>gi|150397483|ref|YP_001327950.1| metallophosphoesterase [Sinorhizobium medicae WSM419]
 gi|150028998|gb|ABR61115.1| metallophosphoesterase [Sinorhizobium medicae WSM419]
          Length = 300

 Score =  227 bits (578), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 147/300 (49%), Positives = 197/300 (65%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S  EL+ KRI G VNWH NR ++      + L+ DI   + D
Sbjct: 1   MFKLAHISDVHLGPLPDLSLRELASKRITGFVNWHRNRVRHLFPGTLDCLMKDIEKRDPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN   + EI   T WL   G P +IS+VPGNHDAY+ GA EKS HAW  ++ 
Sbjct: 61  HLAITGDLVNLASSLEIEAVTEWLTEAGEPDEISVVPGNHDAYVPGAYEKSTHAWYPFMR 120

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   S   K    FPY+R+R ++ALIGCSTA+ATPPF+A+GYFG  QA  T  LLR+A 
Sbjct: 121 GDDAPSGWVKKHACFPYMRVRGSVALIGCSTAVATPPFAASGYFGPRQARETVNLLRRAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FRI+M+HHPP+   +S++ RM GI+RF   I   GA+++LHGHTHLNSL+W+K   
Sbjct: 181 EAGLFRIVMIHHPPIRGATSMHKRMIGIRRFAATISAGGAEMVLHGHTHLNSLYWLKGHA 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +PV+GIASASQ    +KP A+YNLF ++ +   W L  +RY ++PD+  +    +  F
Sbjct: 241 GPVPVIGIASASQGPGGSKPVAAYNLFSVDGEPGDWRLTRERYAINPDATGVVLAETTFF 300


>gi|328542773|ref|YP_004302882.1| Ser/Thr protein phosphatase family protein [polymorphum gilvum
           SL003B-26A1]
 gi|326412519|gb|ADZ69582.1| Ser/Thr protein phosphatase family protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 308

 Score =  226 bits (575), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 111/295 (37%), Positives = 162/295 (54%), Gaps = 7/295 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH SD HL     P   +L  KRI+G VNW  NR +  S +    L++D+     D
Sbjct: 1   MFRLAHFSDPHLGPLPDPRLSQLLSKRILGYVNWRRNRARAMSGDFLVRLLDDMRAAAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV++TGD+VN     EI  +  WL S+  P D+S+VPGNHDAY+ GA + +L AW+ Y+T
Sbjct: 61  HVALTGDLVNIALPLEIEAARAWLESLSAPDDLSLVPGNHDAYVPGALKSALEAWRPYMT 120

Query: 127 SDTTCSTGKKL----FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
            D   +         FP++R R+ IA++G STA A+ P+ A G  G  QA    + L + 
Sbjct: 121 GDARPALEPHGHQVQFPFVRKRDGIAIVGVSTARASAPWLATGKIGIAQARRLEEALARL 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +G FR++M+HHPP    ++ + R+    R +  I   GA+L+LHGHTH++S   +K  
Sbjct: 181 GAEGLFRVVMIHHPPFRKATAWHKRLQDASRVRAAIRKAGAELVLHGHTHVDSRETLKGP 240

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEK-KNEYWTLEGKRYTLSPDSLSIQ 296
              IPV+G+ SA+      KP A YNLF I    +  W+        +    +I+
Sbjct: 241 DGPIPVIGVPSATNAPGGRKPGARYNLFDIAPRDSGGWSCHLTERGFTAPGRAIE 295


>gi|222086630|ref|YP_002545164.1| phosphatase protein [Agrobacterium radiobacter K84]
 gi|221724078|gb|ACM27234.1| phosphatase protein [Agrobacterium radiobacter K84]
          Length = 316

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 143/308 (46%), Positives = 195/308 (63%), Gaps = 5/308 (1%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLIN 58
           M    +  MF LAHISD+HL   P     EL+ KRI G VNWH NR+K+      +LL++
Sbjct: 8   MDWAMSQPMFKLAHISDVHLGPLPRLSIRELASKRITGFVNWHRNRRKHLFGGTLDLLLD 67

Query: 59  DILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSL 118
           DI     DH+++TGD+VN     EI T+  WL+++G+P   S+VPGNHDAY+ GA EK++
Sbjct: 68  DIRAKQADHLAVTGDLVNLGSGIEIRTAAEWLKTVGDPAFTSVVPGNHDAYVPGAYEKAM 127

Query: 119 HAWKDYITSDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHAT 175
            AW  Y+  D       +    FPYLRIR+ +ALIGCSTA+ATPPF+A+G+F   QA  T
Sbjct: 128 RAWYPYVQGDLAPPEWPEDQHVFPYLRIRDRVALIGCSTAVATPPFAASGFFSARQARET 187

Query: 176 SKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNS 235
             +LR A + G FR++M+HHPP+   +S Y RM GI+RF  +I   GA+L+LHGHTHLN+
Sbjct: 188 VNMLRAAGEAGLFRVVMIHHPPIRGATSFYKRMIGIRRFAAVISTGGAELVLHGHTHLNT 247

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           LHW+      +PVVGIASASQ     KP A+YNLF I      W L+ +R++L+     +
Sbjct: 248 LHWLNGPTGPVPVVGIASASQGPGGLKPAAAYNLFTIAGHPGAWELKAERFSLNAHGDGV 307

Query: 296 QKDYSDIF 303
           +    D+ 
Sbjct: 308 ETQGVDVL 315


>gi|227822882|ref|YP_002826854.1| putative phosphohydrolase, Icc family [Sinorhizobium fredii NGR234]
 gi|227341883|gb|ACP26101.1| putative phosphohydrolase, Icc family [Sinorhizobium fredii NGR234]
          Length = 302

 Score =  225 bits (573), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 143/301 (47%), Positives = 198/301 (65%), Gaps = 5/301 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  SF EL+ KRI G VNWH NR ++        L++DI   + D
Sbjct: 1   MFKLAHISDVHLGPLPDLSFRELASKRITGFVNWHRNRARHLFPGTLESLMDDIEKRDPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN   + EI   T WL   G+P DIS+VPGNHDAY+ GA EK+  AW  ++ 
Sbjct: 61  HLAITGDLVNLASSLEIQAVTEWLTEAGDPEDISVVPGNHDAYVPGAYEKTARAWFPFMR 120

Query: 127 SDTTCSTG---KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D+  +        FPY+R+R ++ALIGCSTA+ATPPF+A+GYFG  QA AT  LLR A 
Sbjct: 121 GDSGPAGWMKDHHCFPYIRVRGSVALIGCSTAVATPPFAASGYFGPRQARATVNLLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   +S++ RM GI+RF   I   GA+L++HGHTHLN+++W++   
Sbjct: 181 EAGLFRVVMIHHPPIRGATSMHKRMIGIRRFAATISSGGAELVIHGHTHLNTVYWLRGHA 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +PVVGIASASQ    +KP A+YNLF I+ +   W L  +R+ L  D+ ++    +  F
Sbjct: 241 APVPVVGIASASQGPGGSKPVAAYNLFSIDGEPGAWRLTRERFALGADAKTVSLAETTQF 300

Query: 304 Y 304
           +
Sbjct: 301 H 301


>gi|190892804|ref|YP_001979346.1| phosphoesterase [Rhizobium etli CIAT 652]
 gi|190698083|gb|ACE92168.1| putative phosphoesterase protein [Rhizobium etli CIAT 652]
          Length = 312

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 145/300 (48%), Positives = 200/300 (66%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 11  MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 70

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR +G+P   S+VPGNHDAY+ GA EKS+ AW +Y+ 
Sbjct: 71  HLAVTGDLVNLASGIEIRAAAAWLRELGDPAHTSVVPGNHDAYVPGAYEKSMRAWYEYVR 130

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D      ++    FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 131 GDLAPPQWQEDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 190

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 191 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 250

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  +  DIF
Sbjct: 251 QPVPVVGIASASQGPGSIKPAAAYNLFSIDGSPGAWELSGERFSLNRAGDAVIPESVDIF 310


>gi|327193481|gb|EGE60376.1| putative phosphoesterase protein [Rhizobium etli CNPAF512]
          Length = 306

 Score =  223 bits (568), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 146/300 (48%), Positives = 200/300 (66%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 5   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 64

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR +G+P   S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 65  HLAVTGDLVNLASGIEIRAAAAWLRELGDPAHTSVVPGNHDAYVPGAYEKSMRAWYDYVR 124

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D      ++    FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 125 GDLAPPQWQEDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 184

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 185 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 244

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  +  DIF
Sbjct: 245 QPVPVVGIASASQGPGSIKPAAAYNLFSIDGSPGAWELSGERFSLNRAGDAVIPESVDIF 304


>gi|241205764|ref|YP_002976860.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859654|gb|ACS57321.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 302

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 147/300 (49%), Positives = 202/300 (67%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   PS    EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPSLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR+ G+P + S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRAFGDPANTSVVPGNHDAYVPGAYEKSMRAWYDYVR 120

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D      +     FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLAPPQWQDDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 181 EAGLFRVVMIHHPPIRGATAFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  + +DIF
Sbjct: 241 QPVPVVGIASASQGPGSVKPPAAYNLFSIDGSPGAWELSGERFSLNRAGDAVMPESTDIF 300


>gi|114705049|ref|ZP_01437957.1| hypothetical protein FP2506_08931 [Fulvimarina pelagi HTCC2506]
 gi|114539834|gb|EAU42954.1| hypothetical protein FP2506_08931 [Fulvimarina pelagi HTCC2506]
          Length = 311

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 125/301 (41%), Positives = 177/301 (58%), Gaps = 3/301 (0%)

Query: 9   MFVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH+SDIHL   P     EL+ KR+ G VNWH NR++    +    L+ D+     D
Sbjct: 1   MFRLAHLSDIHLGPLPELSLRELASKRVTGYVNWHRNRRRSMFGDTLTDLVLDMKHQRPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN    +E   +  WL  +G PHD+S+VPGNHDAY+ GA ++S H W DY+ 
Sbjct: 61  HIAVTGDLVNLATKKETVAARIWLEQLGVPHDVSLVPGNHDAYVPGALKRSFHEWHDYLI 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   +     FPYLR+R  IA+ G STA A+ PF A G F + QA A +KLL      G
Sbjct: 121 GDNPLAAIGNSFPYLRVRGKIAIFGVSTAEASAPFFATGSFRRGQALALAKLLESCRSTG 180

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE-KKL 245
            FR++++HHPP+   +S + R+ G Q F K+I   GA+L+LHGHTHL++L+W++    + 
Sbjct: 181 HFRVVLIHHPPISGAASWHKRLIGKQFFSKVIRDVGAELVLHGHTHLDTLYWLEGPGHRK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYD 305
           +PVVG+ SASQ   S KP A YNLF I+ +   W+L  +   +      +         D
Sbjct: 241 VPVVGVPSASQSPGSEKPAARYNLFEIDGEPGNWSLTQRERGMREGHEGVDWLRERRLVD 300

Query: 306 T 306
            
Sbjct: 301 D 301


>gi|13472484|ref|NP_104051.1| hypothetical protein mll2796 [Mesorhizobium loti MAFF303099]
 gi|14023230|dbj|BAB49837.1| mll2796 [Mesorhizobium loti MAFF303099]
          Length = 321

 Score =  221 bits (563), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 131/289 (45%), Positives = 181/289 (62%), Gaps = 3/289 (1%)

Query: 5   YTTIMFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL 62
           Y   MF LAHISD+HL   P  S+ +L+ KR++G VNW  NR+++    V + +  DI  
Sbjct: 9   YEGWMFRLAHISDVHLGPLPDVSYRDLASKRVLGYVNWQRNRRRHMHDAVIDAITADIKT 68

Query: 63  HNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWK 122
            N DH+++TGD+VN   + EI  + HWL ++G+PHD+S+VPGNHDAY+ GA +K   +W 
Sbjct: 69  QNPDHLAVTGDLVNLALDGEIEMAKHWLETLGSPHDVSVVPGNHDAYVPGAFDKVCRSWA 128

Query: 123 DYITSDT-TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
            +++ D       +  FPYLR+R N+AL+G STA AT PF ANG+F + QA    K+LR 
Sbjct: 129 AWMSGDGVNTPVDRNAFPYLRVRGNVALVGVSTARATAPFMANGFFMEGQAERLGKILRD 188

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
              +G FR IM+HHPPV    S + R+FGI RF K+I   GA+L+LHGH+HL SL  I  
Sbjct: 189 TGGQGLFRAIMIHHPPVRGAVSQHKRLFGIARFHKVIRKNGAELVLHGHSHLPSLFQIGL 248

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSP 290
               +PVVG+A+A Q   S  P A YNLF I+ +   W +   R  L+ 
Sbjct: 249 RGTKVPVVGVAAAGQAPGSKHPAAQYNLFDIDGEKGNWRIRLTRRGLTG 297


>gi|92118726|ref|YP_578455.1| metallophosphoesterase [Nitrobacter hamburgensis X14]
 gi|91801620|gb|ABE63995.1| metallophosphoesterase [Nitrobacter hamburgensis X14]
          Length = 318

 Score =  221 bits (563), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 99/281 (35%), Positives = 151/281 (53%), Gaps = 5/281 (1%)

Query: 10  FVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL+  P+    +L+ KR +G +NW  +R     ++V + L+ D+     DH
Sbjct: 21  FTLAHLSDPHLAPLPAPNLHQLAGKRALGYLNWKRSRHAIHRRDVLDALVADVRAQAPDH 80

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           ++ITGD+VN     E   +  WL S+G P D+++VPGNHDAY+   K+++   W  Y+  
Sbjct: 81  IAITGDLVNLALPDEFTRARAWLESVGAPADVTVVPGNHDAYVRVTKKQTS-EWAGYLHG 139

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D   +     FP+LR R  + LIG S+A+ T PF A G  G+ Q  A  +   +      
Sbjct: 140 DGAEAGAPLAFPFLRRRGPLTLIGVSSAVPTAPFMATGTLGRAQLDALDRGFSQLASDPN 199

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP    + S Y R+        ++   G DLILHGH H++S  W +     IP
Sbjct: 200 FRVLLVHHPL--SSKSSYKRLTDADALLTILGRHGVDLILHGHDHIHSTMWFEGPHGRIP 257

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
            VG+ SAS   + + P A+YNLF I +  + W  E +    
Sbjct: 258 AVGVPSASAVPYRHYPAAAYNLFSITRDGDAWRCEQRVRGF 298


>gi|154245314|ref|YP_001416272.1| metallophosphoesterase [Xanthobacter autotrophicus Py2]
 gi|154159399|gb|ABS66615.1| metallophosphoesterase [Xanthobacter autotrophicus Py2]
          Length = 301

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 105/293 (35%), Positives = 152/293 (51%), Gaps = 6/293 (2%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           M+VLAH+SD HL   P     EL  KR  G++NW   R++ F       LI D+L    D
Sbjct: 1   MYVLAHLSDPHLGPIPEARISELLGKRFFGMMNWIGARRRNFGAATLAPLITDLLAQAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ +TGD+VN +   E  T   +L S+G P  +S+VPGNHDAY+  A    L  W  ++ 
Sbjct: 61  HICVTGDLVNVSLPAEFDTGATFLASLGAPDKVSVVPGNHDAYVRSAMHYHLEHWAPFLA 120

Query: 127 SDT---TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D          + FPY+R R  +A++G STA+ T  F A+G  G+ Q      LL +  
Sbjct: 121 GDNTHPHTPVDVEAFPYVRRRGAVAVVGVSTAVPTAVFLASGEMGRAQRARLKTLLEQLK 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++M+HHPPV      +  +    + + ++   GA+L+LHGH H  SL  I+   
Sbjct: 181 AEGLFRVVMIHHPPV-GERPFHRDLRDAAKVRAVLAEAGAELVLHGHDHRASLGQIEAAG 239

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
            LIPVVG+ SAS    S +    Y L+ I      W  + +R   + D  S+Q
Sbjct: 240 GLIPVVGVPSASAGPASERGPGGYCLYRISGGPGAWRCDMERRGYAKDVTSVQ 292


>gi|116253249|ref|YP_769087.1| phosphoesterase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257897|emb|CAK08995.1| putative phosphoesterase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 312

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 148/300 (49%), Positives = 203/300 (67%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   PS    EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 11  MFKLAHISDVHLGPLPSLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 70

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV++TGD+VN     EI  +  WLR++G+P D S+VPGNHDAY+ G+ EKS+ AW DY+ 
Sbjct: 71  HVAVTGDLVNLASGIEIRAAAAWLRALGDPADTSVVPGNHDAYVPGSYEKSMRAWYDYVR 130

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D       +    FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 131 GDLAPPQWPENRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNILRAAG 190

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 191 EAGLFRVVMIHHPPIRGATAFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQM 250

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  + +DIF
Sbjct: 251 QPVPVVGIASASQGPGSIKPPAAYNLFSIDGSPGAWELRGERFSLNRAGDAVMPESADIF 310


>gi|319898478|ref|YP_004158571.1| hypothetical protein BARCL_0302 [Bartonella clarridgeiae 73]
 gi|319402442|emb|CBI75983.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 298

 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 122/282 (43%), Positives = 176/282 (62%), Gaps = 5/282 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P     EL  KR+ G +NW   R      +    L++ +     D
Sbjct: 5   MFYLAHISDVHLSPLPQPSLLELCGKRLTGYLNWTKKRNNQMKTDALETLMHALKQKKPD 64

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD++N   ++E   +  WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 65  HIVISGDLINLALDKEFTQARSWLLAQNNPQNISLTFGNHDAYVRGAFQKACTCFQPWIK 124

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD      K  FPY+RIRNNIA+IG S+AIATPPF A GYF ++QA   S+ L +A  + 
Sbjct: 125 SDFPQ---KNPFPYMRIRNNIAIIGASSAIATPPFQAAGYFDKKQAKILSQFLSEAATRN 181

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FRI+ +HHPP    +S + +++G++RF K+I H G +LILHGHTHL +L+ I+ +    
Sbjct: 182 LFRIVTIHHPPFHHATSWHKKLWGVERFLKIIKHHGCELILHGHTHLPTLNIIEGKMGKT 241

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG+ASASQ   S KP A++NLF IE  +  W  + +RY +
Sbjct: 242 PIVGVASASQSFGSKKPPANFNLFTIEYLHHQWHCQLERYGI 283


>gi|319403806|emb|CBI77390.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 298

 Score =  219 bits (556), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 128/280 (45%), Positives = 187/280 (66%), Gaps = 5/280 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P     EL  KR+ G +NW   R      +   +L++ +     D
Sbjct: 5   MFYLAHISDVHLSPLPQPSLLELCGKRLTGYLNWKKKRNNQMKSDALEILMHALKQKKPD 64

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   + +WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 65  HIVISGDLVNLSLDKEFTQARNWLLAQNNPENISLTFGNHDAYVRGAFQKACTYFQPWIK 124

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD   S+ K  FPY+RIRNNIA+IG S+AIATPPF A+GYFG++QA   S+ L +A K+G
Sbjct: 125 SD---SSQKNPFPYMRIRNNIAIIGASSAIATPPFQASGYFGKQQAKTLSQFLNEAEKQG 181

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP    +S + +++GI+RF K++ H G +LILHGHTHL +L+ I+ + + I
Sbjct: 182 LFRVVMIHHPPFHHATSWHKKLWGIERFLKVVKHHGCELILHGHTHLPTLNIIEGKVRKI 241

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRY 286
           P+VG++SASQ   S KP AS+NLF IE  +  W  + +RY
Sbjct: 242 PIVGVSSASQSFGSKKPPASFNLFAIEYLHNQWHCQLQRY 281


>gi|158422516|ref|YP_001523808.1| putative phosphohydrolase [Azorhizobium caulinodans ORS 571]
 gi|158329405|dbj|BAF86890.1| putative phosphohydrolase [Azorhizobium caulinodans ORS 571]
          Length = 322

 Score =  218 bits (555), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 100/300 (33%), Positives = 146/300 (48%), Gaps = 6/300 (2%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MFVLAH+SD HL   P     EL  KR  G++NW   R++ F       L+ D+     D
Sbjct: 22  MFVLAHLSDPHLGPIPEARLSELLGKRFFGMMNWIGARRRNFGASTLAPLMADLAAQAPD 81

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN +   E  T   +L S+G P  +S++PGNHDAY+  A    L  W  ++ 
Sbjct: 82  HIAVTGDLVNVSLPAEFDTGATFLASLGTPDKVSVIPGNHDAYVRSAMTYHLERWAPFLA 141

Query: 127 SD---TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D          + FPY+R R  IA++G STAI T  F A+G  G+ Q      LLR+  
Sbjct: 142 GDETHPGTPVDTEAFPYVRRRGPIAIVGVSTAIPTAVFLASGKAGKAQLERLRALLRQLK 201

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            +G FR++++HHPPV      +  +      +  +   GA+L+LHGH H  SL  I+   
Sbjct: 202 AEGLFRVVLIHHPPV-GERHSHRDLRDAPAVRAALVEAGAELVLHGHDHRASLGHIEGVA 260

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             IPVVG+ SAS      +    YNL+ I      W  + +    +     +        
Sbjct: 261 PPIPVVGVPSASAGPEDGRGAGRYNLYRISGGPGAWVCDMESRGYAKGETDVALRDQRRL 320


>gi|222149376|ref|YP_002550333.1| hypothetical protein Avi_3243 [Agrobacterium vitis S4]
 gi|221736360|gb|ACM37323.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 302

 Score =  218 bits (554), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 147/294 (50%), Positives = 192/294 (65%), Gaps = 5/294 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISDIHL   P   F EL+ KRI G VNWH NR K+        L+ DI     D
Sbjct: 1   MFKLAHISDIHLGPMPHLTFRELASKRITGYVNWHRNRAKHMVSGTLEALVADIHAKAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G P   S+VPGNHDAY+ GA EK++HAW DY+ 
Sbjct: 61  HLTVTGDLVNLASGLEINKAAEWLRTVGPPATTSVVPGNHDAYVPGAHEKAMHAWYDYVR 120

Query: 127 SDTTCSTGKKLF---PYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            DT     +K F   P  R R  + LIGCST+IATPPFSA+GYF   QA  T++LLR+A 
Sbjct: 121 GDTDPDIWRKDFKLWPTFRRRGPVGLIGCSTSIATPPFSASGYFSSRQARETAQLLRQAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           ++G FR++++HHPPV   +S + RM GI+RF   I   GA+L+LHGHTHLN+L+W+ N  
Sbjct: 181 EEGLFRVVLIHHPPVRGAASQHKRMIGIRRFAAAISLGGAELVLHGHTHLNTLNWLHNRH 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
             +PVVGIASASQ   + KPQA+YNLF I   +  W L+ +RY L+ D+  +  
Sbjct: 241 GRVPVVGIASASQGPGNKKPQAAYNLFSISGASGAWVLDWERYALTGDTSEVSL 294


>gi|163867927|ref|YP_001609131.1| hypothetical protein Btr_0711 [Bartonella tribocorum CIP 105476]
 gi|161017578|emb|CAK01136.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 296

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 123/282 (43%), Positives = 173/282 (61%), Gaps = 3/282 (1%)

Query: 9   MFVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P    FELS KR+ G +NW   RK   +  V   LI+ +     D
Sbjct: 1   MFYLAHISDVHLSPLPKPSLFELSGKRLTGYLNWQKKRKNQITINVLETLIDALNQKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN   ++E   +  WL ++G P DIS+  GNHDAY+ GA +K+   +K +IT
Sbjct: 61  HLVISGDLVNLALDKEFEQAHRWLLNLGQPQDISLTFGNHDAYVRGALQKACTLFKPWIT 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D         FPY+RIR ++A+I  S+AIATPPF A+GYFG+ QA     LL +A ++ 
Sbjct: 121 GDVPQ-KSVFPFPYMRIRKDVAIIAASSAIATPPFHASGYFGKMQAQMLPHLLNEAAQRN 179

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP    +S + ++   +RF  +I H G +LILHGHTHL +L + +   K I
Sbjct: 180 LFRVVMIHHPPFPKATSWHKKLRDTKRFLNVIKHHGCELILHGHTHLPTLKYTEGPTKKI 239

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG+ SASQ     KP A +NLF IE     W  + +RY++
Sbjct: 240 PIVGVPSASQAFGDKKPPAGFNLFSIEHLRNQWHCQLQRYSI 281


>gi|319405244|emb|CBI78849.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 294

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 124/282 (43%), Positives = 178/282 (63%), Gaps = 5/282 (1%)

Query: 9   MFVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P    FEL  KR+ G +NW   R      +    L+  +     D
Sbjct: 1   MFYLAHISDVHLSPLPQPSLFELCGKRLTGYLNWKKKRNNQMKADALETLMRALKQKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN    +E   +  WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 61  HIVISGDLVNLALEKEFTQARSWLLAQNNPQNISLTFGNHDAYVRGAFQKACTYFQPWIK 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD      K  FPY+RIR+NIA+IG S+AIATP F A+GYF ++QA   S+ L +A  +G
Sbjct: 121 SDFPQ---KNPFPYMRIRDNIAIIGASSAIATPFFQASGYFDKQQAKILSQFLTEAATRG 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           FFR++++HHPP    +S + +++GI+RF K++   G +LILHGHTHL +L+ I+ E   I
Sbjct: 178 FFRVVIIHHPPFHHATSWHKKLWGIERFLKVVKQHGCELILHGHTHLPTLNTIEGEMSKI 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG++SASQ   S KP AS+NLF IE  +  W  + +RY +
Sbjct: 238 PIVGVSSASQSFGSKKPPASFNLFAIEYLHHQWHCQLQRYGI 279


>gi|90422893|ref|YP_531263.1| metallophosphoesterase [Rhodopseudomonas palustris BisB18]
 gi|90104907|gb|ABD86944.1| metallophosphoesterase [Rhodopseudomonas palustris BisB18]
          Length = 298

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 99/297 (33%), Positives = 156/297 (52%), Gaps = 6/297 (2%)

Query: 8   IMFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
            +F LAH+SD HL   P  +  EL+ KRI+G +NW  NR     ++V + L+ D+  H  
Sbjct: 2   TVFTLAHLSDPHLPPMPVATLRELAGKRILGYLNWTKNRHAIHRRDVLDALMADLRAHRP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGD+VN    +E   +  W+  +G P  +S++PGNHD Y+ G  E+    + DY+
Sbjct: 62  DHIAVTGDLVNLALEQEFAPARRWIEQVGPPDRVSVIPGNHDRYVRGTAERFAETFPDYM 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           + D   +     FP+LR R  + +IG STA+ T P  A G+ G+ Q  A    L   +  
Sbjct: 122 SGDDRSNAVV--FPFLRRRGPLVIIGVSTAVPTAPLRATGWLGEAQRAALEAQLASLDGD 179

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             FR++++HHP    + + + R+      Q ++   G DL+LHGH H++S  W+   +  
Sbjct: 180 PAFRVLLIHHPLR--SKARHKRLTDSAELQALLGRHGVDLVLHGHDHVHSTIWVDGPRAP 237

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
           IPVVG+ SAS     ++P A+YNLF I +  E W  +             Q     +
Sbjct: 238 IPVVGVPSASAGPDGHRPPAAYNLFSIARDGERWRCDHTTRGFGDAPGITQLSAVRL 294


>gi|323137673|ref|ZP_08072749.1| metallophosphoesterase [Methylocystis sp. ATCC 49242]
 gi|322396970|gb|EFX99495.1| metallophosphoesterase [Methylocystis sp. ATCC 49242]
          Length = 293

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 102/295 (34%), Positives = 154/295 (52%), Gaps = 6/295 (2%)

Query: 10  FVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F+LAH+SD H+   P     EL  KR+ G VNW + R       V + L+ D+     DH
Sbjct: 3   FLLAHLSDAHIGPIPRPNLAELLGKRVTGYVNWLYKRAGQHDMGVLSRLVEDMKAQKPDH 62

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V +TGDIVN     EI  +  WL S+G P ++S  PGNHDAY++ A +     +  +   
Sbjct: 63  VLMTGDIVNIGLPAEIALARDWLASLGGPEEVSYTPGNHDAYVADATQLVHEVFAPWTAG 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           +    T    FPYLR R  +ALIG  + + T PF A+G  G+EQ  A   LL +   +G 
Sbjct: 123 E----TAAAGFPYLRRRGGVALIGLDSGVPTGPFIASGRLGEEQLSALGALLEQTKTEGL 178

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++ +HHPP +  + +   +     F+ +I   GA+L+LHGH H  SL  I       P
Sbjct: 179 ARVVFLHHPPHVGGARILRGLDDAAAFEDVIARHGAELVLHGHNHKPSLAHIAGPLAAAP 238

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
           VVG+ASAS +   + P A+YNL+ I ++ +   +  ++  L+     ++    D+
Sbjct: 239 VVGVASASARPGGHYPAAAYNLYSIGREGDRLRINMRQRGLNEAGEIVEMAAVDL 293


>gi|121602306|ref|YP_989290.1| Ser/Thr protein phosphatase family protein [Bartonella
           bacilliformis KC583]
 gi|120614483|gb|ABM45084.1| Ser/Thr protein phosphatase family protein [Bartonella
           bacilliformis KC583]
          Length = 294

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 127/282 (45%), Positives = 181/282 (64%), Gaps = 5/282 (1%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISDIHLS    PSF EL  KR+ G +NW   RK   +  V   L+  I   N D
Sbjct: 1   MFYLAHISDIHLSPVPQPSFSELFGKRLTGYLNWQKKRKNQMTTGVLETLMCTIKEKNPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   + +WL + G PHDIS+  GNHDAY+  A +K+   ++ +I 
Sbjct: 61  HLVISGDLVNLSLDKEFKQARNWLLTQGQPHDISLTFGNHDAYVRRALQKACTIFQPWIQ 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D      K  FPY+RIR+NIA+IG S+AIATPPF A+GYFG++QA   S+LL +A  + 
Sbjct: 121 GDLPQ---KNAFPYMRIRDNIAIIGASSAIATPPFQASGYFGKKQAQILSQLLDEAAARN 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++ +HHPP    +  + +++GI RF  +I   G +LILHGHTHL +L+ I+ +K+ I
Sbjct: 178 LFRVVTIHHPPFHHATLWHKKLWGIGRFLDVIKRYGCELILHGHTHLPTLNIIEEKKRKI 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG+ASASQ      P A++N F IE  +  W  + +RY++
Sbjct: 238 PIVGVASASQGCGGKNPPANFNFFTIEHAHHQWHCQLQRYSI 279


>gi|304393664|ref|ZP_07375592.1| metallophosphoesterase [Ahrensia sp. R2A130]
 gi|303294671|gb|EFL89043.1| metallophosphoesterase [Ahrensia sp. R2A130]
          Length = 309

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 118/301 (39%), Positives = 163/301 (54%), Gaps = 8/301 (2%)

Query: 9   MFVLAHISDIHLSYSPSFFE--LSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P F    L  KR++G  NW  NRK      V   LI+  L  N D
Sbjct: 1   MFKLAHISDVHLGPLPPFKRSALLSKRVLGYANWRLNRKGDLHSGVLGNLIDHTLATNPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+VN     EI     WL  +G P DIS++PGNHD Y+ GA  + +  WK ++ 
Sbjct: 61  HLAITGDLVNLALPEEIELIHQWLTGLGAPEDISVIPGNHDTYVPGALRRIIERWKPWMQ 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D         FPY R R  +ALIG ++  AT PF A G +  +Q   TS++L++A   G
Sbjct: 121 GDKP--VAGNPFPYRRDRGAVALIGTNSGRATAPFLATGSWRAQQDSDTSEMLQRAKADG 178

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FR++M+HHPP  + ++ + R+ G +RF++MI  EGA+LILHGHTH+ S   I      +
Sbjct: 179 QFRVVMIHHPPFPNATAQHKRLIGAKRFRRMIAREGAELILHGHTHIVSDERIDGPDGPV 238

Query: 247 PVVGIASASQKVHS----NKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
           PV+G+ SAS          +P A YNLF I      W    +++        I +   DI
Sbjct: 239 PVIGVPSASHGPRLTPSIGRPGARYNLFEISGNQGAWRCRQQQFGYGDGQQKISELADDI 298

Query: 303 F 303
            
Sbjct: 299 I 299


>gi|296445940|ref|ZP_06887891.1| metallophosphoesterase [Methylosinus trichosporium OB3b]
 gi|296256608|gb|EFH03684.1| metallophosphoesterase [Methylosinus trichosporium OB3b]
          Length = 293

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 149/288 (51%), Gaps = 7/288 (2%)

Query: 10  FVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           FVLAH+SD H+     PS  EL+ KR+ G  NW   R ++   +V   ++ DI     DH
Sbjct: 3   FVLAHLSDAHIGPIPQPSLRELAGKRMTGYANWLSKRAQFHDMDVLARIVADIAAQQPDH 62

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V +TGDIVN   + EI  +  WL ++G P  +S  PGNHDAY+  A  +    +  + +S
Sbjct: 63  VVMTGDIVNIGLDAEIEAARDWLMTLGGPEQVSFTPGNHDAYVRAAVARVAETFAPWTSS 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           +         FPYLR R  IALIG  +A+ T PF A+G  G  Q      LL +  ++G 
Sbjct: 123 EAG-----AGFPYLRRRGGIALIGLDSAVPTAPFVASGRLGSAQLGRLGALLEQTREEGL 177

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++++HHPP    +     +     F+  I   GA+L+LHGH H  S+H +       P
Sbjct: 178 ARVVLLHHPPHQGGAKPLRGLDDAGAFEATIARHGAELVLHGHNHAISVHRLPGRDGSTP 237

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           VVG ASAS K  ++   A+YNL+ IE+      + G+   +     ++
Sbjct: 238 VVGTASASAKPGAHYRAAAYNLYSIERGERGVVVTGRSRGVDEGCETV 285


>gi|91978511|ref|YP_571170.1| metallophosphoesterase [Rhodopseudomonas palustris BisB5]
 gi|91684967|gb|ABE41269.1| metallophosphoesterase [Rhodopseudomonas palustris BisB5]
          Length = 292

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 98/296 (33%), Positives = 153/296 (51%), Gaps = 8/296 (2%)

Query: 10  FVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P     +L+ KR++G +NW  NR+    +++ + L+ D+     DH
Sbjct: 3   FTLAHLSDPHLPPLPKPRLADLANKRVLGYLNWTRNRQSIHRRDILDALVADLQAQTPDH 62

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN   + E   +  WL  +G P  +S+VPGNHDAY++    +    + DYI  
Sbjct: 63  IAVTGDLVNIALDDEFAPARRWLDGVGPPERVSVVPGNHDAYVAATAPRFGETFADYIRG 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FPYLR R+ IA+IG S+A+ T PF A G+ G  Q      +L+    +  
Sbjct: 123 D----DGATGFPYLRRRDRIAIIGVSSAVPTAPFMATGWLGDAQRARLETMLQSLASERV 178

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP    +   + R+        ++     DL+LHGH H+++   I      IP
Sbjct: 179 FRVLLIHHPLRSRS--RFKRLTDSAELIALLQRHPVDLVLHGHDHVHATIRIDAPSGPIP 236

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           VVG+ SAS     ++P A+YNLF I + N+ W  E +               S + 
Sbjct: 237 VVGVPSASAFKDHHRPSAAYNLFAISEGNDGWRCEHRVRGFGATETITDLRDSRVL 292


>gi|115523419|ref|YP_780330.1| metallophosphoesterase [Rhodopseudomonas palustris BisA53]
 gi|115517366|gb|ABJ05350.1| metallophosphoesterase [Rhodopseudomonas palustris BisA53]
          Length = 299

 Score =  216 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 96/295 (32%), Positives = 150/295 (50%), Gaps = 5/295 (1%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD+HL   P     EL+ KR++G +NW  NR     +EV + L+ D+L    D 
Sbjct: 4   FTLAHLSDVHLPPLPAVRPLELANKRVLGYLNWKKNRHTIHRREVLDSLVADMLAQAPDQ 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN    +E      WL S+G P  +++VPGNHDAY+   + +       ++  
Sbjct: 64  IAVTGDLVNLALEQEFSPVAAWLDSVGPPDRVTVVPGNHDAYVRSTQHRFAETLHPFLRG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FP+LR R  +ALIG S+A+ T P  A G  G+ Q  A  +LL +   +  
Sbjct: 124 DDAGE-GVVRFPFLRRRGPLALIGLSSAVPTAPLMAVGRLGEAQLAALEQLLAQLAGEDS 182

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP    + S    +        ++   G  L+LHGH H+++  W++     IP
Sbjct: 183 FRVLLVHHPL--TSRSRQKWLADAPELLALLRRCGVHLVLHGHDHVHATVWVEGPTAPIP 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
           V+G+ SAS     + P A YNLF + + N+ W                + D  D+
Sbjct: 241 VIGVPSASAMASGHHPGAGYNLFSVHRDNDAWRCTHTIRGFGESGGMSELDRVDL 295


>gi|148253756|ref|YP_001238341.1| putative metallo-phosphoesterase [Bradyrhizobium sp. BTAi1]
 gi|146405929|gb|ABQ34435.1| putative metallo-phosphoesterase [Bradyrhizobium sp. BTAi1]
          Length = 297

 Score =  216 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 96/296 (32%), Positives = 159/296 (53%), Gaps = 5/296 (1%)

Query: 10  FVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL+  P     EL+ KR +G +NW  NR KY  +++ +LL++D+     D 
Sbjct: 5   FTLAHLSDPHLAPLPRPRLAELAGKRALGYLNWTRNRYKYHRRDILDLLVSDLHTQMPDQ 64

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VNF    E   +  WL+++G P  ++ +PGNHDAY+   + +   ++  Y   
Sbjct: 65  IAVTGDLVNFALESEFPLAQAWLKTVGPPDKVTAIPGNHDAYVRSTRLRFAESFAAYFGG 124

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FP LR R  +ALI  S+A+ + PF A G  G  Q  A  +LL+    +  
Sbjct: 125 DAPQE-GPATFPSLRRRGPLALISLSSAVPSGPFMATGRLGSAQLAALEQLLQSIAHEQL 183

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP    +++   R+   +    ++   G +LILHGH H++S  WI   ++ IP
Sbjct: 184 FRVLLVHHPLR--SANRMKRLTDAKDLIALLARHGVELILHGHDHVHSTIWIDGPERKIP 241

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            VG+ SAS   H + P A+YN+F I +   +W  +    +++      +     + 
Sbjct: 242 TVGVPSASSIAHGHYPAAAYNIFAISRAGNHWRCDMTVRSVNDALRVREIRQVRLL 297


>gi|260462516|ref|ZP_05810723.1| metallophosphoesterase [Mesorhizobium opportunistum WSM2075]
 gi|259031712|gb|EEW32981.1| metallophosphoesterase [Mesorhizobium opportunistum WSM2075]
          Length = 309

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 125/285 (43%), Positives = 178/285 (62%), Gaps = 3/285 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S+ +L+ KR++G VNW  NR+++    V + ++ D+   + D
Sbjct: 1   MFRLAHISDVHLGPLPDVSYRDLASKRVLGYVNWQRNRRRHMHDAVIDTIVADVKAQSPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   + EI  + HWL ++G P D+S+VPGNHDAY+ GA +K   +W  +++
Sbjct: 61  HLAVTGDLVNLALDGEIEMARHWLETLGPPQDVSVVPGNHDAYVPGAFDKVCRSWAAWMS 120

Query: 127 SDT-TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D       +  FP+LR+R N+ALIG STA AT PF ANG+F + QA    K+LR    +
Sbjct: 121 GDGINTPVDRNAFPFLRVRGNVALIGVSTARATAPFMANGFFMEGQADRLGKILRDTGGQ 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR IM+HHPPV      + R+FGI RF K+I   GA+L+LHGH+HL SL  I      
Sbjct: 181 GLFRAIMIHHPPVRGAVPQHKRLFGIARFHKIIRRHGAELVLHGHSHLPSLFQIGVRGAK 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSP 290
           +PVVG+A+A Q      P A YNLF I+ + + W +   R  L+ 
Sbjct: 241 VPVVGVAAAGQAPGGKHPAAQYNLFDIDGEKDNWRIRLTRRGLTG 285


>gi|86358665|ref|YP_470557.1| putative phosphatase protein [Rhizobium etli CFN 42]
 gi|86282767|gb|ABC91830.1| putative phosphatase protein [Rhizobium etli CFN 42]
          Length = 312

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 145/300 (48%), Positives = 202/300 (67%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 11  MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFASTLDLLLDDIRTHRAD 70

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G+P D S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 71  HLAVTGDLVNLASGIEIRAAAAWLRALGDPADTSVVPGNHDAYVPGAYEKSMRAWYDYVR 130

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D      ++    FPYLR+R+ +A++GCSTA+ATPPF+A+G+F   QA  T  +LR A 
Sbjct: 131 GDLAPPQWQEDRRIFPYLRVRDKVAIVGCSTAVATPPFAASGFFSARQARDTVNMLRAAG 190

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ + RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 191 EAGLFRVVMIHHPPIRGATAFHKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 250

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++  +  DIF
Sbjct: 251 QPVPVVGIASASQGPGSIKPPAAYNLFSIDGAPGAWELTGERFSLNRTGDAMMPESVDIF 310


>gi|319406812|emb|CBI80445.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 294

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 128/282 (45%), Positives = 187/282 (66%), Gaps = 5/282 (1%)

Query: 9   MFVLAHISDIHLSYSPSF--FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P    +EL  KR+ G +NW   R      +    L++ +     D
Sbjct: 1   MFYLAHISDVHLSPLPQPSLWELCGKRLTGYLNWKKKRNNQMKSDALETLMHALKQKKPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   + +WL +  NP +IS+  GNHDAY+ GA +K+   ++ +I 
Sbjct: 61  HIVISGDLVNLSLDKEFTQARNWLLAQNNPENISLTFGNHDAYVRGAFQKACTYFQPWIK 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           SD    + K  FPY+RIRNNIA+IG S+AIATPPF A+GYFG++QA   S+ L +A K+G
Sbjct: 121 SD---FSQKNPFPYMRIRNNIAIIGASSAIATPPFQASGYFGKKQAKILSQFLNEAAKQG 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           FFR++M+HHPP    +S Y +++GI+RF +++ H G +LILHGHTHL +L+ I+ +   I
Sbjct: 178 FFRVVMIHHPPFHHATSWYKKLWGIERFLEVVKHHGCELILHGHTHLPTLNIIEEKISKI 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           PVVG++SASQ   S KP AS+NLF I+  +  W  + +RY +
Sbjct: 238 PVVGVSSASQSFGSKKPPASFNLFAIKYLHHQWHCQLQRYGI 279


>gi|27377568|ref|NP_769097.1| hypothetical protein bll2457 [Bradyrhizobium japonicum USDA 110]
 gi|27350712|dbj|BAC47722.1| bll2457 [Bradyrhizobium japonicum USDA 110]
          Length = 293

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 103/282 (36%), Positives = 148/282 (52%), Gaps = 8/282 (2%)

Query: 10  FVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P     EL+ KR+ G VNW  NR KY  +EV + L+ D+     DH
Sbjct: 4   FTLAHLSDPHLPPLPKPRLIELAGKRVFGYVNWTRNRHKYQRREVLDALVADVKAQAPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN   + E   +  WL  +G P  ++ +PGNHDAY+     +    +  Y+ S
Sbjct: 64  IAVTGDLVNLALDAEFAPARTWLDGVGPPDRVTTIPGNHDAYVRATYHRFGETFAPYLAS 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FP LR R  +ALI  STA+ T P  A G  G+ Q  A  ++L +   +  
Sbjct: 124 DN----GSAGFPALRRRGPLALISLSTAVPTLPLMATGTLGRAQLAALERVLERLATEDV 179

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP    + + + RM        ++   G +L+LHGH H++S  W +     IP
Sbjct: 180 FRVLLVHHPL--KSDARHKRMTDAADLLALLKRHGVELVLHGHDHIHSTMWFEGPNGNIP 237

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
            +G+ SAS   H   P A+YNLF IEK N  W  E     L 
Sbjct: 238 AIGVPSASALAHGRYPAAAYNLFTIEKDNAGWRCEQTVRGLG 279


>gi|85714290|ref|ZP_01045278.1| metallophosphoesterase [Nitrobacter sp. Nb-311A]
 gi|85698737|gb|EAQ36606.1| metallophosphoesterase [Nitrobacter sp. Nb-311A]
          Length = 301

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 96/302 (31%), Positives = 154/302 (50%), Gaps = 6/302 (1%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
             LAH+SD HL   P     +L+ KR IG +NW   R     ++V + L+ DI   + DH
Sbjct: 4   LTLAHLSDPHLGPLPPLRLHQLAGKRAIGYLNWKRGRHAIHRRDVLDTLVADIKAQSPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD++N     E   +  WL  +G PH++++VPGNHDAY+    +K +  W+DY+  
Sbjct: 64  IAVTGDLINLALPGEFTQARAWLGDVGTPHNVTLVPGNHDAYVR-PTQKQISEWEDYMRG 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D+        FP+LR R  + LIG S+++ T PF A G+ G  Q  A  + L +      
Sbjct: 123 DSAREGAPLSFPFLRRRGPLTLIGVSSSVPTGPFMATGWLGSSQLDALDRGLAQLESDPS 182

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           F ++++HHP    +   + R+        ++     +LILHGH H++S  W + +   IP
Sbjct: 183 FHVLLIHHPL--SSKDSHKRLTDADALLALLKRRNVNLILHGHDHIHSTMWFEGQHGRIP 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTL 307
            +G+ SAS   H + P A+YNLF I      W  E +    + D  +I +        T 
Sbjct: 241 AIGVPSASATPHRHYPPAAYNLFSITHDGSSWRCEHRVRGFA-DQAAIDRGEISELQRTQ 299

Query: 308 VL 309
           ++
Sbjct: 300 LI 301


>gi|146339005|ref|YP_001204053.1| putative metallo-phosphoesterase [Bradyrhizobium sp. ORS278]
 gi|146191811|emb|CAL75816.1| putative metallo-phosphoesterase [Bradyrhizobium sp. ORS278]
          Length = 295

 Score =  213 bits (542), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 98/296 (33%), Positives = 160/296 (54%), Gaps = 7/296 (2%)

Query: 10  FVLAHISDIHLSYS--PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL+    P   EL+ KR +G +NW  NR KY   ++ +LLI+D+     D 
Sbjct: 5   FTLAHLSDPHLAPQHRPRLSELAGKRALGYLNWTRNRYKYHRLDILDLLISDLHAQMPDQ 64

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VNF    E   +  WLR++G P  ++ +PGNHDAY+   + +   ++  Y   
Sbjct: 65  IAVTGDLVNFALESEFPVAQAWLRTVGPPDKVTAIPGNHDAYVRSTRLRFAESFAAYFGG 124

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D   + G   FP LR R  +ALI  S+A+ + PF A G  G  Q  A  +LL+    +  
Sbjct: 125 D---AEGPATFPSLRRRGPLALISLSSAVPSAPFMATGRIGSAQLAALEQLLQSIAHEPL 181

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP    +++   R+   +    ++   G +L+LHGH H++S  WI   ++ IP
Sbjct: 182 FRVLLVHHPLR--SANRMKRLIDSKELIALLARHGVELVLHGHDHVHSTIWIDGPERKIP 239

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           VVG+ SAS   H + P A+YN+F I  +  +W  +    +++      +     + 
Sbjct: 240 VVGVPSASSLAHGHTPAAAYNIFAIAAEGNHWRCDMTVRSVNDARRVREIRQIRLL 295


>gi|209550379|ref|YP_002282296.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536135|gb|ACI56070.1| metallophosphoesterase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 302

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 146/300 (48%), Positives = 205/300 (68%), Gaps = 5/300 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G+P D S+VPGNHDAY+ GA EKS+ AW +Y+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRALGDPADTSVVPGNHDAYVPGAYEKSMRAWYEYVR 120

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D +    ++    FPYLRIR+ +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLSPPQWQEDRHIFPYLRIRDKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW++ + 
Sbjct: 181 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWLRGQV 240

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++++    ++  + +DIF
Sbjct: 241 QPVPVVGIASASQGPGSIKPPAAYNLFSIDGSPGAWELSGERFSVNRSGDAVMAESADIF 300


>gi|86751303|ref|YP_487799.1| metallophosphoesterase [Rhodopseudomonas palustris HaA2]
 gi|86574331|gb|ABD08888.1| Metallophosphoesterase [Rhodopseudomonas palustris HaA2]
          Length = 292

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 99/296 (33%), Positives = 154/296 (52%), Gaps = 8/296 (2%)

Query: 10  FVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P     +L+ KR++G +NW  NR     +++ + L+ D+     DH
Sbjct: 3   FTLAHLSDPHLPPLPKPRLADLASKRLLGYLNWTRNRHNIHRRDILDALVADLQAQRPDH 62

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL S+G P  +S+VPGNHDAY++         + DYI  
Sbjct: 63  IAVTGDLVNIALAEEFPPARQWLDSVGPPDRVSLVPGNHDAYVAATAPLIAETFADYIRG 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FPYLR R+ +A+IG STA+ T PF A G+ G  Q      LL++ + +  
Sbjct: 123 D----DGAAGFPYLRRRDAVAIIGVSTAVPTAPFMATGWLGDAQRARLETLLQRLDSERA 178

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           FR++++HHP    +   + R+        ++     DL+LHGH H+++   I   +  IP
Sbjct: 179 FRVLLIHHPLRSRS--RHKRLTDSAELIALLQRHPVDLVLHGHDHVHATIRIDTPRGPIP 236

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           VVG+ SAS     ++P A+YNLF I + N+ W  E +               + + 
Sbjct: 237 VVGVPSASAFNDHHRPSAAYNLFAISEANDGWRCEHRIRGFGDTETITDLQDARLL 292


>gi|170747325|ref|YP_001753585.1| metallophosphoesterase [Methylobacterium radiotolerans JCM 2831]
 gi|170653847|gb|ACB22902.1| metallophosphoesterase [Methylobacterium radiotolerans JCM 2831]
          Length = 307

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 103/302 (34%), Positives = 142/302 (47%), Gaps = 12/302 (3%)

Query: 10  FVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD H+         +L  KR  G  NW   R +     V   L+ D+      H
Sbjct: 3   FRLAHLSDPHVGPLGRVRLRQLIGKRATGYANWRRGRSRSHDMTVLEALVTDLKAQGAGH 62

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V+ TGD+ N     E  T+  +L ++G+P  +S VPGNHDAY+ G+ E  L A   Y   
Sbjct: 63  VACTGDLCNIGLPSEWETARTFLEALGSPEAVSFVPGNHDAYVRGSLEGLLAACGRYTGD 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG- 186
           D+        FPYLR R  +AL+G S+AI T PF A G  G  Q  A   LLR    +  
Sbjct: 123 DSG---SWGHFPYLRRRGPLALVGLSSAIPTKPFVATGRLGASQLAAAETLLRALATEPG 179

Query: 187 -FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             FR++M+HHPP    +S    +     F  M+   GADLILHGH H+ S   I      
Sbjct: 180 RPFRVVMIHHPPQPGGASPGRELKDAAAFTAMVGRAGADLILHGHNHVTSTARIAGPDGR 239

Query: 246 -IPVVGIASASQKVHSNK----PQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
            +PV+G  SAS +   +      +ASY LF I +  + + +  +R  L            
Sbjct: 240 TVPVIGAPSASARPDGHGAIASRRASYLLFEIGRAEQGYAVTARRRGLDASGTVTDLGTL 299

Query: 301 DI 302
           D+
Sbjct: 300 DL 301


>gi|299134628|ref|ZP_07027820.1| metallophosphoesterase [Afipia sp. 1NLS2]
 gi|298590438|gb|EFI50641.1| metallophosphoesterase [Afipia sp. 1NLS2]
          Length = 298

 Score =  208 bits (529), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 97/297 (32%), Positives = 146/297 (49%), Gaps = 7/297 (2%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P     EL  KR IG  NW   R     ++V   L+ D+   N DH
Sbjct: 4   FTLAHLSDPHLGPMPPARLTELLGKRAIGYANWKRRRHMIHRRDVLAQLLADLHAQNPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL SIG+ HD+S+VPGNHDAY   A+ +   +W DY+  
Sbjct: 64  IAVTGDLVNVALPAEFTQARAWLESIGSVHDVSLVPGNHDAYARVARGQFALSWADYMRG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D     G   FPYLR R  +ALIG +TA+ + PF A G  G+ Q  A   LL K   +  
Sbjct: 124 DDATEVG---FPYLRRRGPLALIGLTTAVPSAPFMATGRIGRAQLAALDSLLIKLKNEPL 180

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++++HHP          R+        ++   G DL+LHGH H ++  W++ ++    
Sbjct: 181 CRVVLVHHPLRSARGRWSARLTDAPALIDILTRHGVDLVLHGHDHRHATVWLQGQRGRFA 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEK-KNEYWTLEGKRYTLSPDSL-SIQKDYSDI 302
            +G+ SAS     +   A+Y L  I +  +  W +  +       +   ++     +
Sbjct: 241 SIGVPSASASFGGHHQPAAYQLISIARKDDGTWNISRRVRGFGGTTDGVVELKNERL 297


>gi|319781807|ref|YP_004141283.1| metallophosphoesterase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167695|gb|ADV11233.1| metallophosphoesterase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 307

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 127/285 (44%), Positives = 178/285 (62%), Gaps = 3/285 (1%)

Query: 9   MFVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P  S+ +L+ KR++G VNW  NR+++    V + ++ DI  +  D
Sbjct: 1   MFRLAHISDVHLGPLPDVSYRDLASKRVLGYVNWQRNRRRHMHDAVIDTIVADIKANTPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   + EI  + HWL ++G PHD+S+VPGNHDAY+ GA +K   +W  +++
Sbjct: 61  HLAVTGDLVNLALDGEIEMARHWLETLGPPHDVSVVPGNHDAYVPGAFDKVCRSWAAWMS 120

Query: 127 SDT-TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
            D       +  FPYLR+R N+ALIG STA AT PF ANG+F + Q     K+L+    +
Sbjct: 121 GDGVNTPVDRNAFPYLRVRGNVALIGVSTARATAPFMANGFFMEGQGDRLGKILQDTAGQ 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G FR+IM+HHPPV      + R+FGI RF K+I   GADL+LHGH+HL SL +I      
Sbjct: 181 GLFRVIMIHHPPVRGAVPQHKRLFGIARFNKIIRRHGADLVLHGHSHLPSLFFIGGRGVR 240

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSP 290
           IP VG+A+A Q      P A YNLF I+ +   W +   R  L+ 
Sbjct: 241 IPAVGVAAAGQAPGGKHPAAQYNLFDIDGEKGNWRIRLTRRGLTG 285


>gi|170744851|ref|YP_001773506.1| metallophosphoesterase [Methylobacterium sp. 4-46]
 gi|168199125|gb|ACA21072.1| metallophosphoesterase [Methylobacterium sp. 4-46]
          Length = 298

 Score =  207 bits (526), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 144/290 (49%), Gaps = 8/290 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   RK      V   L+ D+     D
Sbjct: 1   MFRLAHLTDPHVGPLSRPRLRQLLSKRATGWVNWSRGRKLTHDMAVLEALVADLRAAAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ TGD+ N     E  T+  +L ++G P  +S VPGNHDAY+ G+ +  L A   +  
Sbjct: 61  HIACTGDLCNIGLPSEWETARMFLEALGGPEAVSFVPGNHDAYVRGSLDGLLDAVGPWTR 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D     G++ FPYLR R  +AL+G S+AI T PF A+G  G  Q  A   LL    ++ 
Sbjct: 121 DDAG---GERAFPYLRRRGPLALVGLSSAIPTAPFVASGRLGTRQIAAAEALLGSLAREP 177

Query: 187 --FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP +  +     +      + MI   GADL+LHGH H+ S+ ++     
Sbjct: 178 EAPCRVVMIHHPPHVGGALPGRNLTDASAVEAMIRRVGADLVLHGHNHVGSVAFVIGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
             +PV+G  SAS +  +    A Y+L+   +    + +      L PD  
Sbjct: 238 RRVPVIGAPSASARGGALSHCAGYHLYEFARTATGYAVTATLRGLLPDDR 287


>gi|319408922|emb|CBI82579.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 294

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 120/282 (42%), Positives = 186/282 (65%), Gaps = 5/282 (1%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HLS  P     EL  KR+ G  NW   RK   +  V + L++ +     +
Sbjct: 1   MFYLAHISDVHLSPLPQPSLSELFGKRLTGYFNWQKKRKSQMTTSVLDTLMHALKKEKPN 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ I+GD+VN + ++E   +  WL + G+P +IS+  GNHDAY+ GA +K+  A++ +IT
Sbjct: 61  HLVISGDLVNLSLDKEFEQACRWLCAQGHPENISLTLGNHDAYVRGAFQKACIAFQPWIT 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D        +FPY+R+R+N+A+I  S+AIATP F A GYF + QA   S+LL +A  + 
Sbjct: 121 GDIPQ---NNVFPYMRVRDNVAIISASSAIATPFFQAAGYFDKMQAQTLSQLLNEAAARD 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            FRI+M+HHPP  + +S Y +++GI++F  +I H G +LILHGHTHL +L++I+ + K +
Sbjct: 178 LFRIVMIHHPPFHNATSWYKKLWGIEKFLDVIKHHGCELILHGHTHLPTLNFIEGKMKKV 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           P+VG++SASQ   S KP A++NLF IE+ ++ W  + +R+++
Sbjct: 238 PIVGVSSASQAFGSKKPPANFNLFAIERSHQQWHCQLQRHSI 279


>gi|315121809|ref|YP_004062298.1| putative phosphoesterase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495211|gb|ADR51810.1| putative phosphoesterase protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 294

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 210/301 (69%), Positives = 243/301 (80%), Gaps = 7/301 (2%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           MFVLAHISDIH+S   SF ELS KRIIGL NWHF RKKYFS  + +LL+NDIL HN++H+
Sbjct: 1   MFVLAHISDIHISCPLSFSELSLKRIIGLANWHFGRKKYFSHTMVDLLVNDILSHNINHL 60

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +ITGDIVN T N+EI  + HWL++I NPHDISIV GNHDAY + +K+KSL AW DYI  D
Sbjct: 61  AITGDIVNMTTNQEISEAIHWLKNIVNPHDISIVLGNHDAYTNSSKKKSLRAWSDYIAGD 120

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           T     KK FPYLR+RNNIALIGCSTAIATPPFSANGYFGQEQ H TSKLLRKA K+G F
Sbjct: 121 TPPIE-KKQFPYLRVRNNIALIGCSTAIATPPFSANGYFGQEQDHDTSKLLRKAKKEGLF 179

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++MMHHPP LDTS++YNRMFGI+RF+ MI  EGA+L+LHGHTH NSLHWI   KKLIPV
Sbjct: 180 RVVMMHHPPFLDTSTIYNRMFGIKRFKDMILREGAELMLHGHTHRNSLHWIDGAKKLIPV 239

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTLV 308
           VGIA+A      +K  ASYNLFYIEKK++ WTL GKRYTLS DS  +QK+ S+IF +TL 
Sbjct: 240 VGIAAAC-----HKKNASYNLFYIEKKHDCWTLRGKRYTLS-DSNGVQKNCSNIFNETLS 293

Query: 309 L 309
           L
Sbjct: 294 L 294


>gi|258593791|emb|CBE70132.1| putative metallo-phosphoesterase (modular protein) [NC10 bacterium
           'Dutch sediment']
          Length = 428

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 82/301 (27%), Positives = 149/301 (49%), Gaps = 8/301 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           +F +AH+SD+HL+     +  +L  KR +G ++W   R+      + + L +D+     D
Sbjct: 99  VFRVAHLSDLHLTSLVDVTIRDLLNKRALGYLSWRLRRRHEHVPAILDALRHDLSGLTPD 158

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+ ITGD+ +     E   +  WL ++G P D++I+PGNHDAY+    + +   W  Y+T
Sbjct: 159 HIVITGDLTHIGLPSEFQQAQQWLETLGAPTDVTIIPGNHDAYVRAPWDDTFALWTPYMT 218

Query: 127 SD------TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
           SD         + G+  FP +R+R ++ LIG ++A  + PF A G  G  Q      LL 
Sbjct: 219 SDPGSQTGGQQAPGESFFPSVRVRGHVVLIGATSARPSAPFFATGSLGTAQMARLGDLLD 278

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
              ++G FRI+++HHPP+        R+        ++   G ++I+HGH H + +  I 
Sbjct: 279 LTRRQGLFRILLIHHPPLAAIVQWRKRLTDGAALISLLARHGVEMIIHGHAHRSYVGHIP 338

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
           +    + V+G+ SAS +  + + +A+Y+++ +   +  W +       S +         
Sbjct: 339 SAHGEMSVIGVPSASARGANPERRAAYHVYEVRPLSHGWEVRTSVRNYSLNDRCFVAGTQ 398

Query: 301 D 301
            
Sbjct: 399 R 399


>gi|254562136|ref|YP_003069231.1| metallophosphatase/metallophosphoesterase [Methylobacterium
           extorquens DM4]
 gi|254269414|emb|CAX25380.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens DM4]
          Length = 315

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 101/299 (33%), Positives = 146/299 (48%), Gaps = 8/299 (2%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+   P     +L  KR  G VNW   R ++   ++   LI D+    VD
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQGVD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA--NK 184
           +D       +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR      
Sbjct: 121 ADDGQI---RLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPAQIEAAERVLRDLATAP 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I     
Sbjct: 178 DRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PVVG  SAS +      +ASY L+ +      + +      L       +    DI
Sbjct: 238 RPVPVVGAPSASARTLLTNRRASYYLYTVTPGENGFRIAVTERGLDEAGGIGELSGFDI 296


>gi|209886135|ref|YP_002289992.1| metallophosphoesterase [Oligotropha carboxidovorans OM5]
 gi|209874331|gb|ACI94127.1| metallophosphoesterase [Oligotropha carboxidovorans OM5]
          Length = 300

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 93/286 (32%), Positives = 142/286 (49%), Gaps = 6/286 (2%)

Query: 10  FVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P     EL  KR+IG  NW   R     ++V +LL+ D+     DH
Sbjct: 4   FTLAHLSDPHLGPMPPARLIELFGKRVIGYTNWKRRRHAIHRRDVLSLLLADLHAQRPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL ++G+  D+S+VPGNHDAY   A+ +   +W DY+  
Sbjct: 64  IAVTGDLVNVALPAEFTQARAWLETVGSAQDVSLVPGNHDAYARAARGQFALSWADYMRG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FPYLR R  +ALIG +TA+ + PF A G  G+ Q     +LL +   +  
Sbjct: 124 DGETEVH---FPYLRRRGPLALIGLTTAVPSAPFMATGRIGRAQLAGLDRLLARIATEPL 180

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++++HHP          R+        ++   G +L+LHGH H ++  W K  +    
Sbjct: 181 CRVVLIHHPLRSAPGRWSARLTDAPALIALLERHGVNLVLHGHDHRHATVWFKGSRGRFA 240

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNE-YWTLEGKRYTLSPDS 292
            +G+ SAS     +   A+Y L   E+     WT+  +      D+
Sbjct: 241 SIGVPSASASTGGHHQAAAYQLISFEEDAAKGWTISRRVRGFGSDA 286


>gi|163852389|ref|YP_001640432.1| metallophosphoesterase [Methylobacterium extorquens PA1]
 gi|163663994|gb|ABY31361.1| metallophosphoesterase [Methylobacterium extorquens PA1]
          Length = 331

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 101/301 (33%), Positives = 147/301 (48%), Gaps = 8/301 (2%)

Query: 7   TIMFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           + MF LAH++D H+   P     +L  KR  G VNW   R ++   ++   LI D+    
Sbjct: 15  SRMFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQG 74

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
           VDHV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +
Sbjct: 75  VDHVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGW 134

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA-- 182
             +D       +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR    
Sbjct: 135 TEADDGQI---RLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPVQIEAAERVLRDLAT 191

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
                 R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I   
Sbjct: 192 APDRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGP 251

Query: 243 KK-LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
               +PVVG  SAS +      +ASY L+ +      + +      L       +    D
Sbjct: 252 DGRPVPVVGAPSASARTLLTNRRASYYLYTVTPGENGFQIAVTERGLDEAGGIGELSGFD 311

Query: 302 I 302
           I
Sbjct: 312 I 312


>gi|110634536|ref|YP_674744.1| metallophosphoesterase [Mesorhizobium sp. BNC1]
 gi|110285520|gb|ABG63579.1| metallophosphoesterase [Chelativorans sp. BNC1]
          Length = 307

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 127/302 (42%), Positives = 179/302 (59%), Gaps = 4/302 (1%)

Query: 9   MFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH SDIHL   P   + EL  KRI G +NWH  R+      + +L+ NDIL    D
Sbjct: 1   MFRLAHFSDIHLGPLPELSYRELISKRITGYINWHRRRRVNLDNGIIDLISNDILASAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN   +REI  +  WL S+G P DIS+VPGNHDAY+  A  K+  AW  Y+T
Sbjct: 61  HIALTGDLVNLALDREIEMAQLWLESLGTPADISVVPGNHDAYVPHALNKACRAWGAYMT 120

Query: 127 SDTTCS-TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           +D     T +  FPY+R+R  +A+IG S+A AT PF A+GYF +EQ     +LL +A  +
Sbjct: 121 ADGAEPITDRHQFPYMRVRGPVAIIGLSSARATAPFLASGYFTEEQESRACELLEEAADR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK- 244
             FR++++HHPPV   +  + R+FGI RFQ M+   GA+L+LHGHTHL ++H I      
Sbjct: 181 KLFRVLLIHHPPVRGATGQHKRLFGISRFQSMVRKYGAELVLHGHTHLPTVHRIDGSNGA 240

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
            +PVVG+A+A Q   +  P A YNLF I      W ++  R  ++     + +  +    
Sbjct: 241 SVPVVGVAAAGQAHGAALPAAHYNLFEIMGAPGTWQVQLIRRGVAEPGGKVVQLSTQWLI 300

Query: 305 DT 306
            T
Sbjct: 301 ST 302


>gi|218531148|ref|YP_002421964.1| metallophosphoesterase [Methylobacterium chloromethanicum CM4]
 gi|218523451|gb|ACK84036.1| metallophosphoesterase [Methylobacterium chloromethanicum CM4]
          Length = 315

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 101/299 (33%), Positives = 146/299 (48%), Gaps = 8/299 (2%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+   P     +L  KR  G VNW   R ++   ++   LI D+    VD
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQGVD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA--NK 184
           +D       +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR      
Sbjct: 121 ADDGQI---RLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPVQIEAAERVLRDLATAP 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I     
Sbjct: 178 DRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PVVG  SAS +      +ASY L+ +      + +      L       +    DI
Sbjct: 238 RPVPVVGAPSASARTLLTNRRASYYLYTVTPGENGFRIAVTERGLDEAGGIGELSGFDI 296


>gi|316935907|ref|YP_004110889.1| metallophosphoesterase [Rhodopseudomonas palustris DX-1]
 gi|315603621|gb|ADU46156.1| metallophosphoesterase [Rhodopseudomonas palustris DX-1]
          Length = 293

 Score =  204 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 95/298 (31%), Positives = 152/298 (51%), Gaps = 8/298 (2%)

Query: 8   IMFVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
            +F LAH+SD HL   P      L+ KR +G +NW  NR +   +++ + L+ D+     
Sbjct: 2   TVFTLAHLSDPHLPLPPKTGLRHLASKRALGYLNWRRNRHQIHRRDILDRLVADLQAQQP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGD++N     E   +  WL S+G    +S+VPGNHDAY+     +    + DYI
Sbjct: 62  DHIAVTGDLMNIALLNEFAPARQWLESVGPADRVSLVPGNHDAYVRSTAHRFAETFPDYI 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           + D         FPYLR R  IA+IG S+A+ T P  A G+ G  Q  A   LL+  + +
Sbjct: 122 SGDDAVP----GFPYLRRREGIAIIGVSSAVPTAPLRATGWLGAAQRAALETLLQSLSGE 177

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             F+++++HHP    +   + R+        ++     DL+LHGH H+++   I+     
Sbjct: 178 RVFKVLLIHHPLQSRS--RHKRLTDSAELIALLQRHPVDLVLHGHDHVHATVRIETPSGA 235

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           IPVVG+ SAS     ++P A+YNLF I + N+ W  E +          +     ++ 
Sbjct: 236 IPVVGVPSASAMNDRHRPSAAYNLFKISEGNDGWRCEHRVRGFQASEQIVDVRPPEML 293


>gi|240139723|ref|YP_002964200.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens AM1]
 gi|240009697|gb|ACS40923.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens AM1]
          Length = 315

 Score =  204 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 101/299 (33%), Positives = 146/299 (48%), Gaps = 8/299 (2%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+   P     +L  KR  G VNW   R ++   ++   LI D+    VD
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRSRHHDMDLLGALIADLHGQGVD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGWTE 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA--NK 184
           +D       +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  ++LR      
Sbjct: 121 ADDGQI---RLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGPVQIEAAERMLRDLATAP 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP    ++    +     F  MI   GADLILHGH H+ ++  I     
Sbjct: 178 DRPCRVVMIHHPPHPGGAASGRELKDAAAFAAMIGRAGADLILHGHNHVGTVARITGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PVVG  SAS +      +ASY L+ +      + +      L       +    DI
Sbjct: 238 RPVPVVGAPSASARTLLTNRRASYYLYTVTPGENGFRIAVTERGLDEAGGIGELSGFDI 296


>gi|188582396|ref|YP_001925841.1| metallophosphoesterase [Methylobacterium populi BJ001]
 gi|179345894|gb|ACB81306.1| metallophosphoesterase [Methylobacterium populi BJ001]
          Length = 316

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 104/299 (34%), Positives = 147/299 (49%), Gaps = 8/299 (2%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+   P     +L  KR  G VNW   R  +   ++   LI D+     D
Sbjct: 1   MFRLAHLTDPHVGPLPRPRLRQLLSKRAAGYVNWRRGRCHHHDMDLLGALIADLHGQGAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           HV+ TGD+ N     E  ++  +L ++G    +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HVACTGDLCNLGLPDEWESARLFLEALGPGERVSFVPGNHDAYVRGSLEGLLAACGGWTA 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK--ANK 184
           +D   S   +LFPYLR R  +AL+G S+AI T PF A+G  G  Q  A  +LLR   A  
Sbjct: 121 ADDGQS---RLFPYLRRRGPLALVGLSSAIPTKPFVASGRLGSVQIDAAERLLRDLAAAP 177

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP    ++    +     F  MI   GADLILHGH H+ S+  I     
Sbjct: 178 DRPCRVVMIHHPPHPGGAAAGRELKDAADFAAMIGRAGADLILHGHNHVGSVAQILGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
             +PVVG  SAS +      +ASY L+ +   +  + +      L       +    DI
Sbjct: 238 RPVPVVGAPSASARTLLTNRRASYYLYTVTPHDSGYRIGVTERGLDEAGGIGELSGFDI 296


>gi|217978415|ref|YP_002362562.1| metallophosphoesterase [Methylocella silvestris BL2]
 gi|217503791|gb|ACK51200.1| metallophosphoesterase [Methylocella silvestris BL2]
          Length = 300

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 96/289 (33%), Positives = 152/289 (52%), Gaps = 6/289 (2%)

Query: 8   IMFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           ++F LAH++D H+   P     EL  KR+ G +NW   R         + ++ D+   N 
Sbjct: 4   VLFRLAHLTDPHIGPLPRPRRRELLGKRVTGYLNWRRGRHLVHDMATLSHIVADVKAQNP 63

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGDI N     E   +  WL ++G   D+S VPGNHDAY+ G+      A+  + 
Sbjct: 64  DHIAMTGDIANIGLPAEFQLARKWLETLGPSEDVSFVPGNHDAYVRGSLPDLARAFAPWT 123

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           T +T        +PYLR+R N+ALIG S+A+ TP F A+G  G+ Q      +L     +
Sbjct: 124 TGETETP---ARYPYLRVRGNVALIGLSSAVPTPFFIASGRLGRRQLEWADAMLADCATR 180

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK-NEKK 244
              R++M+HHPP +D + L   +   + F++MIW  GA+LILHGH H  S+ ++     +
Sbjct: 181 DLIRVVMLHHPPQVDAAGLARGLIDAREFEEMIWRRGAELILHGHNHKTSVTYLDAGRSR 240

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
             PVVG  SAS    + + +A Y++F I    + + ++     + P   
Sbjct: 241 KTPVVGAPSASSARLAARHRAGYHVFEIAGHLQDYEIKAYARGVLPTGA 289


>gi|39937451|ref|NP_949727.1| metallophosphoesterase [Rhodopseudomonas palustris CGA009]
 gi|39651310|emb|CAE29832.1| Metallo-phosphoesterase [Rhodopseudomonas palustris CGA009]
          Length = 293

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 96/296 (32%), Positives = 148/296 (50%), Gaps = 8/296 (2%)

Query: 10  FVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P      L+ KR +G +NW  NR     +++ + L+ D+     DH
Sbjct: 4   FTLAHLSDPHLPLPPKTSLRHLASKRALGYLNWRRNRHLIHRRDILDTLVADLQAQQPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL S+G    +S+VPGNHDAY+     +    + DYI+ 
Sbjct: 64  IAVTGDLVNIALVNEFAPARQWLESVGPADRVSLVPGNHDAYVRSTAHRFAETFPDYISG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FPYLR R  IA+IG S+A+ T P  A G+ G  Q  A   LL+    +  
Sbjct: 124 DDATP----GFPYLRRREAIAIIGVSSAVPTAPLRATGWLGAPQRAALEALLQSLAGERV 179

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           F+++++HHP    +   + R+        ++     DL+LHGH H+++   I      IP
Sbjct: 180 FKVLLIHHPLQSRS--RHKRLTDAADLIALLQRHPVDLVLHGHDHVHATVRIDTPFGAIP 237

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           VVG+ SAS     ++P A+YNLF I + N+ W  E +          +     ++ 
Sbjct: 238 VVGVPSASAMNDRHRPSAAYNLFKISEGNDGWRCEHRIRGFQASEQIVDLRAPELL 293


>gi|182680342|ref|YP_001834488.1| metallophosphoesterase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182636225|gb|ACB96999.1| metallophosphoesterase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 306

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 103/297 (34%), Positives = 152/297 (51%), Gaps = 12/297 (4%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F+LAH+SD H+   P     EL  KR+ G +NW   R      E    L+ D+  H+ DH
Sbjct: 3   FLLAHLSDPHIGPLPVPRRRELLGKRLTGYLNWQRGRSTAHDMETLGRLVADLKSHHPDH 62

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGDI+N     E      WL S+G P ++S VPGNHDAY+ GA       +K +   
Sbjct: 63  IAVTGDILNLGLAAEFPLGRLWLESLGQPENVSFVPGNHDAYVRGALPDLARTFKPWTAG 122

Query: 128 DTT--------CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
           +           S    L+PYLR R  +ALIG ++ +  PPF A+G  G++Q      LL
Sbjct: 123 EHPLGESLPFGQSMATALYPYLRRRGPVALIGLASGVPMPPFIASGRLGRQQLAGAETLL 182

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI 239
           ++A  +   R+IM+HHPP  +       +   + F +MI   GA+LILHGH H  S+ ++
Sbjct: 183 KEAAAQNCIRVIMLHHPPWAEG-KFGRGLVDARPFAEMIGRVGAELILHGHEHRPSVTYL 241

Query: 240 KNEKK-LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
              K   +P+VG+ SAS    S    A+Y+LF IE       ++   + L  D  +I
Sbjct: 242 TGPKGRRVPIVGVPSASLVRGSPYRYAAYHLFAIEGTGAEPRIKASAWGLLADGKTI 298


>gi|298292489|ref|YP_003694428.1| metallophosphoesterase [Starkeya novella DSM 506]
 gi|296929000|gb|ADH89809.1| metallophosphoesterase [Starkeya novella DSM 506]
          Length = 308

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 100/306 (32%), Positives = 160/306 (52%), Gaps = 8/306 (2%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MFVLAH++D HL   P     EL+ KR +G++NW   R+  F+    +LL+ DI     D
Sbjct: 1   MFVLAHVTDAHLGPLPRARFAELAGKRALGVINWRRGRQHRFNIATIDLLVADIKAMAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     E  T  ++LRS+G+ HD+++VPGNHDAY+      SL  W DY+ 
Sbjct: 61  HIAVTGDLVNVGLAAEFATGLNFLRSLGDGHDVTVVPGNHDAYVRSTAHHSLLNWGDYMR 120

Query: 127 SDT--TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
            D      T ++ FP++R R+ +ALIG STA+ T PF A G  G+ Q     K+L +   
Sbjct: 121 GDGVNGDVTAEEAFPFVRRRDGVALIGVSTAVPTHPFMATGKVGKAQRARLGKVLDELAA 180

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK- 243
           +G FR++M+HHPP     + + R+   +  +++    GA+LI+ GH H+  +  +     
Sbjct: 181 EGLFRVVMIHHPP-CGWRAGHKRLIDEEAVREVFARHGAELIICGHDHVPMVEMLPGPHS 239

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY--WTLEGKRYTLSPDSLSIQKDYSD 301
            LIPVV   S +           Y+L+ IE+ +    W    +         ++      
Sbjct: 240 GLIPVVEAPSFAAGPDDRHWPGGYHLYRIERIDAAFPWRCTLEARGFQRGEANVATRTVR 299

Query: 302 IFYDTL 307
           +  + +
Sbjct: 300 VLTEAI 305


>gi|197105520|ref|YP_002130897.1| hypothetical protein PHZ_c2057 [Phenylobacterium zucineum HLK1]
 gi|196478940|gb|ACG78468.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 303

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 87/291 (29%), Positives = 150/291 (51%), Gaps = 10/291 (3%)

Query: 10  FVLAHISDIHLSYSPS---FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           F LAH+SD HL          +++ KR +  + W   R +  S  V + LI D+     D
Sbjct: 4   FRLAHLSDPHLPPPARALRLADMASKRALSRLAWRRKRHR-HSPAVLDALIADLRRCAPD 62

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ITGD+ NF  + E   +  WLR++G+P  +++ PGNHDA ++         W  ++ 
Sbjct: 63  HIAITGDLTNFATHEEFAAAAEWLRTLGDPASVTVSPGNHDALVAHRTPDRFAPWAPWLG 122

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                 T +  FP++R+R  +A++   TA+ T    A G  GQ+Q       LR+A  +G
Sbjct: 123 -----DTPQADFPHVRVRGCVAIVNACTAVPTAWRLAQGALGQDQIARLEAALRRAKAEG 177

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            +RI+++HHPP     S    +    RF+ ++   GA+L+LHGH H   LH I   +  I
Sbjct: 178 LYRIVLLHHPPAEGAVSARKALTDAGRFRAVLEAVGAELVLHGHAHDALLHRIPGPQGAI 237

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
           PV+G+ SAS     + P A + L  + +++  ++   +   ++P   ++++
Sbjct: 238 PVLGVPSASAPPGGHDPAAQWRLIEVTRRSGGFSTRIEARGIAP-GNTVER 287


>gi|301058950|ref|ZP_07199919.1| Ser/Thr phosphatase family protein [delta proteobacterium NaphS2]
 gi|300446946|gb|EFK10742.1| Ser/Thr phosphatase family protein [delta proteobacterium NaphS2]
          Length = 350

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 95/297 (31%), Positives = 147/297 (49%), Gaps = 8/297 (2%)

Query: 10  FVLAHISDIHLS--YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           FVLAH+SD H++        +L  KR+ G + W F R     +E+  +L  D+     DH
Sbjct: 28  FVLAHLSDPHMAWAGPVKKRDLLNKRLAGYLKWRFFRNTEHRREILTILKEDLDNTRPDH 87

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           + ITGD+ +     E   +  WL+S+G P  +++VPGNHDAY+    +++   W DY+ S
Sbjct: 88  IVITGDLTHLGLPAEFKKARTWLQSLGTPSQVTVVPGNHDAYVRSDWDRTFACWLDYMRS 147

Query: 128 DTTCSTG------KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
           D  C  G        LFP LR+R  IALIG  +A  + P  A G  G  Q      +L++
Sbjct: 148 DPPCRNGGRVRGLDDLFPTLRVRGRIALIGLCSAHPSAPHLAIGTVGGPQLRKLETVLKQ 207

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
              +G FRI+ +HHPP+    S   R+      + ++   GA+L+LHGH H  +L+ +  
Sbjct: 208 TGDRGLFRIVAIHHPPLSGIVSRRKRLTDAHALRGVVARCGAELMLHGHAHRMALNTLDT 267

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD 298
                PV G  SAS     ++ +A Y++F +        +   R   SPD+     +
Sbjct: 268 RSGRTPVAGAPSASSSSSDHQRRARYHVFTLTASENACNVHMGRRVYSPDARCFIPE 324


>gi|163758543|ref|ZP_02165630.1| hypothetical protein HPDFL43_14007 [Hoeflea phototrophica DFL-43]
 gi|162283833|gb|EDQ34117.1| hypothetical protein HPDFL43_14007 [Hoeflea phototrophica DFL-43]
          Length = 291

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 122/272 (44%), Positives = 164/272 (60%), Gaps = 1/272 (0%)

Query: 22  YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNR 81
              S  EL+ KRI G +NW  NR+K+        L++ +     DHV+ITGD+VN     
Sbjct: 5   PRVSPAELASKRITGYLNWQRNRRKHLFGNTLEQLLDGMRAEAPDHVAITGDLVNLATRT 64

Query: 82  EIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYL 141
           EI  +  WL +  +P + + VPGNHDAY+ GA  +S  AW+ +I SD   S G KLFP  
Sbjct: 65  EIEAARLWLETHFDPANATFVPGNHDAYVPGAFARSTEAWEPWIASDNPASQG-KLFPNC 123

Query: 142 RIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDT 201
           R R  +ALIG STA AT PF A G FG +QA A  KLL +A+  G FR++M+HHPPV   
Sbjct: 124 RRRGPVALIGLSTANATLPFMATGDFGHKQAIAAGKLLDQAHDDGLFRVLMIHHPPVRGA 183

Query: 202 SSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSN 261
           +  + RM G   F KM+   GA+L+LHGHTHL++LH++      +PVVGIASASQ   S+
Sbjct: 184 TRWHKRMRGTGHFSKMLKLHGAELVLHGHTHLDTLHYLAGRHGDVPVVGIASASQGPDSH 243

Query: 262 KPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
           +P A +N+F I+   + W L  +R  LS D  
Sbjct: 244 RPTAGFNMFEIDGDRDTWKLVHRRMKLSGDGA 275


>gi|220927299|ref|YP_002502601.1| metallophosphoesterase [Methylobacterium nodulans ORS 2060]
 gi|219951906|gb|ACL62298.1| metallophosphoesterase [Methylobacterium nodulans ORS 2060]
          Length = 298

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 99/290 (34%), Positives = 146/290 (50%), Gaps = 8/290 (2%)

Query: 9   MFVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAH++D H+     P   +L  KR  G VNW   R +     V   LI D+L    D
Sbjct: 1   MFRLAHLTDPHVGPLSKPRLRQLLSKRATGWVNWTRGRHRTHDMAVLEALIADLLAAAPD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H++ TGD+ N     E  T+  +L ++G P  +S VPGNHDAY+ G+ E  L A   +  
Sbjct: 61  HIACTGDLCNIGLPSEWETARVFLEALGGPEAVSFVPGNHDAYVRGSLEGLLGAVGPWTR 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D      ++ FPYLR R  +AL+G S+AI T PF A+G  G  Q  A   LL    ++ 
Sbjct: 121 DDAGR---ERAFPYLRRRGPLALVGLSSAIPTAPFVASGRLGSRQLAAAEALLGSLAREP 177

Query: 187 --FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
               R++M+HHPP +  +     +     F+ +I   GADL+LHGH H+ S+ ++     
Sbjct: 178 ERPCRVVMIHHPPHVGGALPGRNLTDSSAFEAVIRRVGADLVLHGHNHVGSVAFLIGPDG 237

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
             +PV+G  SAS +  +    A Y+L+  E+    + +      L PD  
Sbjct: 238 RRVPVIGAPSASARGGTLTHCAGYHLYGFERTATGYAVTATLRGLLPDER 287


>gi|209964083|ref|YP_002296998.1| phosphoesterase, putative [Rhodospirillum centenum SW]
 gi|209957549|gb|ACI98185.1| phosphoesterase, putative [Rhodospirillum centenum SW]
          Length = 323

 Score =  194 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 82/294 (27%), Positives = 131/294 (44%), Gaps = 8/294 (2%)

Query: 10  FVLAHISDIHLS---YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
              AH +D HL      P +  L  KR+ G ++W   R +    EV   L++DI     D
Sbjct: 4   LRFAHFTDPHLPLPPAGPGWTALLSKRLFGYLSWRRRRHRIHRPEVLAALLDDIRARKPD 63

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+  TGD+ N +   E   +  WL +   P D+++VPGNHDA +     + L  W+ ++ 
Sbjct: 64  HLVCTGDLANISLPAEFERARVWLEATAAPRDLTLVPGNHDALVPVPWVRGLGLWEPWMR 123

Query: 127 SDTTC-----STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
            D        + G+ LFP LR+R  +A IG S+A+ T P  A G  GQ Q      LL++
Sbjct: 124 GDPGTGPDGTAGGEGLFPSLRVRGAVAFIGLSSAVPTAPLLATGRVGQTQLRRLEALLQE 183

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
               G +R++++HHP    T      +      + ++   GA+L+LHGH H      +  
Sbjct: 184 QGAAGRYRVVLLHHPLADGTVRARKALTDRAAVRAVLARAGAELVLHGHAHCARFAALPG 243

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
               IP +   SAS   H     A ++L  + +  + W            + + 
Sbjct: 244 PLGPIPSLTAPSASAVAHGRYDAARWSLVEVRRTPDGWRTAVTVRGWEASAGAF 297


>gi|296115282|ref|ZP_06833922.1| putative metallophosphoesterase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978185|gb|EFG84923.1| putative metallophosphoesterase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 303

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 89/286 (31%), Positives = 146/286 (51%), Gaps = 14/286 (4%)

Query: 12  LAHISDIHLSYSP---SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           +AH SD HL+         +L  KR++  ++W   R+          ++ DI  HNVD +
Sbjct: 6   IAHASDPHLAIDTLRIRAGDLLNKRVLSYLSWQRRRR-IHRTAALQRVMEDIAAHNVDML 64

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD+ N     E   +  WL  +  P  +++VPGNHDA +S     ++  W  ++   
Sbjct: 65  ALTGDLTNLGLPDECAQAERWLSRL--PMPVTVVPGNHDALVSSDWHATIGRWSPWM--- 119

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G   FP++R    +ALIG ++A  TP F+A+G  G  QA   + +L +  ++G  
Sbjct: 120 -----GPLPFPFVRRVGPVALIGLNSAHPTPCFNASGDIGAHQAARLAAVLEETGQQGLC 174

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R+IM+HHPP+   +S    +    RF   I   GA+L+LHGHTH+++L  +      +PV
Sbjct: 175 RVIMIHHPPLAHLTSRRKSLRDAGRFGACIAQHGAELVLHGHTHVSTLATLPGRNGPVPV 234

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLS 294
           +G+ASAS         AS+NL ++      + +E  R  + PD  +
Sbjct: 235 MGVASASTDTSDPARAASWNLVHVSSFMTGYRMEITRRIMLPDGKA 280


>gi|16125410|ref|NP_419974.1| hypothetical protein CC_1158 [Caulobacter crescentus CB15]
 gi|221234153|ref|YP_002516589.1| Icc family phosphohydrolase [Caulobacter crescentus NA1000]
 gi|13422478|gb|AAK23142.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220963325|gb|ACL94681.1| phosphohydrolase, Icc family [Caulobacter crescentus NA1000]
          Length = 305

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 87/294 (29%), Positives = 134/294 (45%), Gaps = 12/294 (4%)

Query: 9   MFVLAHISDIHLSYSPS---FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           ++ +AH+SD HL   P      ++  KR++  + W   R K    EV   L+ D+     
Sbjct: 3   IYRIAHLSDPHLPPPPGAFGLRDVFTKRLLSRIAWRKKR-KVHRPEVLAALVADLQATAP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV I+GD+ NF    EI T+  WL  +G   D ++ PGNHDA       +    W  ++
Sbjct: 62  DHVVISGDLTNFASPVEIATARSWLEGLGAASDHTVSPGNHDALAGVGGPERFAIWSPWL 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                  TG+  FP +R+R  +A+    +A+ T P  A G  GQ+Q       L      
Sbjct: 122 G-----DTGEASFPQVRVRGPVAIFNLCSAVPTAPHLATGRLGQDQIERLDAALSDPAYA 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK- 244
             FR++++HHPP     S   R+      + ++   GADL+LHGH H   +  +      
Sbjct: 177 SLFRLVVLHHPPHPGAVSKRKRLEDQDALRAVLARHGADLVLHGHAHEALVGSLPGPGGA 236

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT-LEGKRYTLSPDSLSIQK 297
            IPV+G+ SAS K   + P A ++   IE + E    +      LS     I +
Sbjct: 237 TIPVLGVPSASAKPSRHAP-ARWHQIEIEPRPEGGHAVRVVARGLSETGTEITE 289


>gi|295690094|ref|YP_003593787.1| metallophosphoesterase [Caulobacter segnis ATCC 21756]
 gi|295431997|gb|ADG11169.1| metallophosphoesterase [Caulobacter segnis ATCC 21756]
          Length = 302

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 83/294 (28%), Positives = 140/294 (47%), Gaps = 12/294 (4%)

Query: 9   MFVLAHISDIHLSYSPS---FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           ++ +AH+SD HL   P    + ++  KR++  + W   R K    EV + L+ D+     
Sbjct: 3   IYRIAHLSDPHLPPPPGAFGWKDVFTKRLLSRIAWRKKR-KVHRPEVLSALVADLKASAP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV I+GD+ NF  + EI  +  WL S+G P D ++ PGNHDA       +    W  ++
Sbjct: 62  DHVVISGDLTNFASHTEIAAARKWLESLGEPTDFTVSPGNHDALAGAGGPERFAIWAPWL 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D      +  FP +R+R  +A+    +A+ T P  A G  G+EQ       L      
Sbjct: 122 GDDG-----ESRFPQVRLRGPVAIFNLCSAVPTAPHLATGRLGEEQLRKLDAALADPAYD 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK- 244
           GFF+++++HHPP     S    +      ++++   GADL+LHGH H   L  ++     
Sbjct: 177 GFFKLVVLHHPPHEGAVSKRKSLDDGHALREVLERRGADLVLHGHAHEALLGALRGPDGA 236

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKK-NEYWTLEGKRYTLSPDSLSIQK 297
            +PV+G+ SAS + + + P A +N   IE +    + +      +      + +
Sbjct: 237 TVPVLGVPSASARPNRHGP-ARWNAIEIEPRAAGGFDVRIVSRGIEAGREGLTE 289


>gi|167645645|ref|YP_001683308.1| metallophosphoesterase [Caulobacter sp. K31]
 gi|167348075|gb|ABZ70810.1| metallophosphoesterase [Caulobacter sp. K31]
          Length = 307

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 80/287 (27%), Positives = 143/287 (49%), Gaps = 11/287 (3%)

Query: 9   MFVLAHISDIHLSYS---PSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +F LAHISD+HLS       + +L  KR++  + W   + +    E+   ++ D++    
Sbjct: 3   IFRLAHISDLHLSPPKGAFGWRDLLSKRLLSRIAW-RRKHREHRPEILARVVADLIAQAP 61

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DHV+ITGD+ N+    E   +  WL ++G   D+++ PGNHDA +     ++  AW  ++
Sbjct: 62  DHVAITGDLTNYASPAEFEAARLWLETLGPSRDVTVSPGNHDALVDAEGVEAFAAWTPWL 121

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                   G+  FP +R+R+ +A+    +A+ T P  A G  G+ Q    + LL     +
Sbjct: 122 G-----DAGETRFPQVRVRDGVAVFNLCSAVPTAPHLATGRLGEAQLRRLAALLSDPAYR 176

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             FR++++HHPP+    +    +  +   + ++  +GADLILHGH H   +  +   +  
Sbjct: 177 DDFRVLLIHHPPIPGAVARRKSLEDVDALRAVLAEQGADLILHGHAHDAMVATVPGPRGA 236

Query: 246 -IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYW-TLEGKRYTLSP 290
            IPV+G+ SAS       P A ++   I ++ +    ++     L P
Sbjct: 237 MIPVLGVPSASAMGGRGHPAARWHAVEIAREADGRIEVKVVARGLDP 283


>gi|118581152|ref|YP_902402.1| metallophosphoesterase [Pelobacter propionicus DSM 2379]
 gi|118503862|gb|ABL00345.1| metallophosphoesterase [Pelobacter propionicus DSM 2379]
          Length = 332

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 96/298 (32%), Positives = 151/298 (50%), Gaps = 8/298 (2%)

Query: 10  FVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           FVLAH+SD HLS  P     +L  KR++G  +W+  R+      V + L+ND+     DH
Sbjct: 27  FVLAHLSDPHLSPLPGVHPRDLLNKRLLGYFSWYRRRRHIHCPHVLDALLNDLAQAAPDH 86

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V+ITGD+ N     E   +  WL  +G+P  + +VPGNH+ Y++    ++   W DY+  
Sbjct: 87  VAITGDLTNLGLPDEFRQAARWLERVGSPARVMVVPGNHECYVAAPWRETFGRWADYLAG 146

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D   + G   +P LR+R  +ALIG STA  + PF A G  G+EQ      LL +  ++G 
Sbjct: 147 DGAVADGV--YPRLRVRGGVALIGLSTARPSLPFMAVGSLGKEQLDRLEDLLEQTGRRGL 204

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++++HHPPV  + +   R+     F  +I  +GA+LILHGH H++    +      +P
Sbjct: 205 LRVVLLHHPPVPGSIAWRKRLTDASGFAAVIGRQGAELILHGHAHVSMEREL--VAGTVP 262

Query: 248 VVGIASASQKVHSNKP--QASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           V G++S+S     + P   ASY L+   ++ + W +       S              
Sbjct: 263 VFGVSSSSSSSSQSAPLRTASYTLYRFRRRGDVWEVLLSVRIYSHRESRFVLAREREL 320


>gi|300023904|ref|YP_003756515.1| metallophosphoesterase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525725|gb|ADJ24194.1| metallophosphoesterase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 301

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 94/289 (32%), Positives = 153/289 (52%), Gaps = 8/289 (2%)

Query: 10  FVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH SD+H+S      +   + KR++G +NW   R++     VA+ LI D      DH
Sbjct: 5   FTLAHFSDVHMSPVVGFGWRYWNAKRVLGYLNWQRKRRRVHVTAVADRLIADAHSLRPDH 64

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           ++ITGD+VN     E   +  WLRS+G+P  +++VPGNHD Y S   ++ +  W  Y+  
Sbjct: 65  IAITGDLVNLGLPAEHEAALAWLRSVGSPASVTVVPGNHDIYSSMHGDRGVVRWAAYMGG 124

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           +         FP++R    +AL+G ++A+ TPPF A+G  G  Q     + L + ++ G 
Sbjct: 125 EE----DTLAFPFVRRVGPLALVGLNSAVETPPFFASGSLGSHQLEIAREQLLRLDEDGA 180

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            R++++HHPP+ D ++   R+     F  ++   GA+L+L+GH H  ++ W+ + KK IP
Sbjct: 181 IRVVLIHHPPLADMTTPRRRLNDAAHFAHLLERTGAELVLYGHNHTPAIDWLPSRKKPIP 240

Query: 248 VVGIASASQKVHSNKPQ-ASYNLFYIEKKNEYWTLEGKRYTL-SPDSLS 294
           ++G ASAS          A YNLF   + +    +      L +PD   
Sbjct: 241 LIGAASASAGTEHGDEPLARYNLFTFFRSSSGLRIRHVVRGLETPDGPV 289


>gi|330994317|ref|ZP_08318245.1| metallophosphoesterase [Gluconacetobacter sp. SXCC-1]
 gi|329758784|gb|EGG75300.1| metallophosphoesterase [Gluconacetobacter sp. SXCC-1]
          Length = 305

 Score =  189 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 85/296 (28%), Positives = 143/296 (48%), Gaps = 14/296 (4%)

Query: 11  VLAHISDIHLS---YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
            +AH+SD HL      P   +   KR+   ++W  +R+     E+   ++ D+    VD 
Sbjct: 5   TIAHLSDPHLPTEMAPPRLADRLNKRMFSHISWRRHRRFIHRPEILARVMADMAATPVDM 64

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+ N     E   +  WL  +  P   +++PGNHD  +    ++++  W+ ++  
Sbjct: 65  IAVTGDLTNMGLPGECRNALRWLERM--PAPCTVIPGNHDTLVHADWQQTVGLWQPWM-- 120

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                 G   FP++R   ++ALIG S+A+ TP F A G  G  QA     LL +  ++G 
Sbjct: 121 ------GALPFPFVRRVGSVALIGVSSAVPTPWFRATGTLGVRQAARLRTLLHETGRQGL 174

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            RI+M+HHPPV   +     +     F   I HEGA+++LHGH H +S+  +   +  +P
Sbjct: 175 CRIVMIHHPPVAGLAVARKALRDPDNFAACIAHEGAEMVLHGHIHTSSISSLPGPQGAVP 234

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           V+GIASAS +       A +N   + + +  + L   R    PD          +F
Sbjct: 235 VLGIASASARSADPLRAAGWNRITVHRGDTGYALGVTRRCF-PDGGQAVTSQETVF 289


>gi|85703077|ref|ZP_01034181.1| hypothetical protein ROS217_20087 [Roseovarius sp. 217]
 gi|85672005|gb|EAQ26862.1| hypothetical protein ROS217_20087 [Roseovarius sp. 217]
          Length = 319

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 93/296 (31%), Positives = 149/296 (50%), Gaps = 7/296 (2%)

Query: 11  VLAHISDIHL--SYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
            LAH+SD HL  +    +  +  KR + L++WH  R+ +   E+   LI D+  H  D +
Sbjct: 16  TLAHLSDPHLPLTGPVPWRAVLNKRALSLLSWHRKRRHHHRPEILAALIADMQRHAPDLI 75

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD+ N     E   +  WL S+GNP  + ++PGNHDA I GA E     W  Y   D
Sbjct: 76  AVTGDLTNLGLESEYRAARRWLESLGNPARVMVIPGNHDALIRGAWEAGAAQWHPYWQGD 135

Query: 129 TTCSTG--KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
              +T      FPY+R R  +ALIG S+A+ATPP  A+G  G  Q    + LLR A  +G
Sbjct: 136 AAPATAHVSDAFPYMRRRGMLALIGVSSAVATPPAFASGAVGPAQLARLAHLLRAARDEG 195

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
             R++M+HHPP+  T S    +      ++++  EG +L+LHGH+H      +       
Sbjct: 196 LCRVMMIHHPPLDGTVSARKALRDGAALRRVLQAEGVELVLHGHSHRTHHQTLATRDGAA 255

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
            V+G+ SAS         A+Y+L+++   +  W ++      +  +    +  + +
Sbjct: 256 AVIGVPSASSLSPE---AAAYHLYHLTPMSGGWVIDVTARHATRAAEMAARHRTQL 308


>gi|254470109|ref|ZP_05083513.1| metallo-phosphoesterase [Pseudovibrio sp. JE062]
 gi|211960420|gb|EEA95616.1| metallo-phosphoesterase [Pseudovibrio sp. JE062]
          Length = 270

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 94/253 (37%), Positives = 145/253 (57%), Gaps = 5/253 (1%)

Query: 48  FSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD 107
            +    + LI DI     DH+++ GD+VN    +E+  +  WL ++G+P ++S+ PGNHD
Sbjct: 1   MTNSYLDALIRDIHAQQPDHIALCGDLVNIALPKEVAGAKDWLATVGSPENLSLTPGNHD 60

Query: 108 AYISGAKEKSLHAWKDYITSDT-----TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFS 162
           AY+ GA +++  AW+ Y+ SD              FP++R R+N+ +IG STA AT PF 
Sbjct: 61  AYVPGALKQAYGAWRPYMQSDPDLGLTPPLGTDPHFPFVRRRSNVTIIGLSTAKATGPFM 120

Query: 163 ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG 222
           A G+    Q    +  LR A ++G FR++M+HHPPV + +S Y R+ G  RF+ +I   G
Sbjct: 121 ATGHISANQLRELADQLRHAKERGDFRVVMLHHPPVRNATSWYKRLVGSSRFRNIIAEHG 180

Query: 223 ADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           A+LILHGHTH  +   I   +  +PV+ + SAS  + S+KP A YNLF IEK    W+  
Sbjct: 181 AELILHGHTHRATRMEINGPEGPVPVICVPSASNGLSSHKPPARYNLFTIEKDGSGWSCI 240

Query: 283 GKRYTLSPDSLSI 295
            +    +  +  +
Sbjct: 241 MEERGFTTANEGV 253


>gi|192293234|ref|YP_001993839.1| metallophosphoesterase [Rhodopseudomonas palustris TIE-1]
 gi|192286983|gb|ACF03364.1| metallophosphoesterase [Rhodopseudomonas palustris TIE-1]
          Length = 293

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 95/296 (32%), Positives = 149/296 (50%), Gaps = 8/296 (2%)

Query: 10  FVLAHISDIHLSYSPS--FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           F LAH+SD HL   P      L+ KR +G +NW  NR     +++ + L+ D+     DH
Sbjct: 4   FTLAHLSDPHLPLPPKTSLRHLASKRALGYLNWRRNRHLIHRRDILDTLVADLQAQQPDH 63

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +++TGD+VN     E   +  WL S+G    +S+VPGNHDAY+     +    + DYI+ 
Sbjct: 64  IAVTGDLVNIALVNEFAPARQWLESVGPADRVSLVPGNHDAYVRSTAHRFAETFPDYISG 123

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D         FPYLR R  IA+IG S+A+ T P  A G+ G  Q  A   LL+    +  
Sbjct: 124 DDATP----GFPYLRRRETIAIIGVSSAVPTAPLRATGWLGALQLAALEALLQSLAGERV 179

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           F+++++HHP    +   + R+        ++     DL+LHGH H+++   I+     IP
Sbjct: 180 FKVLLIHHPLQSRS--RHKRLTDAADLIALLQRHPVDLVLHGHDHVHATVRIETPFGTIP 237

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           VVG+ SAS     ++P A+Y+LF I + N+ W  E +          +     ++ 
Sbjct: 238 VVGVPSASAMNDRHRPSAAYSLFKISEGNDGWRCEHRIRGFQASEQIVDLRAPELL 293


>gi|121595373|ref|YP_987269.1| metallophosphoesterase [Acidovorax sp. JS42]
 gi|120607453|gb|ABM43193.1| metallophosphoesterase [Acidovorax sp. JS42]
          Length = 307

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 78/291 (26%), Positives = 131/291 (45%), Gaps = 10/291 (3%)

Query: 10  FVLAHISDIHLSYSP--SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
             LAH+SD+HL + P  S  +   KR +   +W   R+     ++ + L  D+  H VDH
Sbjct: 4   LTLAHVSDLHLPFEPALSPRQRLSKRQLSAWSWQR-RRALHRTDILDALAQDLRAHAVDH 62

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           + +TGDI NF+   E   +  WL ++  P  ISIVPGNHDA +     + L  W+ +  +
Sbjct: 63  ILVTGDITNFSLPGEFEQAARWLTALAPPERISIVPGNHDALVPVPHAQGLGLWQGWTRA 122

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           +         +P++  R+ +ALIG ++A+ T P  A G  G  Q     +LL      G 
Sbjct: 123 E-------DGWPFVHHRDGVALIGLNSALPTAPLLARGRLGDAQLARLEQLLEAEGAAGR 175

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            RI+M+HHPP          +      + ++   GA+L+LHGH     +  +      IP
Sbjct: 176 TRIVMLHHPPAAGAIGWRKALADAPALRAVLRRAGAELVLHGHARDARMDVVAGPSLPIP 235

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD 298
            + + S+S   +     A ++   +           +    S ++ +   D
Sbjct: 236 CLCVPSSSAVPNPKDQGALWHRLRLMDGAGGPRAMVEVRRWSTEAEAFVPD 286


>gi|149202538|ref|ZP_01879510.1| metallophosphoesterase [Roseovarius sp. TM1035]
 gi|149143820|gb|EDM31854.1| metallophosphoesterase [Roseovarius sp. TM1035]
          Length = 319

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 92/296 (31%), Positives = 148/296 (50%), Gaps = 7/296 (2%)

Query: 11  VLAHISDIH--LSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
            LAH+SD H  L+    +  +  KR + L++WH  R+ +   E+  +LI D+  H  D +
Sbjct: 16  TLAHLSDPHLPLTGPVPWHSVLNKRALSLLSWHRKRRHHHRPEILAMLIADMRAHAPDQI 75

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD+ N     E   +  WL ++G P  + ++PGNH+A I GA +     W  Y   D
Sbjct: 76  AVTGDLTNLGLESEYRAARRWLENLGRPERVMVIPGNHEALIRGAWDAGAAQWLPYWQGD 135

Query: 129 TTCSTGK--KLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
               T      FPY+R R  +ALIG S+A+ATPP  A+G  G  Q    + +LRKA   G
Sbjct: 136 AAPVTVDVSDAFPYMRRRGMLALIGVSSAVATPPAFASGAVGPAQLARLAPMLRKARGAG 195

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
             R++M+HHPP+  T S    +     F+ ++  EG +L+LHGH+H +    ++      
Sbjct: 196 LCRVLMIHHPPLDGTVSARKALRDAAAFRAVLQAEGVELVLHGHSHRHHHQTLETRDGPT 255

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
           PV+G+ SAS         A+Y+L+ I      W ++      + +        + +
Sbjct: 256 PVIGVPSASSLYPE---AAAYHLYQIRPTAAGWEIDVTARHATREQEMATGRCTRL 308


>gi|58040481|ref|YP_192445.1| hypothetical protein GOX2053 [Gluconobacter oxydans 621H]
 gi|58002895|gb|AAW61789.1| Hypothetical protein GOX2053 [Gluconobacter oxydans 621H]
          Length = 313

 Score =  179 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 84/288 (29%), Positives = 139/288 (48%), Gaps = 16/288 (5%)

Query: 11  VLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            LAHISD HL   P  + E   KR + L++W  +R+    ++    L+ DI   +VD + 
Sbjct: 30  TLAHISDPHLPPPPVHWREALNKRALSLLSWKKHRRYVHLEQTCAALVKDIGRSDVDTIL 89

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ++GD+ NF    E   +  WL ++  P    ++PGNHD  +       LH W+ +     
Sbjct: 90  VSGDLTNFGTPDEFAAAARWLDAL--PAQALVIPGNHDCMVRQPDSAGLHQWERW----- 142

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 + +PY+RI+N +A++G ++ I T PF A G     Q      LL++  ++G  R
Sbjct: 143 ----SARQYPYVRIQNGVAIVGVNSGIPTAPFMACGRVAHRQRERLEALLQELGREGLCR 198

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           ++M+HHPP          +   +    +    GA+++LHGH+H  +L  I      IP++
Sbjct: 199 VVMIHHPPRRGLVPWRKSLLDHREVAAVFRRAGAEIVLHGHSHDATLTHIAGTD--IPLL 256

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
           G+ASAS        QA +N   I    + WT+   R+ L  D    ++
Sbjct: 257 GVASASLTDERPHRQACWNRLSIHPYGKGWTITLARHRL--DGSVSER 302


>gi|162148703|ref|YP_001603164.1| metallophosphoesterase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787280|emb|CAP56874.1| putative metallophosphoesterase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 316

 Score =  172 bits (435), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 82/283 (28%), Positives = 136/283 (48%), Gaps = 10/283 (3%)

Query: 12  LAHISDIHLSYSP---SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           LAH+SD HL++         L  KRI+   +W   R+      +   +  D+     D V
Sbjct: 21  LAHLSDPHLAHDGLRLPVGALMNKRIMSQWSWRRRRRFLHVDAILERVAADVRDAAPDAV 80

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD+ N     E   +  WLR    P    +VPGNHD  +  +   S+  W  ++ + 
Sbjct: 81  ALTGDLTNLGLPVECRHAAAWLRK-NMPEPTFVVPGNHDMLVRESWPDSVGQWAAWMAA- 138

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                    FPY+R   ++ALIG ++A   P F+A G  G  QA   + +L +  + G F
Sbjct: 139 -----APDDFPYVRHVGSVALIGVNSARPMPWFTAAGRIGAAQADRLADILHETGRAGAF 193

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++M+HHPPV         +     F+ +I   GA+++LHGH HL+++  +      +PV
Sbjct: 194 RVVMIHHPPVDGMVPRRKALLDSGLFRSVIGRAGAEMVLHGHAHLSAVSTLPGPAISVPV 253

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
           +GIASAS + H  +  A+++   +   +  +  E  R  +  D
Sbjct: 254 LGIASASMRAHRQERMAAWHHIRVTATDRGFHAEIHRRIVGFD 296


>gi|209545530|ref|YP_002277759.1| metallophosphoesterase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533207|gb|ACI53144.1| metallophosphoesterase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 307

 Score =  172 bits (434), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 82/283 (28%), Positives = 136/283 (48%), Gaps = 10/283 (3%)

Query: 12  LAHISDIHLSYSP---SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           LAH+SD HL++         L  KRI+   +W   R+      +   +  D+     D V
Sbjct: 12  LAHLSDPHLAHDGLRLPVGALMNKRIMSQWSWRRRRRFLHVDAILERVAADVRDAAPDAV 71

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD+ N     E   +  WLR    P    +VPGNHD  +  +   S+  W  ++ + 
Sbjct: 72  ALTGDLTNLGLPVECRHAAAWLRK-NMPEPTFVVPGNHDMLVRESWPDSVGQWAAWMAA- 129

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                    FPY+R   ++ALIG ++A   P F+A G  G  QA   + +L +  + G F
Sbjct: 130 -----APDDFPYVRHVGSVALIGVNSARPMPWFTAAGRIGAAQADRLADILHETGRAGAF 184

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++M+HHPPV         +     F+ +I   GA+++LHGH HL+++  +      +PV
Sbjct: 185 RVVMIHHPPVDGMVPRRKALLDSGLFRSVIGRAGAEMVLHGHAHLSAVSTLPGPAISVPV 244

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
           +GIASAS + H  +  A+++   +   +  +  E  R  +  D
Sbjct: 245 LGIASASMRAHRQERMAAWHHIRVTATDRGFHAEIHRRIVGFD 287


>gi|23008783|ref|ZP_00050080.1| COG1409: Predicted phosphohydrolases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 265

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 88/243 (36%), Positives = 125/243 (51%), Gaps = 7/243 (2%)

Query: 7   TIMFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
             MF LAH++D H+   P     +L  KR  G VNW   R ++   ++   L+ D+    
Sbjct: 4   GDMFRLAHLTDPHIGPLPRPRLRQLLSKRATGYVNWRRGRGRHHDMDLLGALVADLHGQG 63

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
           VDHV+ TGD+ N     E  T+  +L ++G    +S VPGNHDAY+ G+ E  L A   +
Sbjct: 64  VDHVACTGDLCNLGLPDEWETARVFLEALGPADRVSFVPGNHDAYVRGSLEGLLAACGGW 123

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR--KA 182
              D   +   + FPYLR R  +AL+G S+AI T PF+A+G  G  Q  A  +LL    A
Sbjct: 124 TEDDAGQA---RSFPYLRRRGPLALVGLSSAIPTKPFAASGRLGPAQIEAAERLLHGLGA 180

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             +   R++M+HHPP    ++    +     F  MI   GADLILHGH H+ S+  I   
Sbjct: 181 EAERPCRVVMIHHPPHPGGAAAGRELKDAANFSAMIGRAGADLILHGHNHVGSVGRIAGR 240

Query: 243 KKL 245
              
Sbjct: 241 TGG 243


>gi|116328189|ref|YP_797909.1| phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116330913|ref|YP_800631.1| phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
 gi|116120933|gb|ABJ78976.1| Phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           L550]
 gi|116124602|gb|ABJ75873.1| Phosphohydrolase [Leptospira borgpetersenii serovar Hardjo-bovis
           JB197]
          Length = 292

 Score =  165 bits (418), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 65/292 (22%), Positives = 126/292 (43%), Gaps = 14/292 (4%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + H+SD+H   S  FF+L  K  +G +N++  R+K + K + N ++N I   N D + 
Sbjct: 1   MKILHLSDLHFPTSVPFFQLKGKMFVGYLNYNLRRRKKYPKNIWNSILNFIRETNPDAIV 60

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ++GDI N +   E   +   L  +     +  +PGNHD Y+  +  ++    K +     
Sbjct: 61  VSGDITNVSHEEEFKAALKMLSELPQ-EKVFYIPGNHDRYVKQSVGENAFYEKYFSKLSG 119

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
              +    +  ++   ++  +G  + I     +A G    E    T K L +   +    
Sbjct: 120 ESISHNAHYIRIKKIQDLHFVGWDSNIPLSILNAYGRIRPEVVVQTKKTLSERKIRN--Y 177

Query: 190 IIMMHHPPVLDTSSLYNRMF---GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +++ HHP    T+            +    ++  +   + LHGH H N   W+K     +
Sbjct: 178 VLVCHHPIWNPTNKQETIHHKLLNREEIASLLKEQPPLVYLHGHVHTN---WVKFPGDEL 234

Query: 247 PVVGIASASQKVHSN-KPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
           P   + SAS    S+   ++ ++L  I+K+N    +E +RYT + +     +
Sbjct: 235 PYYVVNSASSTRLSDTTHESGFHLLEIQKQN----VEIQRYTYNLEKSKFTE 282


>gi|258542688|ref|YP_003188121.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-01]
 gi|256633766|dbj|BAH99741.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-01]
 gi|256636825|dbj|BAI02794.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-03]
 gi|256639878|dbj|BAI05840.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-07]
 gi|256642934|dbj|BAI08889.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-22]
 gi|256645989|dbj|BAI11937.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649042|dbj|BAI14983.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652029|dbj|BAI17963.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655086|dbj|BAI21013.1| metallophosphoesterase [Acetobacter pasteurianus IFO 3283-12]
          Length = 316

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 86/283 (30%), Positives = 137/283 (48%), Gaps = 8/283 (2%)

Query: 12  LAHISDIHLS--YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           +AH+SD HL     PS  E+  KRI+ L++W   R+          ++ DI   + D V+
Sbjct: 18  IAHLSDPHLPLVGLPSLKEIRFKRILSLLSWQLRRRHLHKLPALQAVMQDIRHFHPDMVA 77

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ N    +E   +  WL     P    ++PGNHDA I          W +++ +  
Sbjct: 78  LTGDLTNLGLLKEFQNARQWLLQQDLP-PALLIPGNHDALIKENSAVKQALWAEWLHN-- 134

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             +  +   P L +++++ALIG +TAI T PF A+G  GQ Q    + LLR+    G  R
Sbjct: 135 -RTQSEPAAPSLLVKDHVALIGINTAIPTLPFLASGKAGQAQLVLLADLLRRTRAMGLCR 193

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           I+++HHPP     S    +   Q FQ ++  EGA+L+L+GH+H   +  I      I  V
Sbjct: 194 IVLLHHPPAPGIVSRRKGLDDFQAFQDVLRAEGAELVLYGHSHRAQITPIPGTD--ILAV 251

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
              SAS      +  A +N   + K+ + W +  +  +L  D 
Sbjct: 252 SSTSASHIADEPEKSAGWNAISVHKQPDIWQITIQHRSLMRDG 294


>gi|24215038|ref|NP_712519.1| putative phosphohydrolase [Leptospira interrogans serovar Lai str.
           56601]
 gi|24196088|gb|AAN49537.1| predicted phosphohydrolase [Leptospira interrogans serovar Lai str.
           56601]
          Length = 292

 Score =  164 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 68/300 (22%), Positives = 136/300 (45%), Gaps = 14/300 (4%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + H+SD+H   S  FF+L  K  +G +N++F RK  + K+V + ++  I   N D + 
Sbjct: 1   MKILHLSDLHFPTSLPFFQLKGKMFVGYLNYNFRRKNKYPKKVWDSILTFIQEINPDAIV 60

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ++GDI N +   E   +   L  +     +  +PGNHD Y+  +  ++    K +     
Sbjct: 61  VSGDITNVSHEEEFKKARKILSELPL-EKVFYIPGNHDRYVKQSSGENALYEKYFSEFSG 119

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
              +  K +  ++   N+  +G  + I     +A+G    E    T + L +  KK    
Sbjct: 120 EPISHNKNYIRIKKIQNLHFVGWDSNIPLSILNAHGRIHPEIVIQTKRFLSE--KKITNY 177

Query: 190 IIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           I++ HHP   P+    ++++++   +    ++  +   + LHGH H N   W+K   + +
Sbjct: 178 ILVCHHPIWNPLDKQETVHHKLLNREEVASLLKEQPPLVYLHGHVHTN---WVKFPGEEL 234

Query: 247 PVVGIASASQKV-HSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYD 305
           P   I SAS       K ++ ++L  I+K+     ++ +RYT + +     +     + +
Sbjct: 235 PYYVINSASSTRLPDAKHKSGFHLIEIQKQK----IKIQRYTYNLERSKFTEASLVSYSE 290


>gi|45657478|ref|YP_001564.1| hypothetical protein LIC11606 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45600717|gb|AAS70201.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 292

 Score =  164 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 68/300 (22%), Positives = 136/300 (45%), Gaps = 14/300 (4%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + H+SD+H   S  FF+L  K  +G +N++F RK  + K+V + ++  I   N D + 
Sbjct: 1   MKILHLSDLHFPTSLPFFQLKGKMFVGYLNYNFRRKNKYPKKVWDSILTFIQEINPDAIV 60

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ++GDI N +   E   +   L  +     +  +PGNHD Y+  +  ++    K +     
Sbjct: 61  VSGDITNVSHEEEFKKARKMLSELPL-EKVFYIPGNHDRYVKQSSGENALYEKYFSEFSG 119

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
              +  K +  ++   N+  +G  + I     +A+G    E    T + L +  KK    
Sbjct: 120 EPISHNKNYIRIKKIQNLHFVGWDSNIPLSILNAHGRIHPEIVIQTKRFLSE--KKITNY 177

Query: 190 IIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           I++ HHP   P+    ++++++   +    ++  +   + LHGH H N   W+K   + +
Sbjct: 178 ILVCHHPIWNPLDKQETVHHKLLNREEVASLLKEQPPLVYLHGHVHTN---WVKFPGEEL 234

Query: 247 PVVGIASASQKV-HSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYD 305
           P   I SAS       K ++ ++L  I+K+     ++ +RYT + +     +     + +
Sbjct: 235 PYYVINSASSTRLPDAKHKSGFHLIEIQKQK----IKIQRYTYNLERSKFTEASLVSYSE 290


>gi|218509337|ref|ZP_03507215.1| putative phosphoesterase protein [Rhizobium etli Brasil 5]
          Length = 237

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 119/236 (50%), Positives = 160/236 (67%), Gaps = 5/236 (2%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR +G+P   S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRELGDPAHTSVVPGNHDAYVPGAYEKSMRAWYDYVR 120

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D      ++    FPYLR+R  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLAPPQWQEDRHIFPYLRVRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI 239
           + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+LHW+
Sbjct: 181 EAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTLHWL 236


>gi|329114706|ref|ZP_08243464.1| Metallophosphoesterase [Acetobacter pomorum DM001]
 gi|326695972|gb|EGE47655.1| Metallophosphoesterase [Acetobacter pomorum DM001]
          Length = 320

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 87/283 (30%), Positives = 138/283 (48%), Gaps = 8/283 (2%)

Query: 12  LAHISDIHLS--YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           +AH+SD HL     PSF E+  KRI+ L++W   R+          ++ DI   + D V+
Sbjct: 22  IAHLSDPHLPLVGLPSFKEIRFKRILSLLSWQLRRRHLHKLPALQSIMRDIRHFHPDMVA 81

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ N    +E   +  WL     P    ++PGNHDA I          W +++ S  
Sbjct: 82  LTGDLTNLGLLKEFQHARQWLLQQDLP-PTLLIPGNHDALIKENSATKQALWAEWLHS-- 138

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             +  +   P L ++++IALIG +TA+ T PF A+G  GQ Q    + LLR+    G  R
Sbjct: 139 -STQPEPAAPSLLVKDHIALIGVNTAVPTLPFLASGKAGQTQLVLLADLLRRTRVMGLCR 197

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           I+++HHPP     S    +     FQ ++  EGA+L+L+GH+H   +  +      I  V
Sbjct: 198 IVLLHHPPAQGIVSRRKGLDDFLAFQNVLRAEGAELVLYGHSHRAQITTLPGTD--ILAV 255

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
              SAS      +  A +N   + K+ + W +  +  +L PD 
Sbjct: 256 SSTSASHIADEPEKSAGWNAISVHKQPDIWQITIQHRSLMPDG 298


>gi|262198837|ref|YP_003270046.1| metallophosphoesterase [Haliangium ochraceum DSM 14365]
 gi|262082184|gb|ACY18153.1| metallophosphoesterase [Haliangium ochraceum DSM 14365]
          Length = 326

 Score =  155 bits (390), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 74/292 (25%), Positives = 125/292 (42%), Gaps = 14/292 (4%)

Query: 22  YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNR 81
                 E   KR IG +N    R ++    V   ++ DI    +DHV  +GD+ N     
Sbjct: 19  TGVRLLEFINKRWIGGLNLLAKRSRHHHTHVFEAMVEDINAQGIDHVVCSGDVTNLGLKS 78

Query: 82  EIFTSTHWLRSIGN-PHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT------CSTG 134
           E   +      +   P +++++PGNHD Y+S A+    H + DY  +DT        +  
Sbjct: 79  EFRFARSCFDGLALGPENVTVIPGNHDVYVSEARGHFDHFFADYHRTDTPWRVTGSEAPA 138

Query: 135 KKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMH 194
              +P +R+R  +A++G S+ + TP F+A G     Q      +L         R++ +H
Sbjct: 139 GTAWPTVRVRGPVAVVGVSSCVPTPWFTAYGRVDHRQLERLRAVLSSPELADKLRVVAIH 198

Query: 195 HPPVLDTSSLYNRM-FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL-IPVVGIA 252
           HPP    +    R   G ++F K++   GA+L+LHGH H +  H +       IPV+GI 
Sbjct: 199 HPPAGRYARHQTRGLRGWRKFAKLLAETGAELVLHGHEHRDLRHELPGPGGAYIPVLGIQ 258

Query: 253 SASQKVHSNKPQASYNLFYIEKK-----NEYWTLEGKRYTLSPDSLSIQKDY 299
           S S      +  A Y +F + +           +        P++    +D 
Sbjct: 259 SGSYHGLRAERTARYRIFDVSRDGVEPNGRPRLVGYHLRMWDPEAGRFVEDT 310


>gi|149917880|ref|ZP_01906375.1| metallophosphoesterase [Plesiocystis pacifica SIR-1]
 gi|149821400|gb|EDM80802.1| metallophosphoesterase [Plesiocystis pacifica SIR-1]
          Length = 292

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 80/293 (27%), Positives = 132/293 (45%), Gaps = 13/293 (4%)

Query: 10  FVLAHISDIHLSY--SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
               H SDIHL             KR+ G VN    R K+  + + + +        VD 
Sbjct: 3   LRFLHCSDIHLLSLRGVGPHRFLNKRLTGGVNLMLKRGKHHDEALFDRMCEHARDRAVDR 62

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGA-KEKSLHAWKDYIT 126
           V ITGD+ N    +E       LR+IG P  ++++PGNHDAY  G+ + +      D   
Sbjct: 63  VVITGDLSNLALEQEFEHIRTKLRAIGVP--VTVIPGNHDAYTRGSVRNRRFEQMLDEFM 120

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           +      G   +P+++   ++AL+G STA A+ P  A G  G EQ      +L +   +G
Sbjct: 121 AGERSEGGD--YPFVQRYGDVALVGVSTAQASLPMYAVGTVGPEQLERLDGVLERLGAEG 178

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK--K 244
             RI+++HHP V   S   + +  I  F ++I   GA+LILHGH H      +      +
Sbjct: 179 LGRIVLIHHPVVPGVSKKRHDLLDIDAFGEVIARRGAELILHGHEHTLLEGTLAGPDSER 238

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
            +PV GI+S +        +A++ ++ +       ++E + +    +    Q 
Sbjct: 239 PVPVHGISSGTNISQHEGRRAAFAIYQVS----AASIERELHVWDGEDFRPQP 287


>gi|86157416|ref|YP_464201.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773927|gb|ABC80764.1| Metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 307

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 75/301 (24%), Positives = 131/301 (43%), Gaps = 14/301 (4%)

Query: 9   MFVLAHISDIHLSYSPSF---FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           M  +AH+SD+H+           L  KRI G VN    R + + +E    ++     H  
Sbjct: 1   MLRIAHLSDLHVLSPRGTEWRRILFNKRITGYVNLVRQRGRVYRREYLAAVLAAAAAHAD 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYIS--GAKEKSLHAWKD 123
            HV +TGDI N    RE+  +   L  +    ++++VPGNHD Y+       +  H +  
Sbjct: 61  -HVVVTGDITNLALERELEEARALLDGVARAVEVTVVPGNHDVYLPSIQDGRRFPHHFGP 119

Query: 124 YITSDTTC---STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
           ++  D            FP +++R   A+IG S+A+  PPF A+G  G+ Q  A   +L 
Sbjct: 120 FLRGDLPDLARDLAAGPFPCVKLRGPAAIIGLSSAVPRPPFVASGRLGEAQLEALEAVLA 179

Query: 181 KANKKGFFRIIMMHHPPVLDTSSL---YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH 237
                    ++++HHPPV          + +    R + ++   G  L+L GH H     
Sbjct: 180 HPEVARRTPVVLVHHPPVDGRIRALQLRDGLVDADRLRAVLSRLGRGLVLFGHLHARVRW 239

Query: 238 WIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
            +      + VVG + A+      + +A +N + +        +E   + L+PD  S+++
Sbjct: 240 RLPTATGALQVVGASGAALDHPHPRVRAGFNAYELRDDGSLAAVEA--HVLAPDGRSVER 297

Query: 298 D 298
            
Sbjct: 298 V 298


>gi|220916163|ref|YP_002491467.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219954017|gb|ACL64401.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 309

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 69/302 (22%), Positives = 130/302 (43%), Gaps = 14/302 (4%)

Query: 8   IMFVLAHISDIHLSYSPSF---FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
            +  +AH+SD+H+           L  KRI G  N    R + + +E    ++       
Sbjct: 2   AVLRIAHLSDLHVRSPRGAEWRRILFNKRITGYANLIRQRGRVYRREYLAAVLAAAAARA 61

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI--SGAKEKSLHAWK 122
             HV +TGD+ N    RE+  +   L ++    ++++VPGNHD Y+       +  H + 
Sbjct: 62  D-HVVVTGDVTNLALERELEEARSLLDAMARRVEVTVVPGNHDVYLASIQDGRRFPHHFG 120

Query: 123 DYITSDTTC---STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
            ++  D            FP +++R   A+IG S+A+  PPF A+G  G+ Q  A   +L
Sbjct: 121 AFLRGDLPDLALDLAAGPFPCVKLRGPAAIIGLSSAVPRPPFVASGRLGEAQLEALEAVL 180

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSL---YNRMFGIQRFQKMIWHEGADLILHGHTHLNSL 236
                     ++++HHPPV          + +    R + ++   G  L+L GH H    
Sbjct: 181 AHPEVARRTPVVLLHHPPVDGRIRALQLRDGLVDADRLRAVLCRLGRGLVLFGHLHARVR 240

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
             +      + V+G + A+      + +A +N + +        +E   + ++PD  S++
Sbjct: 241 WRLPTAAGALQVIGASGAALDHPHPRVRAGFNSYDLRDDGSLAAVEA--HVVAPDGRSVE 298

Query: 297 KD 298
           + 
Sbjct: 299 RV 300


>gi|197121459|ref|YP_002133410.1| metallophosphoesterase [Anaeromyxobacter sp. K]
 gi|196171308|gb|ACG72281.1| metallophosphoesterase [Anaeromyxobacter sp. K]
          Length = 307

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 69/302 (22%), Positives = 129/302 (42%), Gaps = 14/302 (4%)

Query: 9   MFVLAHISDIHLSYSPSF---FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +  +AH+SD+H+           L  KRI G VN    R +   +E    ++        
Sbjct: 3   VLRIAHLSDLHVRSPRGTEWRRILFNKRITGYVNLIRQRGRVHRREYLAAVLAAAAARAD 62

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI--SGAKEKSLHAWKD 123
            HV +TGD+ N    RE+  +   L ++    ++++VPGNHD Y+       +  H +  
Sbjct: 63  -HVVVTGDVTNLALERELEEARSLLDAMARRVEVTVVPGNHDVYLASIQDGRRFPHHFGA 121

Query: 124 YITSDTTC---STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
           ++  D            FP +++R   A+IG S+A+  PPF A+G  G+ Q  A   +L 
Sbjct: 122 FLRGDLPDLARDLAAGPFPCVKLRGPAAIIGLSSAVPRPPFVASGRLGEAQLEALEAVLA 181

Query: 181 KANKKGFFRIIMMHHPPVLDTSSL---YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH 237
                    ++++HHPPV          + +    R + ++   G  L+L GH H     
Sbjct: 182 HPEVARRTPVVLLHHPPVDGRIRALQLRDGLVDADRLRAVLCRLGRGLVLFGHLHARVRW 241

Query: 238 WIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
            +      + V+G + A+      + +A +N + +        +E   + ++ D  S+++
Sbjct: 242 RLPTAAGALQVIGASGAALDHPHPRVRAGFNSYELRDDGSLAAVEA--HVIAADGRSVER 299

Query: 298 DY 299
             
Sbjct: 300 VS 301


>gi|301336319|ref|ZP_07224521.1| hypothetical protein CmurM_00750 [Chlamydia muridarum MopnTet14]
          Length = 290

 Score =  150 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 63/308 (20%), Positives = 114/308 (37%), Gaps = 24/308 (7%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLIND 59
           M K+  + +F L H SDIH    P   F+   KR  GL+        + +  +       
Sbjct: 1   MPKK-PSTIFRLIHCSDIHFCVFPKNPFQCFNKRFKGLLRQLIGGVSFRALAIFQRFPQL 59

Query: 60  ILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
           I     D V +TGD+     + E   +  +L  I     + IVPGNHD Y   + +K   
Sbjct: 60  IEQLEADGVCVTGDVTITALDSEFRLAKEFLSRIETIAPVYIVPGNHDVYTYRSLKK--- 116

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
             + + +             + R+ +   L+    +     ++ANG     Q     + L
Sbjct: 117 --QTFYSYFPNKELQTHRIAFQRLTSTWWLVLLDCSCFNGWYAANGEVTSSQLLDLERFL 174

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHW 238
                     +I+ +H P+  T+   + +      + ++ H     L LHGH H   L  
Sbjct: 175 SSLPPSD--HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMHFPSVRLYLHGHDHYVEL-- 230

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY----WTLEGKRYTLSPDSLS 294
                  +P + + S S  + S    A +++  +  +  Y      +     T SP  +S
Sbjct: 231 -----DHLPPLVVNSGSLTLPS---NARFHIVDLHPEGGYQISTAAITNLTETASPLKIS 282

Query: 295 IQKDYSDI 302
           I++    +
Sbjct: 283 IEETTISL 290


>gi|218662697|ref|ZP_03518627.1| putative phosphoesterase protein [Rhizobium etli IE4771]
          Length = 247

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 105/213 (49%), Positives = 148/213 (69%), Gaps = 3/213 (1%)

Query: 94  GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKL---FPYLRIRNNIALI 150
           G+P + S+VPGNHDAY+ GA EKS+ AW DY+  D   +  ++    FPYLR+R  +A++
Sbjct: 34  GDPAETSVVPGNHDAYVPGAYEKSMRAWYDYVRGDLAPAQWQEDRHIFPYLRVRGKVAIV 93

Query: 151 GCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFG 210
           GCSTA+ATPPF+A+G+FG  QA  T  +LR A + G FR++M+HHPP+   ++ Y RM G
Sbjct: 94  GCSTAVATPPFAASGFFGARQARDTVNMLRAAGEAGLFRVVMIHHPPIRGATTFYKRMIG 153

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
           I+RF  +I   GA+L+LHGHTHLN+LHW++ + + +PVVGIASASQ   S KP A+YNLF
Sbjct: 154 IRRFAAVISTGGAELVLHGHTHLNTLHWLRGQVQPVPVVGIASASQGPGSIKPAAAYNLF 213

Query: 271 YIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            I+     W L G+R++L+    ++     DIF
Sbjct: 214 SIDGSPGAWELSGERFSLNRAGDAVISGSVDIF 246


>gi|255349151|ref|ZP_05381158.1| hypothetical protein Ctra70_04070 [Chlamydia trachomatis 70]
 gi|255503688|ref|ZP_05382078.1| hypothetical protein Ctra7_04065 [Chlamydia trachomatis 70s]
 gi|255507368|ref|ZP_05383007.1| hypothetical protein CtraD_04050 [Chlamydia trachomatis D(s)2923]
 gi|296439093|gb|ADH21246.1| hypothetical protein E11023_03990 [Chlamydia trachomatis E/11023]
          Length = 290

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 59/299 (19%), Positives = 113/299 (37%), Gaps = 23/299 (7%)

Query: 10  FVLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           F L H SDIH    P   F+   KR  GL+        + +  ++      +     D V
Sbjct: 9   FRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLIGGVSFQAFAISQRFPQLVKQLEADSV 68

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+     + E   +  +L  + +   + IVPGNHD Y   A +K     + + +  
Sbjct: 69  CVTGDMTITALDTEFRFAKEFLSRVESVAPVYIVPGNHDVYTHRALKK-----QTFYSYF 123

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      + ++     L+    +     ++ANG     Q  A  + L         
Sbjct: 124 PNKELQTHRIAFKKLTPTWWLVLLDCSCFNGWYTANGEVTDSQLLALEQFLSSLPASE-- 181

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            +I+ +H P+  T+   + +      + ++ +     L LHGH H   L         +P
Sbjct: 182 HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRLYLHGHDHYVEL-------DHLP 234

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEY----WTLEGKRYTLSPDSLSIQKDYSDI 302
            + + S S  + S    A +++  +  +  Y      L   + T +P ++SI++    +
Sbjct: 235 PLVVNSGSLTLPS---NARFHIIDLHPEGGYQITTAALTNLKETSTPLTISIEETTISL 290


>gi|15605487|ref|NP_220273.1| phosphohydrolase [Chlamydia trachomatis D/UW-3/CX]
 gi|76789496|ref|YP_328582.1| Icc family phosphohydrolase [Chlamydia trachomatis A/HAR-13]
 gi|166154096|ref|YP_001654214.1| hypothetical protein CTL0123 [Chlamydia trachomatis 434/Bu]
 gi|166154971|ref|YP_001653226.1| hypothetical protein CTLon_0123 [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|237803184|ref|YP_002888378.1| hypothetical protein JALI_7591 [Chlamydia trachomatis B/Jali20/OT]
 gi|237805105|ref|YP_002889259.1| hypothetical protein CTB_7591 [Chlamydia trachomatis B/TZ1A828/OT]
 gi|255311588|ref|ZP_05354158.1| hypothetical protein Ctra62_04000 [Chlamydia trachomatis 6276]
 gi|255317889|ref|ZP_05359135.1| hypothetical protein Ctra6_03995 [Chlamydia trachomatis 6276s]
 gi|301335334|ref|ZP_07223578.1| hypothetical protein CtraL_00820 [Chlamydia trachomatis L2tet1]
 gi|3329215|gb|AAC68349.1| phosphohydrolase [Chlamydia trachomatis D/UW-3/CX]
 gi|76168026|gb|AAX51034.1| phosphohydrolase, Icc family [Chlamydia trachomatis A/HAR-13]
 gi|165930084|emb|CAP03567.1| conserved hypothetical protein [Chlamydia trachomatis 434/Bu]
 gi|165930959|emb|CAP06521.1| conserved hypothetical protein [Chlamydia trachomatis
           L2b/UCH-1/proctitis]
 gi|231273405|emb|CAX10320.1| conserved hypothetical protein [Chlamydia trachomatis B/TZ1A828/OT]
 gi|231274418|emb|CAX11213.1| conserved hypothetical protein [Chlamydia trachomatis B/Jali20/OT]
 gi|296436303|gb|ADH18477.1| hypothetical protein G9768_04000 [Chlamydia trachomatis G/9768]
 gi|296437232|gb|ADH19402.1| hypothetical protein G11222_04020 [Chlamydia trachomatis G/11222]
 gi|296438162|gb|ADH20323.1| hypothetical protein G11074_03995 [Chlamydia trachomatis G/11074]
 gi|297140663|gb|ADH97421.1| hypothetical protein CTG9301_04010 [Chlamydia trachomatis G/9301]
 gi|297748884|gb|ADI51430.1| Phosphohydrolase, Icc family [Chlamydia trachomatis D-EC]
 gi|297749764|gb|ADI52442.1| Phosphohydrolase, Icc family [Chlamydia trachomatis D-LC]
          Length = 290

 Score =  143 bits (360), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 59/299 (19%), Positives = 113/299 (37%), Gaps = 23/299 (7%)

Query: 10  FVLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           F L H SDIH    P   F+   KR  GL+        + +  ++      +     D V
Sbjct: 9   FRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLIGGVSFQAFAISQRFPQLVKQLEADSV 68

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+     + E   +  +L  + +   + IVPGNHD Y   A +K     + + +  
Sbjct: 69  CVTGDMTITALDTEFRFAKEFLSRVESVAPVYIVPGNHDVYTHRALKK-----QTFYSYF 123

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      + ++     L+    +     ++ANG     Q  A  + L         
Sbjct: 124 PNKELQTHRIAFKKLTPTWWLVLLDCSCFNGWYTANGEVTDSQLLALEQFLSSLPASE-- 181

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            +I+ +H P+  T+   + +      + ++ +     L LHGH H   L         +P
Sbjct: 182 HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRLYLHGHDHYVEL-------DHLP 234

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEY----WTLEGKRYTLSPDSLSIQKDYSDI 302
            + + S S  + S    A +++  +  +  Y      L   + T +P ++SI++    +
Sbjct: 235 PLVVNSGSLTLPS---NARFHIIDLHPEGGYQIATAALTNLKETSTPLTISIEETTISL 290


>gi|289525798|emb|CBJ15279.1| conserved hypothetical protein [Chlamydia trachomatis Sweden2]
 gi|296435376|gb|ADH17554.1| hypothetical protein E150_04025 [Chlamydia trachomatis E/150]
          Length = 290

 Score =  143 bits (359), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 59/299 (19%), Positives = 113/299 (37%), Gaps = 23/299 (7%)

Query: 10  FVLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           F L H SDIH    P   F+   KR  GL+        + +  ++      +     D V
Sbjct: 9   FRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLIGGISFQAFAISQRFPQLVKQLEADSV 68

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+     + E   +  +L  + +   + IVPGNHD Y   A +K     + + +  
Sbjct: 69  CVTGDMTITALDTEFRFAKEFLSRVESVAPVYIVPGNHDVYTHRALKK-----QTFYSYF 123

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      + ++     L+    +     ++ANG     Q  A  + L         
Sbjct: 124 PNKELQTHRIAFKKLTPTWWLVLLDCSCFNGWYTANGEVTDSQLLALEQFLSSLPASE-- 181

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            +I+ +H P+  T+   + +      + ++ +     L LHGH H   L         +P
Sbjct: 182 HVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRLYLHGHDHYVEL-------DHLP 234

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEY----WTLEGKRYTLSPDSLSIQKDYSDI 302
            + + S S  + S    A +++  +  +  Y      L   + T +P ++SI++    +
Sbjct: 235 PLVVNSGSLTLPS---NARFHIIDLHPEGGYQITTAALTNLKETSTPLTISIEETTISL 290


>gi|15834755|ref|NP_296514.1| icc-related protein [Chlamydia muridarum Nigg]
 gi|270284922|ref|ZP_06194316.1| icc-related protein [Chlamydia muridarum Nigg]
 gi|270288949|ref|ZP_06195251.1| icc-related protein [Chlamydia muridarum Weiss]
 gi|7190171|gb|AAF39013.1| icc-related protein [Chlamydia muridarum Nigg]
          Length = 290

 Score =  143 bits (359), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 61/302 (20%), Positives = 115/302 (38%), Gaps = 23/302 (7%)

Query: 7   TIMFVLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           + +F L H SDIH    P   F+   KR  GL+        + +  ++      +     
Sbjct: 6   STVFRLIHCSDIHFCVLPKNPFQCFNKRFKGLLRQLVGGVSFRAPAISQRFPQLVAQLEA 65

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           + V +TGD+     + E   +  +L  I +   + IVPGNHD Y   A +K     + + 
Sbjct: 66  NGVCVTGDVTITALDSEFRLAKEFLSRIESIAPVYIVPGNHDVYTYRALKK-----QTFY 120

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           +             + ++  N  L+    +      +ANG     Q  A  + L      
Sbjct: 121 SYFPNKELQTHRIAFQKLTPNWWLVLLDCSCFNGWCAANGEVTDSQIVALEQFLASLPS- 179

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
               +I+ +H P+  T+   + +      + ++ +     + LHGH H         E  
Sbjct: 180 -LEHVIVANHYPLSPTTRPAHDLLNYAPLKSLLMNSPSVRMYLHGHDH-------HVEID 231

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY----WTLEGKRYTLSPDSLSIQKDYS 300
            +P + + S S  + S    A +++  +  + EY     +L     T SP  +SI++   
Sbjct: 232 HLPPLVVNSGSLTLPS---NARFHIIDLYPEGEYRISTASLTNLTETDSPLKISIEETSI 288

Query: 301 DI 302
            +
Sbjct: 289 SL 290


>gi|311104652|ref|YP_003977505.1| calcineurin-like phosphoesterase family protein 2 [Achromobacter
           xylosoxidans A8]
 gi|310759341|gb|ADP14790.1| calcineurin-like phosphoesterase family protein 2 [Achromobacter
           xylosoxidans A8]
          Length = 261

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 52/296 (17%), Positives = 98/296 (33%), Gaps = 41/296 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + H SD H                                V    ++       D V
Sbjct: 1   MTRILHFSDTHFGTERKP-------------------------VVEAALDLACTLAPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  ++  +  P  +  VPGNHD  +     ++L+ + +Y  + 
Sbjct: 36  VLSGDITQRARRGQFAAARKFIERLSLP--VLTVPGNHDIPLFNVFARALNPYGNYKRAL 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +     +  IG +T         +G     Q    ++ LR+A   G  
Sbjct: 94  GPVLEP------VFENAGLLAIGVNTTRP--RRRKDGEISGSQIARVAERLRQAKP-GQL 144

Query: 189 RIIMMHHPPVL-DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK-NEKKLI 246
           RI++ HHP      S L N + G +R  +     G DL+L GH HL  +  +        
Sbjct: 145 RIVVAHHPVRAKVESDLSNLLIGRERALEAWAQAGVDLVLGGHIHLPYVLPLNPASASGG 204

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
            VV   +   +        S N+   + + +    + +R+  +  + +       +
Sbjct: 205 WVVQAGTTCSRRVRGNVPNSVNVITSDGRGD---CQIERWDYAAGAHAFAPVDKTL 257


>gi|162452080|ref|YP_001614447.1| putative metallo-phosphoesterase [Sorangium cellulosum 'So ce 56']
 gi|161162662|emb|CAN93967.1| putative Metallo-Phosphoesterase [Sorangium cellulosum 'So ce 56']
          Length = 314

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 80/296 (27%), Positives = 119/296 (40%), Gaps = 20/296 (6%)

Query: 26  FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFT 85
            F L  KR+ G +N  F R         +    +I    VDHV ITGD+ N    RE   
Sbjct: 19  PFRLLNKRLTGYLNLRFRRHAIHKPHAVHAAAREIRRLGVDHVVITGDVSNLALEREFVL 78

Query: 86  STHWLRSIG--NPHDISIVPGNHDAYISGAK--EKSLHAWKDYITSDTT----------- 130
              +L+S     P  +SIVPGNHDAY  GA   ++    +  Y+ SD             
Sbjct: 79  VRDFLQSGLGLPPERVSIVPGNHDAYTKGAHRSQRFSRYFAPYLRSDLVLDAPGKSDDGG 138

Query: 131 --CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G   FP++ +R  +A+IG STA   PP  A+G  G  Q  A  + L     +   
Sbjct: 139 ATRDGGDSAFPFVHLRGPVAIIGLSTAWPRPPLVASGRLGPVQLRALERALEHPEVRRRT 198

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQK---MIWHEGADLILHGHTHLNSLHWIKNEKKL 245
            +++ HHP     S     + G+        ++      L+LHGH H      +  E+  
Sbjct: 199 PVVLQHHPFHNPASRAKTLLEGLGDAAAEGRLLRQVRRGLLLHGHLHRRIHRKLHTERGH 258

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
           I  VG  SAS    S++  A +N++ I+       +   R+    D+         
Sbjct: 259 IDAVGATSASLLHDSDERMAGFNVYEIDDAGTIGGITSHRFVPGQDAFREVPVPER 314


>gi|317402018|gb|EFV82617.1| DNA repair exonuclease [Achromobacter xylosoxidans C54]
          Length = 255

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 54/290 (18%), Positives = 95/290 (32%), Gaps = 39/290 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +   SD H                                V    ++     + + V
Sbjct: 1   MTRILQFSDTHFGTERKP-------------------------VVEAALDLARSLSPELV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GDI       +   +  ++  +  P  +  VPGNHD  +     ++L+ + +Y  + 
Sbjct: 36  VISGDITQRARRGQFAAARKFIERLSLP--VLAVPGNHDIPLFNLFARALNPYGNYKRAL 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +   + +  IG +T         +G     Q    ++ LR+A   G  
Sbjct: 94  GAVLEP------VYESDGLLAIGVNTTRP--RRRKDGEISDAQIARVAQRLRQARP-GQL 144

Query: 189 RIIMMHHPPVL-DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL--HWIKNEKKL 245
           R+++ HHP      S   N + G QR        G DLIL GH HL  +    +      
Sbjct: 145 RVVVAHHPMRAKVESDHSNLLIGRQRALAAWAQAGIDLILGGHIHLPYVLPASVDPAVAA 204

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
             VV   +A  +        S NL   E   +      +R+  +  + + 
Sbjct: 205 GWVVQAGTACSRRVRGNIPNSVNLISCETTGDTRVCHVERWDYAAGAHAF 254


>gi|293603913|ref|ZP_06686328.1| metallophosphoesterase [Achromobacter piechaudii ATCC 43553]
 gi|292817750|gb|EFF76816.1| metallophosphoesterase [Achromobacter piechaudii ATCC 43553]
          Length = 267

 Score =  137 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 49/296 (16%), Positives = 95/296 (32%), Gaps = 38/296 (12%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +  +SD H                                V    ++     N D V
Sbjct: 1   MTRILQLSDTHFGTERKP-------------------------VVEAALDLARSLNPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  ++  +  P  +  VPGNHD  +     ++L+ + +Y  + 
Sbjct: 36  VVSGDITQRARRAQFAAARKFIERLSLP--VLTVPGNHDIPLINLFARALNPYGNYKRAL 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +     +  IG +T         +G     Q    ++ LR+A   G  
Sbjct: 94  GAVLEP------VFENPGLLAIGVNTTRP--RRHKDGEISDAQIARVAQRLRQARP-GQL 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFG-IQRFQKMIWHEGADLILHGHTHLNSLHWI-KNEKKLI 246
           R+++ HHP      S  + +    +R        G DL+L GH HL  +  +        
Sbjct: 145 RVVVAHHPVRAKVESDLSNLLNGRERALAAWAQAGIDLVLGGHIHLPYVLPLSAGGLPAG 204

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
            +V   +A  +        S N+   E + +      +R+  +  +         +
Sbjct: 205 WIVQAGTACSRRVRGSVPNSVNVITREGEGDQQICHVERWDYAEATHVFAPVDKTL 260


>gi|163855981|ref|YP_001630279.1| DNA repair exonuclease [Bordetella petrii DSM 12804]
 gi|163259709|emb|CAP42010.1| probable DNA repair exonuclease [Bordetella petrii]
          Length = 270

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 51/300 (17%), Positives = 94/300 (31%), Gaps = 41/300 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + H+SD H                              + V   L+        D V
Sbjct: 1   MTRILHLSDTHFGTE-------------------------REPVVQALLALSDALQPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            + GDI       +   +  +++++  P  +  VPGNHD  +     +    +  Y  + 
Sbjct: 36  LLGGDITQRARRSQFAAARRFVQALQRP--VLAVPGNHDIPLFNLAARLFDPYGGYRRAL 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +   + +  IG ++         NG     Q    ++ LR+A   G  
Sbjct: 94  GAVLEP------VVETDGLLAIGVNSTRPG--RHKNGQVSAAQVVRVAQRLREAGP-GRL 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQ-KMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           R++++HHP      S +  +   +          G D+IL GH HL  +  I       P
Sbjct: 145 RVVLLHHPVRAAVESDHANLLIGRDLAVPAWVDAGVDIILGGHIHLPYILPIHGAAGPAP 204

Query: 248 ----VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
                V   +A           S N+      NE      +R+    ++   +   + + 
Sbjct: 205 RQAWTVQAGTAVSHRVRGGISNSVNVIDHMPDNERHRCSVQRWDYQAEAGEFRAQGTQML 264


>gi|183221721|ref|YP_001839717.1| putative metallo-dependent phosphatase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
 gi|189911796|ref|YP_001963351.1| phosphohydrolase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167776472|gb|ABZ94773.1| Phosphohydrolase [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Ames)']
 gi|167780143|gb|ABZ98441.1| Putative metallo-dependent phosphatase [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 287

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 65/275 (23%), Positives = 108/275 (39%), Gaps = 15/275 (5%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISD+H     S F L  K I+G +N+H  RK      +   +++ I     D + 
Sbjct: 1   MKILHISDLHFPKKLSLFSLRGKAIVGYLNYHVRRKSKHPVVLIAAMVDTIQNLEYDALV 60

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+ N +   E   +   L+ I       ++PGNHD Y   A   +    K +     
Sbjct: 61  ISGDLTNVSHPSEFQNAKEILKPILT-DKTFLIPGNHDRYQKRAMGPNPLFEKAFEEWMG 119

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                       RI   +  +G  + +A P  +ANGY  +E         +         
Sbjct: 120 ESKDPNFYLRTKRIAGKL-FVGWDSNLAIPRITANGYVAKEVVE------KTVGLANEPY 172

Query: 190 IIMMHHPPVLDTS---SLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +++ HHP     +   S  +R+   +     +     +L LHGHTH N +       K  
Sbjct: 173 VLVGHHPLWNPNAEVESASHRLSNRKEVVNGLQTNPPELYLHGHTHTNWVKL---PGKET 229

Query: 247 PVVGIASASQKVHSN-KPQASYNLFYIEKKNEYWT 280
           P   + SAS    S+ K +  ++L  + K+  Y  
Sbjct: 230 PFTIVNSASSTRLSDSKHECGFHLIELGKQTHYRR 264


>gi|124266912|ref|YP_001020916.1| putative DNA repair exonuclease [Methylibium petroleiphilum PM1]
 gi|124259687|gb|ABM94681.1| putative DNA repair exonuclease [Methylibium petroleiphilum PM1]
          Length = 265

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 48/289 (16%), Positives = 88/289 (30%), Gaps = 35/289 (12%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M VL  ISD H                                V   L         D V
Sbjct: 1   MSVLLQISDTHFGTEQG-------------------------AVVEALGTLAHQQRPDVV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  ++  +G P  +  VPGNHD  +     +    +  Y  + 
Sbjct: 36  VLSGDITQRARPAQFRAARSFVDRLGAP--VLAVPGNHDIPLFDLWARLRSPYGRYSAAF 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                     P       + ++  +T         +G     Q    ++L+  A+     
Sbjct: 94  GIDLEPVHRSP------ELLVVCVNTTRP--WRHKDGEVSALQIDRVARLVEHADPAQLR 145

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
            +++     V       NR+ G     +     GADL++ GH HL  +  ++   + + V
Sbjct: 146 VVVVHQPIAVTRAEEEPNRLRGHAAALQPWAEAGADLVMGGHIHLPYVMPLQGLARSLWV 205

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
           V   +A      +    S NL              +++    D  + + 
Sbjct: 206 VQAGTAVSSRVRDGMPNSVNLLRWGADAAPGCCRIEQWDYKGDDRAFRL 254


>gi|33597917|ref|NP_885560.1| DNA repair exonuclease [Bordetella parapertussis 12822]
 gi|33574346|emb|CAE38682.1| probable DNA repair exonuclease [Bordetella parapertussis]
          Length = 271

 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 56/300 (18%), Positives = 98/300 (32%), Gaps = 41/300 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD H                              + V + L         D V
Sbjct: 1   MMRVLHISDTHFGTE-------------------------REPVVHALHALADTLRPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            + GDI       +   +  +++++  P  +  VPGNHD  +     +    + +Y  + 
Sbjct: 36  VLGGDITQRARRGQFAAARRFIQALQRP--VLAVPGNHDIPLFNLAARLFDPYGNYRRAL 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +   + +  IG ++  A      NG   + QA   ++ LR A   G  
Sbjct: 94  GAVLEP------VYEDDRLLAIGVNSTRAA--RRKNGEVSRTQAQRVAQRLRDARP-GQL 144

Query: 189 RIIMMHHPPVLD-TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK--- 244
           R++ +HHP      S   N + G +         G DLIL GH HL  +  +  +     
Sbjct: 145 RVVALHHPVHAMVESDQRNLLIGREFAVPAWVDAGVDLILGGHIHLPYVAPLHGKAGEAG 204

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
                V   +A  +    +   S NL     + +      +R+    DS +       + 
Sbjct: 205 RRAWAVQAGTAVSRRVPGRVPNSVNLIDYAAQADSPACTVQRWDFQTDSGAFVLFGQQVL 264


>gi|33602822|ref|NP_890382.1| DNA repair exonuclease [Bordetella bronchiseptica RB50]
 gi|33577264|emb|CAE35821.1| probable DNA repair exonuclease [Bordetella bronchiseptica RB50]
          Length = 271

 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 56/300 (18%), Positives = 98/300 (32%), Gaps = 41/300 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD H                              + V + L         D V
Sbjct: 1   MMRVLHISDTHFGTE-------------------------REPVVHALHALADTLRPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            + GDI       +   +  +++++  P  +  VPGNHD  +     +    + +Y  + 
Sbjct: 36  VLGGDITQRARRGQFAAARRFIQALQRP--VLAVPGNHDIPLFNLAARLFDPYGNYRRAL 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +   + +  IG ++  A      NG   + QA   ++ LR A   G  
Sbjct: 94  GAVLEP------VYEDDRLLAIGVNSTRAA--RRKNGEVSRAQAQRVAQRLRDARP-GQL 144

Query: 189 RIIMMHHPPVLD-TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK--- 244
           R++ +HHP      S   N + G +         G DLIL GH HL  +  +  +     
Sbjct: 145 RVVALHHPVHAMVESDQRNLLIGREFAVPAWVDAGVDLILGGHIHLPYVAPLHGKAGAAG 204

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
                V   +A  +    +   S NL     + +      +R+    DS +       + 
Sbjct: 205 RRAWTVQAGTAVSRRVRGRVPNSVNLIDYAAQADSPACTVQRWDFQTDSGAFVLFGQQVL 264


>gi|261883775|ref|ZP_06007814.1| metallophosphoesterase [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 213

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 87/201 (43%), Positives = 127/201 (63%), Gaps = 1/201 (0%)

Query: 27  FELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTS 86
            EL+ KRI G +NW  +RK      V + LI D+L    DH+++TGD+VN   N EI  +
Sbjct: 13  SELASKRITGYINWLRSRKSAMHGTVLDSLIADMLAQTPDHIAVTGDLVNLALNLEIDIA 72

Query: 87  THWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKL-FPYLRIRN 145
             WL+ +G P DIS+VPGNHDAY+ GA +K+   W+ ++      + G++  FPY+R R 
Sbjct: 73  HDWLQLLGAPGDISVVPGNHDAYVPGALDKACRKWEPWMRGAGVDNKGRRPQFPYMRERG 132

Query: 146 NIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLY 205
            +ALIG S+A AT PF A+G F   Q    + +L KA  +G FR++M+HHPPV   +S +
Sbjct: 133 PVALIGVSSARATAPFMASGDFLPAQGKRLAAMLDKAGARGLFRVVMIHHPPVHGATSAH 192

Query: 206 NRMFGIQRFQKMIWHEGADLI 226
            R++GI+RFQK+I    A+L+
Sbjct: 193 KRLYGIRRFQKIIREHEAELV 213


>gi|33592001|ref|NP_879645.1| DNA repair exonuclease [Bordetella pertussis Tohama I]
 gi|33571645|emb|CAE41137.1| probable DNA repair exonuclease [Bordetella pertussis Tohama I]
 gi|332381417|gb|AEE66264.1| DNA repair exonuclease [Bordetella pertussis CS]
          Length = 271

 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 56/300 (18%), Positives = 98/300 (32%), Gaps = 41/300 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD H                              + V + L         D V
Sbjct: 1   MMRVLHISDTHFGTE-------------------------REPVVHALHALADTLRPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            + GDI       +   +  +++++  P  +  VPGNHD  +     +    + +Y  + 
Sbjct: 36  VLGGDITQRARRGQFAAARRFIQALQRP--VLAVPGNHDIPLFNLAARLFDPYGNYRRAL 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +   + +  IG ++  A      NG   + QA   ++ LR A   G  
Sbjct: 94  GAVLEP------VYEDDRLLAIGVNSTRAA--RRKNGEVSRTQAQRVAQRLRDARP-GQL 144

Query: 189 RIIMMHHPPVLD-TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK--- 244
           R++ +HHP      S   N + G +         G DLIL GH HL  +  +  +     
Sbjct: 145 RVVALHHPVHAMVESDQRNLLIGREFAVPAWVDAGVDLILGGHIHLPYVAPLHGKAGEAG 204

Query: 245 -LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
                V   +A  +    +   S NL     + +      +R+    DS +       + 
Sbjct: 205 RRAWTVQAGTAVSRRVRGRVPNSVNLIDYAAQADSPACTVQRWDFQTDSGAFVLFGQQVL 264


>gi|62185440|ref|YP_220225.1| hypothetical protein CAB837 [Chlamydophila abortus S26/3]
 gi|62148507|emb|CAH64278.1| conserved hypothetical protein [Chlamydophila abortus S26/3]
          Length = 293

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/291 (18%), Positives = 105/291 (36%), Gaps = 18/291 (6%)

Query: 11  VLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            + HISD+H    P        KR  G +   F    + S  +A    +  +    D + 
Sbjct: 10  RIIHISDVHFCVFPKNPLTCFNKRFKGALRQVFGGVTFQSSTIAKRFPDLAVQLQADSIC 69

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD      + E   +  ++ ++     + ++PGNHD Y   A  +     + +     
Sbjct: 70  ITGDFSLTALDAEFLLAQDFVNTLAQNASVYVLPGNHDVYTQQALNQ-----QTFYHYFP 124

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   + ++ ++  L+    +     FSANG     Q       +     K    
Sbjct: 125 NVQLQNEQISFNKLIDHWWLVLLDCSCLNGWFSANGMIKSSQISVLENFILSLPPKE--N 182

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPV 248
           II+ +H P+L T    + +      Q ++       L LHGH H  +++  K +     +
Sbjct: 183 IIIANHYPLLPTKDPSHDLINHLLLQHVLKKYPNVRLYLHGHNHQAAVYNFK-DHAPNMI 241

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYW---TLEGKRYTLSPDSLSIQ 296
           +   S S         A +++  +  +  +     +     T  P  +SI+
Sbjct: 242 LNSGSVSL-----PSNARFHIIDLYPQGYHVYTAAITNLLNTQEPLKISIE 287


>gi|121605438|ref|YP_982767.1| metallophosphoesterase [Polaromonas naphthalenivorans CJ2]
 gi|120594407|gb|ABM37846.1| metallophosphoesterase [Polaromonas naphthalenivorans CJ2]
          Length = 271

 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 44/292 (15%), Positives = 84/292 (28%), Gaps = 38/292 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L  ISD H                                V   L+        D +
Sbjct: 1   MACLLQISDPHFGT-------------------------VQPAVMQALVRLAQEQRPDVL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  +   +  P  +  + GNHD  +    ++    +  ++ + 
Sbjct: 36  VLSGDITQRARVSQFNEARAFCDRLAIP-RMLAIAGNHDIPLLNLYQRLFTPYARFLRAF 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                     P       + +IG  T         NG     Q       L ++      
Sbjct: 95  GPVLEPVVSTPL------LHVIGVKTTR--RWRHKNGEVSAAQIGRVVAELGRSAPAQLR 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK---- 244
            +++     VL     ++R+ G +         GAD+++ GH HL  +  +         
Sbjct: 147 IVVVHQPVHVLHAEDQHDRLRGWEPAVHAWARAGADIVMGGHIHLPYVCDLSTRLGALER 206

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
            +  V   +A           S NL   E   +    + +R+     S   +
Sbjct: 207 RLWCVQAGTALSTRVRQGIPNSVNLLRYEGAGQPLACQLERWDFQAASGQFE 258


>gi|315230213|ref|YP_004070649.1| lacZ expression regulatory protein [Thermococcus barophilus MP]
 gi|315183241|gb|ADT83426.1| lacZ expression regulatory protein [Thermococcus barophilus MP]
          Length = 507

 Score =  129 bits (324), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 56/287 (19%), Positives = 108/287 (37%), Gaps = 52/287 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++  P+F   +                       +L++N++   + D V
Sbjct: 1   MIRIAHISDTHITQDPAFKSYAY----------------------DLIVNEVNRSDFDLV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ N     E   +++ +R I  P  + ++PGNHDA                    
Sbjct: 39  IHTGDVTNQGLKEEYEHASYLIRKIEKP--LIVLPGNHDARNV---------------GY 81

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +  R+++ +I   +   T P  ++G  G  +     + L + + K  F
Sbjct: 82  ELFEKYIGPLYGVYERDDLVIIWIDS---TIPDLSDGRVGGYKFRWLKEKLEEYSHK-KF 137

Query: 189 RIIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +I+  HH   P+ DT    N ++       ++     +L L GH H+ +++ I+     +
Sbjct: 138 KIVAAHHHLVPLPDTGRERNVLYNAGDVLDLLLRHEVNLYLCGHKHVPNVYSIE----DL 193

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
            VV     S +        SYN+  +        ++     ++ D  
Sbjct: 194 VVVNAGCTSCRKTRKGDVNSYNIIKLNGDG---RIDVTIRRVTGDEE 237



 Score = 80.8 bits (197), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 44/245 (17%), Positives = 78/245 (31%), Gaps = 29/245 (11%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHVSITGDIVNFTCNREIFTSTHWLR 91
           RI+ +   + + + YF K V    I  I      D V   GDIV+    R    +  +  
Sbjct: 258 RIVQMSESNVSDRIYFRKRVLENAIRAINEKYKPDLVIHCGDIVDVGIERYYEAAAGYYE 317

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            I     I     +         ++                      P ++   +   I 
Sbjct: 318 KIKAEKMIVPGHNDITYLGYDLFKEYF------------------GEPEIKEFGDFVFIP 359

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVL-DTSSLYNRMFG 210
             TA    P    G  GQ    +  +  ++      F  ++MHH  +    S     +  
Sbjct: 360 LLTAQYETPIGVVGRMGQRLLKSLLEEHKE-----KFTAVVMHHNLIPIPRSRELGFLED 414

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                K++  E  +L++ GH        I+      P+V   S S ++  +    S+NL 
Sbjct: 415 AGNVLKILTEERTELVMTGHGGNAFGVRIE----RTPIVNAGSVSWELQRDPFGNSFNLI 470

Query: 271 YIEKK 275
            I + 
Sbjct: 471 DIYED 475


>gi|20094867|ref|NP_614714.1| calcineurin superfamily phosphohydrolase [Methanopyrus kandleri
           AV19]
 gi|19888094|gb|AAM02644.1| Predicted calcineurin superfamily phosphohydrolase [Methanopyrus
           kandleri AV19]
          Length = 270

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 59/297 (19%), Positives = 100/297 (33%), Gaps = 49/297 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H+S                       +K +S EV    I  I     D V +
Sbjct: 4   KIVHISDLHISP---------------------YRKSWSPEVFYRGIEQINDLRPDVVIV 42

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ +    RE    +  L  I  P  +  VPGNHDA   G                  
Sbjct: 43  TGDLTDNGLVREYEEVSSLLEKIEAP--VVPVPGNHDARNLGWMTF-------------- 86

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                  +   R+  ++ ++G  ++    P    G  G+E+     + LR+        I
Sbjct: 87  EDVFGDRYRVERVSADLYVVGLDSS---EPDVDYGQLGRERQEWLEETLRRIPGGACKCI 143

Query: 191 IMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            M HH  PV       N +        +    G DL+L GH H+     ++       VV
Sbjct: 144 AMHHHLLPVPGAGRERNVLVDAGEMINLCIKYGVDLVLCGHRHVPFAAKVE----DTVVV 199

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKN---EYWTLEGKR-YTLSPDSLSIQKDYSDI 302
              + S        + S+N+    +       + +  +R   L+     +++    +
Sbjct: 200 NAGTFSATKLRGYSRNSFNVIEFSESTVSVNLYEITTERKLELARYKPVVREGEYRL 256


>gi|89897952|ref|YP_515062.1| phosphohydrolase [Chlamydophila felis Fe/C-56]
 gi|89331324|dbj|BAE80917.1| phosphohydrolase [Chlamydophila felis Fe/C-56]
          Length = 293

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 57/291 (19%), Positives = 105/291 (36%), Gaps = 18/291 (6%)

Query: 11  VLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            + HISD+H    P        KR  G +   F    + S  +A            D + 
Sbjct: 10  RIIHISDVHFCVFPRNPLTCLNKRFKGALRQIFGGVTFQSSTIAERFPELATRLQADSIC 69

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD      + E   +  ++ ++     +  +PGNHD Y   A  +     + +     
Sbjct: 70  ITGDFSLTALDAEFLLAQDFVNNLSQNASVYALPGNHDVYTQKALNQ-----QTFYQYFP 124

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   + ++ ++  L+    +     FSANG     Q       +     K    
Sbjct: 125 NVQLQNERISFNKLMDHWWLVLLDCSCLNGWFSANGMIQSSQTSVLENFILSLPPKE--N 182

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPV 248
           II+ +H P+L T    + +      Q ++       L LHGH H  +++   N K   P 
Sbjct: 183 IIIANHYPLLPTKDPSHDLINHLLLQHVLKKYPNVRLYLHGHNHQAAVY---NCKDHAPN 239

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYW---TLEGKRYTLSPDSLSIQ 296
           + + S S  + S    A +++  +  +  +     +     T  P  +SI+
Sbjct: 240 MILNSGSVSLPS---NARFHIIDLYPQGYHVYTAEITNLLNTKEPLEISIE 287


>gi|329943207|ref|ZP_08291981.1| calcineurin-like phosphoesterase family protein [Chlamydophila
           psittaci Cal10]
 gi|332287787|ref|YP_004422688.1| putative phosphohydrolase [Chlamydophila psittaci 6BC]
 gi|313848359|emb|CBY17363.1| conserved hypothetical protein [Chlamydophila psittaci RD1]
 gi|325506738|gb|ADZ18376.1| putative phosphohydrolase [Chlamydophila psittaci 6BC]
 gi|328814754|gb|EGF84744.1| calcineurin-like phosphoesterase family protein [Chlamydophila
           psittaci Cal10]
 gi|328915045|gb|AEB55878.1| Ser/Thr protein phosphatase family protein family [Chlamydophila
           psittaci 6BC]
          Length = 293

 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 54/291 (18%), Positives = 108/291 (37%), Gaps = 18/291 (6%)

Query: 11  VLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            + HISD+H    P        KR  G++   F    + S  +A    +  +    D + 
Sbjct: 10  RIIHISDVHFCVFPRNPLTCFNKRFKGVLRQVFGGVTFQSSTIAKRFPDLAVKLQADSIC 69

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD      ++E   +  ++ ++     + ++PGNHD Y   A ++     K +     
Sbjct: 70  ITGDFSLTALDKEFLLAQDFVHTLAQNASVYVLPGNHDVYTQQALDQ-----KTFYNYFP 124

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   + ++ ++  L+    +     FSANG     Q       +     +    
Sbjct: 125 NIQLQNEQISFNKLMDHWWLVLLDCSCLNGWFSANGMIKSSQISILENFILSLPPQE--N 182

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPV 248
           II+ +H P+L T    + +      Q ++       L LHGH H  +++  K +     +
Sbjct: 183 IIIANHYPLLPTKDPSHDLINHLLLQHVLKKYPNVRLYLHGHNHQAAVYNFK-DHAPNMI 241

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYW---TLEGKRYTLSPDSLSIQ 296
           +   S S         A +++  +  +  +     +     T  P  +SI+
Sbjct: 242 LNSGSVSL-----PSNARFHIIDLYPQGYHVYTAAITNLLNTQEPLEISIE 287


>gi|218441067|ref|YP_002379396.1| metallophosphoesterase [Cyanothece sp. PCC 7424]
 gi|218173795|gb|ACK72528.1| metallophosphoesterase [Cyanothece sp. PCC 7424]
          Length = 364

 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 53/308 (17%), Positives = 100/308 (32%), Gaps = 35/308 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A ISD H++ S +   +                   S     L++  I   ++D + 
Sbjct: 3   FRFAVISDPHIAISQTIRNIPN----------RFHLVEVSIPALELVLKHIEQLDLDFLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH-AWKDYITSD 128
           + GD+               L ++  P  + +VPGNHD         S+         S 
Sbjct: 53  LPGDLTQDGEPENHHWLRQRLEAL--PFPVYVVPGNHDVPTPFPTASSIGLKDFPNYYSP 110

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 ++L+    +   I LIG ++ +        G   +EQ     K L +  ++  F
Sbjct: 111 FGYYNPQQLYYTCEVLPGIQLIGLNSNLFDGEGKQLGCLDEEQLIWLEKTLSEVKEQ--F 168

Query: 189 RIIMMHHPPVLDTS-------SLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            I+M+HH  +                +       +++   G  LI  GH H+  + + + 
Sbjct: 169 VIVMIHHNVIEHLPGQSDHVLGRRYMLDNAPMVLQLLEKYGVKLIFTGHLHIQDIAYHQG 228

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYI---EKKNEYWTLEGKRYTLSPDSLSIQKD 298
               I  +   S     H       Y +  I    +K +   ++  R    P   ++ + 
Sbjct: 229 ----IYEITTGSLVSYPHP------YRIIDINYQRQKQQEVKVKSYRVNSVPGWENLPEM 278

Query: 299 YSDIFYDT 306
                 D 
Sbjct: 279 SRQWLSDR 286


>gi|148642443|ref|YP_001272956.1| phosphohydrolase calcineurin-like superfamily [Methanobrevibacter
           smithii ATCC 35061]
 gi|222446058|ref|ZP_03608573.1| hypothetical protein METSMIALI_01707 [Methanobrevibacter smithii
           DSM 2375]
 gi|261349403|ref|ZP_05974820.1| LacZ expression regulatory protein [Methanobrevibacter smithii DSM
           2374]
 gi|148551460|gb|ABQ86588.1| predicted phosphohydrolase, calcineurin-like superfamily
           [Methanobrevibacter smithii ATCC 35061]
 gi|222435623|gb|EEE42788.1| hypothetical protein METSMIALI_01707 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861766|gb|EFC94064.1| LacZ expression regulatory protein [Methanobrevibacter smithii DSM
           2374]
          Length = 247

 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 57/269 (21%), Positives = 97/269 (36%), Gaps = 48/269 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++ HISD+H+S                          F ++V    + +I   N D +
Sbjct: 1   MPLIVHISDLHISELG-----------------------FEEDVFIKAVAEINAINPDMI 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ N     E   +T +L     P  +  VPGNHD                 +  +
Sbjct: 38  ILTGDLTNNGYYSEFIQATKYLEMFDAP--LFAVPGNHD--------------ARNLGYE 81

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           T      +    L   +   +IG  ++    P  ++G  G+ Q       L +   +  F
Sbjct: 82  TFEELIGECSWKLTKDDEFVVIGLDSS---SPDISSGNVGRPQHLWMEHQLDQCVIEELF 138

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            I+ +HH   P+  T    N +       K +     DL+L GH H+ ++  + N     
Sbjct: 139 SIVALHHHVIPIPKTGRERNVLTDAGDVLKTLTDHEVDLVLAGHKHVPNIWKMNN----T 194

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKK 275
             V   S S        + SYN++ I + 
Sbjct: 195 LFVNAGSLSSNKLRGDDKNSYNVYEITED 223


>gi|29840628|ref|NP_829734.1| hypothetical protein CCA00871 [Chlamydophila caviae GPIC]
 gi|29834978|gb|AAP05612.1| conserved hypothetical protein [Chlamydophila caviae GPIC]
          Length = 293

 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 56/291 (19%), Positives = 107/291 (36%), Gaps = 18/291 (6%)

Query: 11  VLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            + HISD+H    P        KR  G +   F    + S  +A    +  +    D + 
Sbjct: 10  RIIHISDVHFCVFPKNPLTCLNKRFKGALRQVFGGVTFQSSTIAERFPDLAVKLQADSIC 69

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD      + E   +  ++ ++     + ++PGNHD Y   A        + +     
Sbjct: 70  ITGDFSLTALDAEFLLAQDFVNNLARNASVYVLPGNHDVYTQKALN-----HQTFYQYFP 124

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   + ++ ++  L+    +     FSANG     Q       +     +    
Sbjct: 125 NTQLQNEQISFNKLVDHWWLVLLDCSCLNGWFSANGMIKSSQISILENFILSLPPQE--N 182

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLIPV 248
           II+ +H P+L T    + +      Q ++       L LHGH H  +++   N K   P 
Sbjct: 183 IIIANHYPLLPTKDPSHDLINYLLLQHVLKKYSNVRLYLHGHHHQAAVY---NCKDHAPN 239

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYW---TLEGKRYTLSPDSLSIQ 296
           + + S S  + S    A +++  +  +  +     +     T  P  +SI+
Sbjct: 240 MILNSGSISLPS---NARFHIIDLYPQGYHVYTTAITNLLDTKEPLEISIE 287


>gi|220917334|ref|YP_002492638.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955188|gb|ACL65572.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 304

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 54/276 (19%), Positives = 100/276 (36%), Gaps = 17/276 (6%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           +  L HISD+H++    +             +     +  S  +A  L++ +    VDH+
Sbjct: 26  ILRLGHISDLHVADRSRYPRNG---------FTARDCERHSTRLAKGLLDALREIGVDHL 76

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+      RE   +   LR       +++VPGNHD +   + E             
Sbjct: 77  VVTGDLTFSGEPREFERAAELLRPFAEAGKLTVVPGNHDVWTEESVETGRFLRALGPDGK 136

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIA-TPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                       + + +   L+   +A     P++  G  G EQ  A  +L R+  + G 
Sbjct: 137 GMKKAAPSYPHVVPLGDEAVLVALDSARYGDDPWTTPGRLGGEQLRAARELAREHARLGR 196

Query: 188 FRIIMMHH----PPVLDTSSLYNRMF---GIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
             ++  HH    PP    S  +          +  +++       +LHGH H      + 
Sbjct: 197 AVLLAFHHHVVLPPERVPSDAHVCRMPLADADQVVRLVAEVPVAAVLHGHRHTAFRVDLP 256

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
                 PV+   SAS+       +A   L+ +++  
Sbjct: 257 GAAGPTPVLCAGSASRTADEPVRRARAYLYEVDRTG 292


>gi|82617413|emb|CAI64324.1| probable phosphodiesterase [uncultured archaeon]
          Length = 266

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 54/312 (17%), Positives = 99/312 (31%), Gaps = 60/312 (19%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + H+SD+H+                          +F  +VA  ++  +   + D +
Sbjct: 1   MTRIVHLSDLHVC-----------------------GAHFLTDVAESVVQGVNKISPDIL 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD+      +E   +  W+      + + IVPGNHD+                    
Sbjct: 38  VITGDLTQNGSCQEYKEAKEWIDRFECRNKV-IVPGNHDSRNV---------------GY 81

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL------RKA 182
                           + + ++G  ++        +G+ G+E     ++        +  
Sbjct: 82  LLFEDIFGARSSCCSLDGVTVVGVDSSQHD---IDDGHLGREVYGWIAENFNSNLSSKSN 138

Query: 183 NKKGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK 240
                FRI  +HH   PV  T              +++   G D++L GH H+  +  + 
Sbjct: 139 LNSTDFRIFALHHHLIPVPMTGREEEIPVDSGDVLELLDRCGVDIVLCGHRHVPWVWKLN 198

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN------EYWTLEGKRYTLSPDSLS 294
                + VV   +A       K    YNL  IE             +   R   + +   
Sbjct: 199 G----MFVVNAGTACSNKIKAKTTQCYNLIEIENDGKGDTGDTGKHIRIYRVLPTGERTL 254

Query: 295 IQKDYSDIFYDT 306
           I     +IF  T
Sbjct: 255 IVDSVPEIFLKT 266


>gi|218461019|ref|ZP_03501110.1| putative phosphoesterase protein [Rhizobium etli Kim 5]
          Length = 191

 Score =  126 bits (316), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 94/191 (49%), Positives = 130/191 (68%), Gaps = 5/191 (2%)

Query: 9   MFVLAHISDIHLSYSPSFF--ELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           MF LAHISD+HL   P     EL  KRI G VNWH NR+K+      +LL++DI  H  D
Sbjct: 1   MFKLAHISDVHLGPLPRLSIQELFSKRITGFVNWHRNRRKHLFGSTLDLLLDDIRAHQAD 60

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           H+++TGD+VN     EI  +  WLR++G+P + S+VPGNHDAY+ GA EKS+ AW DY+ 
Sbjct: 61  HLAVTGDLVNLASGIEIRAAAAWLRALGDPAETSVVPGNHDAYVPGAYEKSMRAWYDYVR 120

Query: 127 SDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            D   +  ++    FPYLR+R+ +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A 
Sbjct: 121 GDLAPAQWQEDRHIFPYLRVRDKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAAG 180

Query: 184 KKGFFRIIMMH 194
           + G FR++M+H
Sbjct: 181 EAGLFRVVMIH 191


>gi|254485594|ref|ZP_05098799.1| 3',5'-cyclic-nucleotide phosphodiesterase [Roseobacter sp. GAI101]
 gi|214042463|gb|EEB83101.1| 3',5'-cyclic-nucleotide phosphodiesterase [Roseobacter sp. GAI101]
          Length = 265

 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 48/296 (16%), Positives = 96/296 (32%), Gaps = 41/296 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               ++   L+  + +   D V
Sbjct: 1   MSTLIHLSDLHFGK-------------------------DRPDLLEPLVERVNVLAPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+       +   +  +++ I     +  VPGNHD  +     +    W+ Y    
Sbjct: 36  VISGDLTQRAREEQFKEARDFIKKINA--RVLSVPGNHDVSLHRPFRRFFWPWRSYKKYI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               T +         + + ++G ++          G    E+ +     +  A   G  
Sbjct: 94  DQDLTPR------FENDEMIVVGINSV--DRFSWQTGRLTAERINHACDAMDHA-PDGKT 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           RI+++HHP      +    + G +   + +   GA+LIL GH H         +      
Sbjct: 145 RILVVHHPLEHPAETEKKPIPGAEEALERLLSCGANLILSGHLHTWHAGNFTVKSGKTTA 204

Query: 249 VG-IASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           V   A  S           +N+  I        +  +R + + ++   +   +  F
Sbjct: 205 VQLHAGTSLSSRVRGEANDFNVIDILDG----RIGIERLSFNEETQQFETTEARQF 256


>gi|319796022|ref|YP_004157662.1| metallophosphoesterase [Variovorax paradoxus EPS]
 gi|315598485|gb|ADU39551.1| metallophosphoesterase [Variovorax paradoxus EPS]
          Length = 275

 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 46/289 (15%), Positives = 83/289 (28%), Gaps = 38/289 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           L  ISD H                               EV   L           V ++
Sbjct: 5   LLQISDPHFGTE-------------------------QPEVLRALERFAEALAPQVVVMS 39

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GDI       +   +  ++  +  P    +VPGNHD  +     +    +  Y  +    
Sbjct: 40  GDITQRATRVQFAAARAFVDRLAAPAK-LVVPGNHDIPLFQLAARCFSPYGRYREAFGDD 98

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
                         +  ++  +T        ++G     Q    ++ L  A+      ++
Sbjct: 99  LEP------AFESEDWLVVTVNTTR--WYRHSDGVVSPAQVERVAQRLAAASPSQLRVVV 150

Query: 192 MMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK----NEKKLIP 247
                 V     L NR+ G +R        G DLIL GH HL  +  +       K+   
Sbjct: 151 THQPVMVTREEDLSNRLHGRERAVARWSEAGVDLILGGHIHLPYVRSLHDAFSGCKRTAF 210

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
            V   +A           S N+  +    +      +R+  +    + +
Sbjct: 211 AVQAGTAVSHRVRAGFANSVNVVRLAMSGDTRACRVERWDYAAAGKAFE 259


>gi|83815871|ref|YP_446078.1| transcriptional regulator, Icc related protein [Salinibacter ruber
           DSM 13855]
 gi|83757265|gb|ABC45378.1| transcriptional regulator, Icc related protein [Salinibacter ruber
           DSM 13855]
          Length = 267

 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 58/300 (19%), Positives = 99/300 (33%), Gaps = 43/300 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +AHISD+H                          +     V   L+++I    +D V+
Sbjct: 1   MTIAHISDLHFG------------------------RIADSGVVEALLDEINAAGIDLVA 36

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ++GD+       E   + + L ++G P    +V GNHD Y      K L    +      
Sbjct: 37  VSGDLTQRARPAEYRAARNLLDALGPPT--LVVAGNHDVYPWWRPLKRLRTPLERYRQFI 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
           T                +A +G ++A    P    G  G     A            F  
Sbjct: 95  TEDLAPT-----FEAGGVAALGLTSAYG--PSIKGGRIGPADRAAMRAFFSGTGDDRFKV 147

Query: 190 IIMMH--HPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK--L 245
           +++ H  HP  +   S +      Q+   +    G DLIL GH H++++  ++       
Sbjct: 148 LVVHHQLHPTAIGPISPHPVARQAQQTLAVAGEVGIDLILCGHLHISAIQPLEIIPGTPR 207

Query: 246 IPVVGIASASQKVHSN--KPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           I V    +A+         P   YN+  +E +        +     PD     +D    F
Sbjct: 208 IVVASAGTATSNRWREPTGPINFYNVVSVEPEAFS----VEERRYVPDEGRFVRDGVTRF 263


>gi|294507999|ref|YP_003572057.1| phosphohydrolases [Salinibacter ruber M8]
 gi|294344327|emb|CBH25105.1| Putative phosphohydrolases [Salinibacter ruber M8]
          Length = 267

 Score =  125 bits (314), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 58/300 (19%), Positives = 99/300 (33%), Gaps = 43/300 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +AHISD+H                          +     V   L+++I    +D V+
Sbjct: 1   MTIAHISDLHFG------------------------RIADSGVVEALLDEINAAGIDLVA 36

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ++GD+       E   + + L ++G P    +V GNHD Y      K L    +      
Sbjct: 37  VSGDLTQRARPAEYRAARNLLDALGPPT--LVVAGNHDVYPWWRPLKRLRTPLERYKQFI 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
           T                +A +G ++A    P    G  G     A            F  
Sbjct: 95  TEDLAPT-----FEAGGVAALGLTSAYG--PSIKGGRIGPADRAAMRAFFSGTGDDRFKV 147

Query: 190 IIMMH--HPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK--L 245
           +++ H  HP  +   S +      Q+   +    G DLIL GH H++++  ++       
Sbjct: 148 LVVHHQLHPTAIGPISPHPVARQAQQTLAVAGEVGIDLILCGHLHISAIQPLEIIPGTPR 207

Query: 246 IPVVGIASASQKVHSN--KPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           I V    +A+         P   YN+  +E +        +     PD     +D    F
Sbjct: 208 IVVASAGTATSNRWREPTGPINFYNVVSVEPEAFS----VEERRYVPDEGRFVRDGVTRF 263


>gi|307151271|ref|YP_003886655.1| metallophosphoesterase [Cyanothece sp. PCC 7822]
 gi|306981499|gb|ADN13380.1| metallophosphoesterase [Cyanothece sp. PCC 7822]
          Length = 365

 Score =  125 bits (313), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 49/290 (16%), Positives = 99/290 (34%), Gaps = 33/290 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A ISD H++ S +   +                   S     L++  +   ++D + 
Sbjct: 4   FRFAVISDPHIAISETIRNVPN----------RFHLVEVSIPALELVLTHLERLDLDFLL 53

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH-AWKDYITSD 128
           + GD+               L ++  P  + +VPGNHD       ++S+      Y   +
Sbjct: 54  LPGDLTQDGEPENHQWLRQRLEAL--PFPVYVVPGNHDVPTLFPTDQSIGLKDFPYYYPN 111

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 ++L+ +  +   + LIG ++          GY  ++Q     K L +   +   
Sbjct: 112 FGYHNPQQLYYHCELLPGVQLIGLNSNQFNQEGQQIGYLDEQQLTWLEKTLAEVKDQ--L 169

Query: 189 RIIMMHHPPVLDTS-------SLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+HH  +                +       K++   G  LI  GH H+  + + + 
Sbjct: 170 VMVMIHHNVIEHLPGQSHHILGRRYMLSNAPALFKLLHKYGVKLIFTGHLHVQDVAYQQG 229

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYI-EKKNEYWTLEGKRYTLSP 290
               I  +   S     H       Y +  +  K  +   +E K Y ++ 
Sbjct: 230 ----IYEITTGSLVSYPHP------YRIIQVQYKGQKQQEIEVKSYRVNG 269


>gi|212223890|ref|YP_002307126.1| metallophosphoesterase [Thermococcus onnurineus NA1]
 gi|212008847|gb|ACJ16229.1| metallophosphoesterase [Thermococcus onnurineus NA1]
          Length = 503

 Score =  125 bits (313), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 55/297 (18%), Positives = 103/297 (34%), Gaps = 50/297 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   ++   +                       +L++N+I   N D V
Sbjct: 1   MIRIAHISDTHITSESAYKGYAY----------------------DLIVNEINRGNFDFV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ N     E   +++ L+ I  P  + ++PGNHD                     
Sbjct: 39  IHTGDVTNQGLREEYERASYELKKIQKP--LIVIPGNHDVRNV---------------GY 81

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +    +  ++   +   T P  ++G  G  +     K L + + +  F
Sbjct: 82  ELFEKFIGPLNGVFEFRDGVIVWVDS---TIPDLSDGRIGGYKFKWLKKRLEEYSDR-KF 137

Query: 189 RIIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +I+  HH   P+ DT    N +F       ++   G +L   GH H+ +++ ++     +
Sbjct: 138 KIVASHHHIVPLPDTGRERNVLFNAGDVLDLLLRHGVNLYTCGHKHVPNVYRVE----DM 193

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            V      S +        SYN+  +        +  +R T              IF
Sbjct: 194 VVANAGCTSCRKTRKGDVNSYNIITLHDDGRI-EVTIRRVTGEELKKEYPPVRPKIF 249



 Score = 78.9 bits (192), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 43/252 (17%), Positives = 84/252 (33%), Gaps = 29/252 (11%)

Query: 26  FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHVSITGDIVNFTCNREIF 84
                  RI+ +   + + + YF ++V   +I  I      D V   GD+V+    R   
Sbjct: 251 PRGKRLLRIVQMSESNVSDRIYFRRKVLENVIRTINERLKPDIVIHCGDVVDMGIERYYE 310

Query: 85  TSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIR 144
            +  +   IG    +     +         ++                      P +   
Sbjct: 311 KAYEFYEKIGAEKLVVPGHNDITYLGYDLFKEYF------------------GKPKILEL 352

Query: 145 NNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVL-DTSS 203
                I   +A    P    G  GQ++     +   ++     F +++MHH  V    S 
Sbjct: 353 GKFTFIPVISAQYETPIGVVGRIGQKKLARHLEDYSES-----FTVVVMHHNIVPIPKSR 407

Query: 204 LYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKP 263
               +       K++  E A+L+L GH      +    + +  P+V   S S ++H N  
Sbjct: 408 EVGFLEDAGDVLKVLTREKANLVLTGH----GGNSFGVKVEKTPLVNAGSVSWELHRNPY 463

Query: 264 QASYNLFYIEKK 275
             ++NL  + + 
Sbjct: 464 GNTFNLIDVYRD 475


>gi|226946463|ref|YP_002801536.1| metallophosphoesterase protein [Azotobacter vinelandii DJ]
 gi|226721390|gb|ACO80561.1| Metallophosphoesterase protein [Azotobacter vinelandii DJ]
          Length = 291

 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/298 (15%), Positives = 92/298 (30%), Gaps = 40/298 (13%)

Query: 7   TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
             M  + HISD H                                V   L + +     D
Sbjct: 18  GTMTRILHISDTHFGTEQQP-------------------------VIEALESHVREQGAD 52

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGN--PHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            + ++GDI       +   +  ++R + +       ++PGNHD  +     + L  + +Y
Sbjct: 53  LLVLSGDITQRARREQFDAAVAFVRRLEDCGIPRSLVIPGNHDLPLHNLLARFLLPYGNY 112

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
                               + + +IG +T         +G     Q  A  + LR+++ 
Sbjct: 113 RRCFGWQLEPT------FENDELLVIGLNTTHP--RRRKDGRVTDAQVQAVCERLRRSDP 164

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL----HWIK 240
                ++       +  S L N   G +         G D+++ GH HL  +        
Sbjct: 165 DKLRIVVAHQPFGAMLPSDLSNLQHGAETALTRWAEAGLDIVMGGHIHLPYVLPLSGQYP 224

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD 298
              + I  V   +A           S+N  ++  +N    +  +R+   P +     +
Sbjct: 225 GLAREIWTVQAGTALSSRLRGNLPNSFNRLHL-GENPDRRVRVERWDYHPPTGRFVPE 281


>gi|253699990|ref|YP_003021179.1| metallophosphoesterase [Geobacter sp. M21]
 gi|251774840|gb|ACT17421.1| metallophosphoesterase [Geobacter sp. M21]
          Length = 266

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 47/290 (16%), Positives = 94/290 (32%), Gaps = 39/290 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD H                             +  V   L+        D +
Sbjct: 1   MSTILHISDTHFGTE-------------------------TPAVIEALLQLAGDQRPDLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+       +   +  +L  +  PH + ++PGNHD  +     +    + ++  S 
Sbjct: 36  VLSGDVTQRARAAQFKAAVEFLERMPVPH-LLVLPGNHDLPLFNILGRVFSPYGNFQRSF 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +     + ++G +T         +G     Q    S+ LR    +   
Sbjct: 95  GRDMEP------VFESQELLVVGVNTTRP--WRHKHGEVSPRQIETVSRRLRSGRAEQLR 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI---KNEKKL 245
            ++          S + N +   +         GADL+L GH HL  +  +       + 
Sbjct: 147 VVVAHQPVRATRESDVRNLLRNHRSAIHAWAEAGADLVLGGHVHLPHVRPLKEVHEIPRA 206

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           +  V   +A  +    +   S NL    K++E  +   +R+    D+  +
Sbjct: 207 VWSVLAGTAVSRRVRGEIPNSVNLIRYRKEDEPRSCLVERWDY--DARGV 254


>gi|46204008|ref|ZP_00209211.1| COG1409: Predicted phosphohydrolases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 292

 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 58/314 (18%), Positives = 92/314 (29%), Gaps = 56/314 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  LAHISD+H   +                            V   L+ ++     D +
Sbjct: 1   MRRLAHISDLHFGRT-------------------------DPAVVEGLVAELNRAPPDLI 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             +GD       RE   +  +L  +  P     VPGNHD        +  H ++ Y    
Sbjct: 36  VASGDFTMRARRREYAEARAFLDRLAAP--WIAVPGNHDIAYFKLFTRFFHPFRRYRRFI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKG 186
              +          + + IA+I  +T     P    + G   + Q   T + L  A    
Sbjct: 94  AQDTEPT------FLDDEIAVICLNTVRTWAPETDWSQGKITRTQIARTEERLA-AVPPQ 146

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGI-QRFQKMIWHEGADLILHGHTHLNSLHWIKNE--- 242
            FRI++ HHP +        R+ G            G  L L GH H +   + +     
Sbjct: 147 VFRIVVGHHPFMPPPWDAEARLVGRADEALDAFRRHGVGLTLAGHLHRHYARFAEAPATG 206

Query: 243 ----------------KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRY 286
                              +  V   SA+          +YN   I       T+     
Sbjct: 207 TEPDAVAVDRGVARASGTRLLAVQAGSATSTRLRGNEPNAYNRIVIADGQATVTVRIWTG 266

Query: 287 TLSPDSLSIQKDYS 300
               D+   +   S
Sbjct: 267 DAFEDAREEEAAPS 280


>gi|17230344|ref|NP_486892.1| hypothetical protein all2852 [Nostoc sp. PCC 7120]
 gi|17131946|dbj|BAB74551.1| all2852 [Nostoc sp. PCC 7120]
          Length = 371

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 44/302 (14%), Positives = 93/302 (30%), Gaps = 31/302 (10%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H++   + ++                            I  +   N+D + 
Sbjct: 5   FRFAVVSDLHIALPHTIWDHPS----------RFHLVEVGIPAFESAIKHLTKLNLDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKS-LHAWKDYITSD 128
           + GD+               L  +  P    +VPGNHD  +  A E+S   A        
Sbjct: 55  LPGDLTQHGEPENHRWLQERLSKL--PFPTYVVPGNHDVPVVMANEQSIACADFPQYYRQ 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 ++L+   ++   + LIG ++          G    +Q     ++L  A  +   
Sbjct: 113 FGYDNTEQLYYTQQLLPGVRLIGLNSNFFNEQGQQVGRLDAQQFQWLEEVLAAAVDELVL 172

Query: 189 RIIMMH---HPPV--LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            ++  +   H P       +    +       +++   G  L+  GH H+  +   +   
Sbjct: 173 VMVHHNVVEHLPHQSRHPMASRYMLENAPELVRLLQRYGVKLVFTGHLHVQDVACAEGVY 232

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYW---TLEGKRYTLSPDSLSIQKDYS 300
                +   S     H       Y +    +  +      +   R    P+  ++Q+   
Sbjct: 233 D----ITTGSLVSYPHP------YRVLEFHRDQQGQEWLQILSHRVESVPEFPNLQQLSR 282

Query: 301 DI 302
           D 
Sbjct: 283 DW 284


>gi|330817062|ref|YP_004360767.1| Metallophosphoesterase [Burkholderia gladioli BSR3]
 gi|327369455|gb|AEA60811.1| Metallophosphoesterase [Burkholderia gladioli BSR3]
          Length = 283

 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 45/296 (15%), Positives = 86/296 (29%), Gaps = 44/296 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L  ISD H                              +E  + L+  I     + V
Sbjct: 1   MSRLLQISDPHFGAE-------------------------RQEAVDALVRLIEQTRPELV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+       +   +  ++  +G    +  +PGNHD  +     +    + +Y  + 
Sbjct: 36  VISGDLTQRARRHQFEAARAFVARLGA-QPVLAIPGNHDLPLFDLIARWRQPYVNYRRAF 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +     +  IG +T          G    EQ    ++ L  A+     
Sbjct: 95  GEELEP------VFDAPALLAIGVNTTRPA--RHTAGEISAEQVARVARRLALASPAQLR 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI------KNE 242
            +++      +  ++ ++R+ G +   +     GADL+L GHTH      +         
Sbjct: 147 VVVVHQPIVAIGPANRHDRLHGGEIALRRWAAAGADLVLGGHTHRAGAWRVTPRDDEAGR 206

Query: 243 KK----LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLS 294
                  + +V   +A  +        S NL                     D   
Sbjct: 207 DGAVERPVFMVQGGTAVSRRLRAGTPNSVNLIDYAGDALGPRRAAVTRCDYDDESR 262


>gi|239817707|ref|YP_002946617.1| metallophosphoesterase [Variovorax paradoxus S110]
 gi|239804284|gb|ACS21351.1| metallophosphoesterase [Variovorax paradoxus S110]
          Length = 274

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 48/291 (16%), Positives = 84/291 (28%), Gaps = 38/291 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L  ISD H                               +V   L           V
Sbjct: 1   MSCLLQISDTHFGTE-------------------------QPDVMAALERLAQTLAPQVV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI      R+   +  ++  +  P  +  +PGNHD  +     +    +  Y  + 
Sbjct: 36  VLSGDITQRATRRQFAAARAFVDRLAAPA-VVAIPGNHDIPLFQLGARLFSPYGRYAGAF 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
            T          +    +  ++  +T        A+G     Q    +  L  A      
Sbjct: 95  GTDLEP------VFESADWLVVAVNTTR--WWRHADGEVSPAQIERVAARLAGALPSQLR 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP- 247
            ++      V     + NR+ G +         GADLIL GH HL  +  +       P 
Sbjct: 147 VVVTHQPVMVTRQEDMQNRLHGREAAVARWCAAGADLILGGHIHLPFVRSLHGAYAGCPR 206

Query: 248 ---VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
               V   +A           S N+  +    +    + +R+  S    + 
Sbjct: 207 TAWAVQAGTAVSSRVRAGHPNSVNVLRLGAPEDGRVCQAERWDHSAADKAF 257


>gi|268324463|emb|CBH38051.1| conserved hypothetical protein, calcineurin-like phosphoesterase
           family [uncultured archaeon]
 gi|268324870|emb|CBH38458.1| conserved hypothetical protein, calcineurin-like phosphoesterase
           family [uncultured archaeon]
          Length = 247

 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 98/294 (33%), Gaps = 52/294 (17%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISDIH+                        +++F  E+   +I  I     + V 
Sbjct: 1   MRVVHISDIHV-----------------------AEQHFLPELLERVIRSINEIEPEIVV 37

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+       E   +  ++  I     + ++PGNHDA                     
Sbjct: 38  VTGDLTENGHQSEFKRAKSYIEKIECEKKV-VIPGNHDARNV---------------GYL 81

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                      +     I ++G  +   T P    G+ G+E+     K L        F+
Sbjct: 82  GFEEIFGHRSIIEKGEGITIVGIDS---TQPDLDVGHVGREKYGWIEKSLNS----NDFK 134

Query: 190 IIMMHHPP--VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           ++ +HH    +  T              +++   G DL+L GH H+  +  +      + 
Sbjct: 135 VVALHHHLISIPKTGRERQIPMDAGDVLELLVRCGVDLVLCGHKHVPWIWNLNG----MI 190

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
           +    +A           S+NL  I+++ +  T   + Y+     L ++K    
Sbjct: 191 IANAGTACTSRVKWNIPQSFNLIEIDEEEKGTTKIYRMYSSGGQELVLEKRRDR 244


>gi|312137489|ref|YP_004004826.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
 gi|311225208|gb|ADP78064.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
          Length = 247

 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 55/274 (20%), Positives = 87/274 (31%), Gaps = 44/274 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +AH+SD H+       +L  K                        +N +     D V ++
Sbjct: 3   IAHLSDFHVGEFKFKEKLLKK-----------------------ALNQVKNIRPDVVIVS 39

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GDI N    +E   +  +L  I        VPGNHDA   G                   
Sbjct: 40  GDITNNGYYQEFIEAKKYLDEISEIIPTITVPGNHDARHVG-------------YEVFEE 86

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
             G +            +IG  ++    P    G  G+EQ     K L+KA  K     +
Sbjct: 87  VIGPRSGVLKNKNKKFVVIGLDSS---EPDLDCGKIGREQQKWLEKELKKAKNKFKIVAL 143

Query: 192 MMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGI 251
             H  PV  T    N +       + +     DL++ GH H+     ++           
Sbjct: 144 HHHIIPVPKTGRERNVLLDAGDILESLVKYDVDLVVCGHRHVPYSWNLEG----CVFATA 199

Query: 252 ASASQKVHSNKPQASYNLFYIEKKNEYWT-LEGK 284
            + S      K   SYN++ + +K       E +
Sbjct: 200 GTVSSPSLRAKNPNSYNVYLVNEKEIKVKLCEVE 233


>gi|240141274|ref|YP_002965754.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens AM1]
 gi|240011251|gb|ACS42477.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens AM1]
          Length = 294

 Score =  122 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 52/297 (17%), Positives = 86/297 (28%), Gaps = 56/297 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD+H   +                            V   L+ ++     D +
Sbjct: 1   MRRVAHISDLHFGRT-------------------------DPAVVEALVAELNRDPPDLI 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             +GD       +E   +  +L  +  P     VPGNHD        +  H +  Y    
Sbjct: 36  VASGDFTMRARRKEYVAARAFLDRLTAP--WIAVPGNHDIAYFKLLTRFFHPFGRYRRFI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKG 186
              +          + + IA++  +T     P    + G   + Q   T + L       
Sbjct: 94  AKDTEPT------FLDDEIAVVCLNTVRTWAPETDWSQGKITRAQIARTEERLAAL-PDH 146

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGI-QRFQKMIWHEGADLILHGHTHLNSLHWIKNE--- 242
            FRI++ HHP +        R+ G               L L GH H +   + +     
Sbjct: 147 VFRIVVGHHPFMPPPWDAEARLVGRADEALDAFRRHNVGLTLAGHLHRHYSRFAEAPETG 206

Query: 243 ----------------KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
                              +  V   SA+          +YN   IE      T+  
Sbjct: 207 TEPDLVSVDRGMARAGGARLLAVQAGSATSTRLRGNEPNAYNRIVIEDGRATVTVRV 263


>gi|218532766|ref|YP_002423582.1| metallophosphoesterase [Methylobacterium chloromethanicum CM4]
 gi|254563783|ref|YP_003070878.1| metallophosphatase/metallophosphoesterase [Methylobacterium
           extorquens DM4]
 gi|218525069|gb|ACK85654.1| metallophosphoesterase [Methylobacterium chloromethanicum CM4]
 gi|254271061|emb|CAX27068.1| putative metallophosphatase/metallophosphoesterase
           [Methylobacterium extorquens DM4]
          Length = 294

 Score =  122 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 52/297 (17%), Positives = 86/297 (28%), Gaps = 56/297 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD+H   +                            V   L+ ++     D +
Sbjct: 1   MRRVAHISDLHFGRT-------------------------DPAVVEALVAELNRDPPDLI 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             +GD       +E   +  +L  +  P     VPGNHD        +  H +  Y    
Sbjct: 36  VASGDFTMRARRKEYVAARAFLDRLTAP--WIAVPGNHDIAYFKLLTRFFHPFGRYRRFI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKG 186
              +          + + IA++  +T     P    + G   + Q   T + L       
Sbjct: 94  AKDTEPT------FLDDEIAVVCLNTVRTWAPETDWSQGKITRAQIARTEERLAAL-PDH 146

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGI-QRFQKMIWHEGADLILHGHTHLNSLHWIKNE--- 242
            FRI++ HHP +        R+ G               L L GH H +   + +     
Sbjct: 147 VFRIVVGHHPFMPPPWDAEARLVGRADEALDAFRRHNVGLTLAGHLHRHYSRFAEAPETG 206

Query: 243 ----------------KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
                              +  V   SA+          +YN   IE      T+  
Sbjct: 207 TEPDLVSVDRGMARAGGARLLAVQAGSATSTRLRGNEPNAYNRIVIEDGRATVTVRV 263


>gi|209964654|ref|YP_002297569.1| 3',5'-cyclic-nucleotide phosphodiesterase, putative [Rhodospirillum
           centenum SW]
 gi|209958120|gb|ACI98756.1| 3',5'-cyclic-nucleotide phosphodiesterase, putative [Rhodospirillum
           centenum SW]
          Length = 286

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 57/279 (20%), Positives = 99/279 (35%), Gaps = 40/279 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD+H                                V   L +D+     D +
Sbjct: 1   MRRIAHISDLHFG-------------------------RIDPAVVAALRDDLAAQAPDLI 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+       +   +  +L  +  PH +  VPGNHD        + +   ++Y    
Sbjct: 36  VVSGDLTQRARPSQFRAARAFLADLPAPHMV--VPGNHDLPAFNLLARLVDPLRNYRRYI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                            N+A++G +T+ +     A G   Q Q       LR+   +  F
Sbjct: 94  AEDLDP------FLNLGNLAVLGLNTSRSLILDFAEGRVNQRQMDRILGCLRELGPE-VF 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQ-RFQKMIWHEGADLILHGHTHLNSLHWIKNEK---- 243
           +++  HHP +        R+ G   R  + +   G DL+L GH H      + +      
Sbjct: 147 KVVFTHHPFLPPPDHPGRRLVGRATRALRALEAAGVDLLLAGHLHRAYSGDVMSHHAHVE 206

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           + I V   ++A+     N+P A +NL  I   +    L 
Sbjct: 207 RSILVAQASTATSTRLRNEPNA-WNLIEIAPPSLVLRLR 244


>gi|187477535|ref|YP_785559.1| metallo-phosphoesterase [Bordetella avium 197N]
 gi|115422121|emb|CAJ48645.1| putative metallo-phosphoesterase [Bordetella avium 197N]
          Length = 260

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/285 (17%), Positives = 93/285 (32%), Gaps = 41/285 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD H                                V   L   I   + D V
Sbjct: 1   MTRVLHISDTHFGRQVVP-------------------------VVQALEVLIQRLDPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  +++ +  P  +  VPGNHD  +     +  + + +Y  + 
Sbjct: 36  LLSGDITQRARRGQFAAARQFVQGLRRP--VLTVPGNHDMPLFNLAARLFNPYGNYRRAM 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +    ++ ++G +++  +     +G    EQ    +  LR A + G  
Sbjct: 94  GVNLEP------VFDGEHLLVVGVNSSRPS--RRKHGEVSPEQIERVASRLR-AARPGQL 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQ-KMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           RI+M+HHP     +     +   +          GAD I  GH HL  +  +    +   
Sbjct: 145 RIVMLHHPVRGPKAGDSANLLIRRELAVPAWVDAGADFIAAGHAHLPYMLPL-GGSRCAW 203

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
            +   +A           S NL        +     +R+  +  S
Sbjct: 204 CLQAGTAVSSRLRGGMPNSVNLIE---HGGHDVCLVQRWDFNAAS 245


>gi|84503427|ref|ZP_01001487.1| possible phospodiesterase [Oceanicola batsensis HTCC2597]
 gi|84388214|gb|EAQ01166.1| possible phospodiesterase [Oceanicola batsensis HTCC2597]
          Length = 278

 Score =  122 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/292 (17%), Positives = 100/292 (34%), Gaps = 38/292 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               E+   L+  +     D V
Sbjct: 1   MTRLIHLSDLHFG-------------------------RDRPELMRPLLTAVNDLGPDIV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +I+GD+     + +   +  ++  I  P  +  VPGNHD        + L+++ +Y    
Sbjct: 36  AISGDLTQRARSSQFRAARTFIDHIEAP--VLCVPGNHDLPAHRPIRRFLNSFANYKRHI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           +       L P      ++A+IG +T       S    +   +    +  L ++  +   
Sbjct: 94  SPDLAPSLLCP------DLAVIGINTNSPFRWQSG---WASRRGIRKAAELCRSGPEHRL 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL-IP 247
            +++ HHP  +   S    MF  +     +   GA ++L GH H   +      +   I 
Sbjct: 145 NVVVAHHPFEMPEESHKRPMFNAEWGLACLAEAGAHVVLSGHLHRWRVIGTDKAEGPGII 204

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
            +   +        +P   + +  IE       L   R+   P++    ++ 
Sbjct: 205 QIHCGTGLSTRQRGEP-NDFAVLEIEGNRPDSALTVTRWIAGPENRFSPREQ 255


>gi|188584121|ref|YP_001927566.1| metallophosphoesterase [Methylobacterium populi BJ001]
 gi|179347619|gb|ACB83031.1| metallophosphoesterase [Methylobacterium populi BJ001]
          Length = 294

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/313 (16%), Positives = 89/313 (28%), Gaps = 60/313 (19%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD+H   +                            V + L  ++     D +
Sbjct: 1   MRRIAHISDLHFGRT-------------------------DTAVVDALAAELNRDPPDLI 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             +GD       +E   +  +L  +  P     VPGNHD        +  H +  Y    
Sbjct: 36  VASGDFTMRARRKEYVEARAFLDGLTAP--WIAVPGNHDIAYFKLFTRFFHPFGRYRRFI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKG 186
              +          + + IA++  +T     P    + G   + Q   T + L     + 
Sbjct: 94  ARDTEPT------FLDDEIAVVCLNTVRTWAPETDWSQGKITRAQIARTEERLAAL-PEH 146

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGI-QRFQKMIWHEGADLILHGHTHLNSLHWIKNE--- 242
            FRI++ HHP +        R+ G            G  L L GH H +   + +     
Sbjct: 147 VFRIVVGHHPFMPPPWDAEARLVGRADEALDAFRRHGVGLTLAGHLHRHYARFAEAPETG 206

Query: 243 ----------------KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRY 286
                              +  V   SA+          +YN   IE             
Sbjct: 207 AEPDSVAVDRGSAQAGGTRLLAVQAGSATSTRLRGNEPNAYNRIVIEDG----RATVTVR 262

Query: 287 TLSPDSLSIQKDY 299
             +       ++ 
Sbjct: 263 VWTGAGFEDVRED 275


>gi|163853821|ref|YP_001641864.1| metallophosphoesterase [Methylobacterium extorquens PA1]
 gi|163665426|gb|ABY32793.1| metallophosphoesterase [Methylobacterium extorquens PA1]
          Length = 292

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/297 (17%), Positives = 86/297 (28%), Gaps = 56/297 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD+H   +                            V   L+ ++     D +
Sbjct: 1   MRRVAHISDLHFGRT-------------------------DPAVVEALVAELNRDPPDLI 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             +GD       +E   +  +L  +  P     VPGNHD        +  H +  Y    
Sbjct: 36  VASGDFTMRARRKEYVAARAFLDRLTAP--WIAVPGNHDIAYFKLLTRFFHPFGRYRRFI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKG 186
              +          + + IA++  +T     P    + G   + Q   T + L       
Sbjct: 94  AKDTEPT------FLDDEIAVVCLNTVRTWAPETDWSQGKITRAQIARTEERLAAL-PDH 146

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGI-QRFQKMIWHEGADLILHGHTHLNSLHWIKNE--- 242
            FRI++ HHP +        R+ G               L L GH H +   + +     
Sbjct: 147 VFRIVVGHHPFMPPPWDAEARLVGRADEALDAFRRHNVGLTLAGHLHRHYSRFAEAPETG 206

Query: 243 ----------------KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
                              +  V   SA+          +YN   IE      T+  
Sbjct: 207 TEPDLVSVDRGMARAGGARLLAVQAGSATSTRLRGNEPNAYNRIVIEDGRATVTVRV 263


>gi|304314392|ref|YP_003849539.1| phosphohydrolase [Methanothermobacter marburgensis str. Marburg]
 gi|302587851|gb|ADL58226.1| predicted phosphohydrolase [Methanothermobacter marburgensis str.
           Marburg]
          Length = 245

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 62/270 (22%), Positives = 103/270 (38%), Gaps = 49/270 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++AHISD+H+                           F +++    I  I     D  
Sbjct: 1   MVLIAHISDLHVGAP-----------------------NFKEDILLEAIRQINELKPDAT 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD+ +     E   +  +L  +  PH    VPGNHDA   G   ++      Y    
Sbjct: 38  VITGDLTDNGYYLEFLQAAEYLSDLKGPH--IFVPGNHDARHVGN--ETFEDVFRYRKG- 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                         + +++ +IG  ++    P    G  G+ Q     + L +A+++G F
Sbjct: 93  ------------TFVMDDLTIIGLDSS---EPDLDYGKIGRSQQIWMEEELERASERGHF 137

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           R+I +HH   PV  T    N +         I  +GADL++ GH H+  +  ++      
Sbjct: 138 RVIALHHHIIPVPKTGRERNVLADAGDILYSIIRKGADLVISGHKHVPHVWRVE----DT 193

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKN 276
             V   + S      K   SYN +YI + +
Sbjct: 194 FFVTAGTVSSLKLRGKDINSYNTYYITEDS 223


>gi|332709207|ref|ZP_08429173.1| putative phosphohydrolase [Lyngbya majuscula 3L]
 gi|332352016|gb|EGJ31590.1| putative phosphohydrolase [Lyngbya majuscula 3L]
          Length = 370

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 46/299 (15%), Positives = 98/299 (32%), Gaps = 35/299 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H+    + ++                    S  V   ++ D+    +D + 
Sbjct: 5   FRFAVVSDLHIGLPHTIWDHPN----------RFHLVEVSIPVLERILEDLEQEALDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH-AWKDYITSD 128
           + GD+               L  +  P  + +VPGNHD       E S+      Y    
Sbjct: 55  LPGDLTQHGEPDNHAWLQKRLSQL--PFPVYVVPGNHDVPNILPNEHSIGLKEFPYYYRQ 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 ++L+    +   + LIG ++          G   Q+Q     ++L +   K   
Sbjct: 113 FGYENPEQLYYTCEVLPGVQLIGLNSNQFDTGGKQVGRLDQQQLIWLEQVLPQCQDK--L 170

Query: 189 RIIMMHHPPVLDTSS-------LYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+HH  +                +        ++   G +L+  GH H+  + + + 
Sbjct: 171 VLVMVHHNVIEHLPDQANHPLGHRYILENAPVLHNILKTAGVNLLFTGHLHVQDIAYQEG 230

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYI--EKKNEYW-TLEGKRYTLSPDSLSIQK 297
               +  +   S     H       Y +  +  + + + W  +E  R    P   ++ +
Sbjct: 231 ----VYEITTGSLVSYPHP------YRILQLCTDNQGKRWLQIESHRVESVPGWENLTQ 279


>gi|238027264|ref|YP_002911495.1| metallophosphoesterase [Burkholderia glumae BGR1]
 gi|237876458|gb|ACR28791.1| Metallophosphoesterase [Burkholderia glumae BGR1]
          Length = 277

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/298 (14%), Positives = 84/298 (28%), Gaps = 37/298 (12%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L  +SD H                                  + L+  +     D V
Sbjct: 1   MSTLLQVSDPHFGAE-------------------------WPAAVDALVALVTTLRPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+      R+   +  ++  +G P  +  +PGNHD  +     +    +  Y  + 
Sbjct: 36  VLSGDLTQRARRRQFDAARAFVDRLG-PQALLAIPGNHDIPLFDPFARLWRPYARYRHAF 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +     + + G +T          G     Q    ++    A      
Sbjct: 95  GADLEP------VFDAPTLLVQGVNTTRPA--RHTAGEISAAQIERVARRFELARPAQLR 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH--WIKNEKKLI 246
             ++         S  ++R+ G +   +     G DL+L GHTH   ++   +    + +
Sbjct: 147 VAVVHQPIATAGPSKRHDRLHGAEAALRRWADAGVDLVLGGHTHRPEINAVAVAGSTRKV 206

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYW-TLEGKRYTLSPDSLSIQKDYSDIF 303
             +   +A      +    S NL   +   E        RY               + 
Sbjct: 207 YAIQGGTAVSWRVRDGQPNSVNLIAYDHAGEGARRARVTRYEHDAAGGRFVAGEPRVL 264


>gi|75907271|ref|YP_321567.1| metallophosphoesterase [Anabaena variabilis ATCC 29413]
 gi|75700996|gb|ABA20672.1| Metallophosphoesterase [Anabaena variabilis ATCC 29413]
          Length = 357

 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 45/302 (14%), Positives = 93/302 (30%), Gaps = 31/302 (10%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H++   + ++                            IN +   N+D + 
Sbjct: 5   FRFAVVSDLHIALPHTIWDHPS----------RFHLVEVGIPAFENAINHLTKLNLDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKS-LHAWKDYITSD 128
           + GD+               L  +  P    +VPGNHD  +  A E+S   A        
Sbjct: 55  LPGDLTQHGEPENHRWLEERLSKL--PFPTYVVPGNHDVPVVMANEQSIACADFPQYYRQ 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                  +L+   ++   + LIG ++          G    +Q     ++L  A  +   
Sbjct: 113 FGYDNTDQLYYTQQLLPGVRLIGLNSNFFNEQGQQMGRLDAQQFQWLEEVLAAAVDELVL 172

Query: 189 RIIMMH---HPPV--LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            ++  +   H P       +    +       +++   G  L+  GH H+  +   +   
Sbjct: 173 VMVHHNVVEHLPHQSRHPMASRYMLENAPELVRLLQRYGVKLVFTGHLHVQDVACAEGVY 232

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYW---TLEGKRYTLSPDSLSIQKDYS 300
                +   S     H       Y +    +  +      +   R    P+  ++Q+   
Sbjct: 233 D----ITTGSLVSYPHP------YRVLEFHRDQQGQEWLQILSHRVESVPEFPNLQQLSR 282

Query: 301 DI 302
           D 
Sbjct: 283 DW 284


>gi|237653530|ref|YP_002889844.1| metallophosphoesterase [Thauera sp. MZ1T]
 gi|237624777|gb|ACR01467.1| metallophosphoesterase [Thauera sp. MZ1T]
          Length = 277

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/304 (15%), Positives = 88/304 (28%), Gaps = 47/304 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M VL HI+D H                                V   L+        D V
Sbjct: 1   MSVLLHIADTHFGTE-------------------------QPPVVEALVALAAQQRPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            + GDI       +   +  ++  +G P  +  VPGNHD  +     +    +  +    
Sbjct: 36  VLAGDITQRARPAQFRAARAFVDRLGAP--VLAVPGNHDIALFDLWARLTRPYARFTEVF 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +    ++ ++G +T  A      NG     Q    + LL  A+ +   
Sbjct: 94  GADLEP------VHASADLLVVGVNTTRA--WRHKNGEVSAAQVDRVAGLLASASPQQLR 145

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
            +++     V       + + G Q   +     GADL+L GH HL          + + V
Sbjct: 146 VVVVHQPAAVSCARDRADLVRGHQAALRAWSVAGADLVLGGHIHLPYTLAPPGLARRLWV 205

Query: 249 VGIASASQKVHSNKPQASYNLFYI------------EKKNEYWTLEGKRYTLSPDSLSIQ 296
           +   +A       +   S N+                   E  +   +++          
Sbjct: 206 LQAGTAVSWRTRAEVPNSVNILRWGEAAGAHEPPAQHGAAEGASCLVEQWDFVRKDRRFV 265

Query: 297 KDYS 300
           +   
Sbjct: 266 RKAV 269


>gi|186686614|ref|YP_001869810.1| metallophosphoesterase [Nostoc punctiforme PCC 73102]
 gi|186469066|gb|ACC84867.1| metallophosphoesterase [Nostoc punctiforme PCC 73102]
          Length = 374

 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 99/301 (32%), Gaps = 35/301 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H++   + ++                    S      ++  +   ++D + 
Sbjct: 5   FRFAVVSDLHVALPHTIWDHPS----------RFHLVEVSISAFQSVLEHLTQLDLDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKS-LHAWKDYITSD 128
           + GD+               L  +  P  + +VPGNHD  +  A ++S   A   +  + 
Sbjct: 55  LPGDLTQHGEPENHAWLQQCLAQL--PFPVYVVPGNHDVPVLLADQQSIAFADFPHYYTK 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 ++++   ++   + LIG ++          G    +Q     ++L  +  +   
Sbjct: 113 FGYEDPQQIYYIRQLLPGVKLIGLNSNYFNDEGEQVGCLDAKQLRWLEEVLAASVDE--L 170

Query: 189 RIIMMHHPPV-------LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+HH  V           +    +       +++   G  L+  GH H+  + +   
Sbjct: 171 VLVMVHHNVVEHLPNQSNHPLANRYMLSNSAELLQLLRRYGVKLVFTGHLHVQDIAYSDG 230

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY---WTLEGKRYTLSPDSLSIQKD 298
                  +   S     H       Y +    + N+      +   R    PD   +Q+ 
Sbjct: 231 VYD----ITTGSLVSYPHP------YRVLEFHRDNQGKESLQILSHRVESVPDFPDLQES 280

Query: 299 Y 299
            
Sbjct: 281 S 281


>gi|57640972|ref|YP_183450.1| calcineurin superfamily metallophosphoesterase [Thermococcus
           kodakarensis KOD1]
 gi|57159296|dbj|BAD85226.1| metallophosphoesterase, calcineurin superfamily [Thermococcus
           kodakarensis KOD1]
          Length = 502

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/290 (18%), Positives = 100/290 (34%), Gaps = 52/290 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   +F                           +L++ +I   N D V
Sbjct: 3   MIRIAHISDTHITNEGAFKGY----------------------AFDLIVEEINRGNFDFV 40

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGDI N     E   + + L+ I  P  + ++PGNHD                     
Sbjct: 41  IHTGDITNQGLREEYEQAAYQLKKIQKP--LVVLPGNHDVRNV---------------GY 83

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +    +  +I   +   T P  ++G  G  +     + L + + +  F
Sbjct: 84  KLFEDFIGPLNGVYEFRDGVVIWVDS---TIPDLSDGRIGGHKFRWLKERLEEYSDR-RF 139

Query: 189 RIIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +I+  HH   P+ DT    N +F       ++   G  L   GH H+ +++ ++     +
Sbjct: 140 KIVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLRHGVTLYTCGHKHVPNVYRVE----DL 195

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
            +      S K        SYN+  +        +      ++ D ++ +
Sbjct: 196 IIDNAGCTSCKKTRKGDVNSYNIIELYDDG---RVRVTIRRVTGDEITKE 242



 Score = 78.1 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 52/245 (21%), Positives = 90/245 (36%), Gaps = 29/245 (11%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           RI+ +   + + + YF ++    ++  I      D V   GD+V+    R    +  + +
Sbjct: 260 RIVQMSESNVSDRVYFRRKTLENVVRMINERLRPDLVVHNGDMVDAGIERYYERAYEYYK 319

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
            +  P  I +   N   Y+     +                      P +    +I +I 
Sbjct: 320 -LVKPQKILVPGHNDITYLGHELFQEYF-----------------GEPEVLELGDIVIIP 361

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVL-DTSSLYNRMFG 210
             +A    P    G  GQ+        LR+   +G FRI++MHH  +    S     +  
Sbjct: 362 VLSAQYETPIGVVGRMGQK---KLRNTLREY--EGKFRIVVMHHNVIPVPKSREIGFLED 416

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                K++  EG +L+L GH        I+N     P+V   S S ++H N    S+NL 
Sbjct: 417 AGDVLKVLTDEGTELVLTGHGGNAFGVKIEN----TPIVNAGSVSWELHRNPFGNSFNLV 472

Query: 271 YIEKK 275
            I   
Sbjct: 473 DIYTD 477


>gi|325958717|ref|YP_004290183.1| metallophosphoesterase [Methanobacterium sp. AL-21]
 gi|325330149|gb|ADZ09211.1| metallophosphoesterase [Methanobacterium sp. AL-21]
          Length = 250

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 59/266 (22%), Positives = 98/266 (36%), Gaps = 47/266 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +A ISD+H+                           F + + +  I++I   + D   +T
Sbjct: 4   IAQISDLHVGSL-----------------------NFQENLLDKAIDEINSVDPDVTIVT 40

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GDI       E      +L  I +P  I +VPGNHDA   G +         Y T +   
Sbjct: 41  GDITENGYYLEYERVVPFLDRIKSP--ILVVPGNHDARHVGDECFEDLIKNRYGTLEDKK 98

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
                        + + +IG  ++    P    G  G+ Q       LR A+++  ++II
Sbjct: 99  -------------HGLKVIGLDSS---EPDLDYGRIGRSQQSWMENELRIADEENLYKII 142

Query: 192 MMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            +HH   PV  T    N +       + +    ADL+L GH H+  +  ++        +
Sbjct: 143 ALHHHIIPVPKTGRERNVLSDAGDILQSLMKGKADLVLSGHKHMPHVWMME----DTTFI 198

Query: 250 GIASASQKVHSNKPQASYNLFYIEKK 275
              + S      K  +SYN   IE +
Sbjct: 199 TAGTVSSLRLRGKALSSYNTIDIEDE 224


>gi|254172134|ref|ZP_04878810.1| metallophosphoesterase, calcineurin superfamily [Thermococcus sp.
           AM4]
 gi|214034030|gb|EEB74856.1| metallophosphoesterase, calcineurin superfamily [Thermococcus sp.
           AM4]
          Length = 500

 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/295 (17%), Positives = 96/295 (32%), Gaps = 52/295 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   +F                           +L++ +I   + D V
Sbjct: 1   MIKIAHISDTHITNEGAFKGY----------------------AFDLIVEEINRGDFDFV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGDI N     E   + + L  I  P  + ++PGNHD                     
Sbjct: 39  VHTGDITNQGLREEYEQAAYQLGKIKKP--LVVIPGNHDVRNV---------------GY 81

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +   +N  LI   +   T P  ++G  G  +       L + + K  F
Sbjct: 82  KLFEKFIGPLNGVYEFDNGVLIWVDS---TIPDLSDGRIGGHKFRWLKAKLEEYSSK-KF 137

Query: 189 RIIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +I+  HH   P+ DT    N +F       ++      L   GH H+ +++ ++     +
Sbjct: 138 KIVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLRHEVTLYTCGHKHVPNVYRVE----DL 193

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
            +      S +        SYN+  +        +      ++ D    +     
Sbjct: 194 VIDNAGCTSCRKTRRGDVNSYNIIRLHDDG---RVSVTIRRVTGDEERKEHRPIR 245



 Score = 76.2 bits (185), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 49/269 (18%), Positives = 86/269 (31%), Gaps = 51/269 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDH 67
           +  +  IS                        + + + YF ++V   +I  I      D 
Sbjct: 256 VLRIVQIS----------------------ESNVSDRVYFRRKVFENVIRMINERLKPDL 293

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V   GD+V+    R    +  + R+I     +     +         E+           
Sbjct: 294 VIHNGDVVDAGIERYYERAYEYYRAISTEKLVVPGHNDITYLGHELFEEYF--------- 344

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                      P L   +   +I   +A    P    G  GQ       + L + N +  
Sbjct: 345 ---------GEPQLIEFDGYVIIPVLSAQYETPIGVVGRMGQR---KLERTLEEYNDR-- 390

Query: 188 FRIIMMHHPPVL-DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           FRI++MHH  +    S     +       K++  E  +L+L GH        ++      
Sbjct: 391 FRIVVMHHNVIPIPRSREIGFLEDGGDVLKLLTRERTELVLTGHGGNAYGVKVEG----T 446

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKK 275
           P+V   S S ++H N    S+NL  I + 
Sbjct: 447 PIVNAGSVSWELHRNPFGNSFNLIDIYED 475


>gi|83953123|ref|ZP_00961845.1| possible phospodiesterase [Sulfitobacter sp. NAS-14.1]
 gi|83842091|gb|EAP81259.1| possible phospodiesterase [Sulfitobacter sp. NAS-14.1]
          Length = 268

 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 50/296 (16%), Positives = 97/296 (32%), Gaps = 41/296 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               ++   L++ +   N D V
Sbjct: 1   MSTLVHLSDLHFGK-------------------------DRPDLLEPLLSCVNELNPDIV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +I+GD        +   + ++++ I  P  +  VPGNHD  +    ++    W+ Y    
Sbjct: 36  AISGDFTQRARRSQFEEAHNFIQRINAP--VLGVPGNHDVLLDRPFQRFFMPWRRYRKWI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               T +         +++ +IG ++          G     +     K +     +   
Sbjct: 94  NADLTPR------YEDDDMVVIGINSV--DRFSWQTGKLTAGRIAQACKAIDDTAAR-KA 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++++HHP      +    + G +   + +   GA+LIL GH H         E      
Sbjct: 145 RVLVVHHPLEHPNHTNKKPIPGAEIALEKLLSCGANLILSGHLHTWHAENFTVESGGTTA 204

Query: 249 VG-IASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           +   A  S           +NL  I        +   R + + D    +   +  F
Sbjct: 205 IQLHAGTSLSSRVRGEPNDFNLVKISDD----QVCVDRLSFNEDKRVFETTEARTF 256


>gi|322513805|ref|ZP_08066891.1| 3',5'-cyclic-nucleotide phosphodiesterase [Actinobacillus ureae
           ATCC 25976]
 gi|322120373|gb|EFX92303.1| 3',5'-cyclic-nucleotide phosphodiesterase [Actinobacillus ureae
           ATCC 25976]
          Length = 275

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 41/296 (13%), Positives = 86/296 (29%), Gaps = 47/296 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHV 68
            L  I+D HL                    H       + +    +++ I     N D V
Sbjct: 15  RLLQITDPHL----------------FSAEHEKLLGVNTTDSFQAVLDQIRQTLFNYDLV 58

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD++              ++ +  P  +  + GNHD     +   + H         
Sbjct: 59  LATGDLIQDHNPEAYHRFAEMVKQLAKP--VFWLEGNHDRQPQMSLYLAKHPHIQAEKQI 116

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              S             +  ++  ++ +A  P   +G     Q    +  L +  ++   
Sbjct: 117 LAGS-------------HWQILLLNSQVANAP---SGNLSFGQLAWLNSKLTEYPERYTL 160

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  +  P        + +       +++        ILHGH H       K       
Sbjct: 161 VVLHHNILPTNSAWLDQHCLKNSNALAEVLSRYPNVKAILHGHIHQEVDAEWKG----YR 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           V+   S   +   N  +     F ++   + W  E   +        +++  S+ F
Sbjct: 217 VLATPSTCIQFKPNCDE-----FTLDLLPQGWR-ELSLFADGRIETEVKRLNSNAF 266


>gi|300113829|ref|YP_003760404.1| metallophosphoesterase [Nitrosococcus watsonii C-113]
 gi|299539766|gb|ADJ28083.1| metallophosphoesterase [Nitrosococcus watsonii C-113]
          Length = 296

 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 57/303 (18%), Positives = 95/303 (31%), Gaps = 44/303 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISD+H                            F  E+   L++ I   + D +
Sbjct: 1   MLNLVHISDLHFG------------------------NPFLPEIGEALLHKINSLSPDLL 36

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GDI       E   +  +L  +  P    +VPGNHD  +    E+    +K Y    
Sbjct: 37  VISGDITQRAKPEEFRAAKAYLDRM-PPIPQLVVPGNHDIPLYRIFERLFQPYKLYCRYI 95

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                  +    +  +NN  ++G  +      F+ NG   +EQ    ++    A+ +   
Sbjct: 96  ------SESRNTVLRQNNAVIVGLDSTNPYFAFT-NGRIRREQLDFCAEAFATASPETAR 148

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH----WIKNEKK 244
            ++  HH            M   +R          DLIL GH H   +         E +
Sbjct: 149 IVVTHHHFAPAPDYKGGEIMPKAKRALDFFTGLKVDLILAGHLHRAYIGNSLDVYPGEDR 208

Query: 245 LIPVVGIASASQKVHSNK----PQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
              ++     +      +     + S+N   I K     T+    Y    D         
Sbjct: 209 EHGIIIAQCGTSTSRRGRVREQEKNSFNRIEIMKD----TIRIFHYMYFTDYKDFHPTAQ 264

Query: 301 DIF 303
             F
Sbjct: 265 HEF 267


>gi|21226673|ref|NP_632595.1| transcriptional regulator, Icc-like protein [Methanosarcina mazei
           Go1]
 gi|20904957|gb|AAM30267.1| transcriptional regulator, Icc related protein [Methanosarcina
           mazei Go1]
          Length = 262

 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 53/286 (18%), Positives = 101/286 (35%), Gaps = 55/286 (19%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
            + +  + H+SDIH S                       + Y+  E+A+ ++  I   + 
Sbjct: 13  ESDIIKIVHLSDIHFS-----------------------EAYYMPEIADSMLQIINESSP 49

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D V ITGD+       E   + +++  I   + + IVPGNHD+  +G             
Sbjct: 50  DIVIITGDLTENGFAAEYNGAKNFIDKIECKNKV-IVPGNHDSKNAGYLFFEDIFKARSS 108

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           +                   ++ +IG  ++    P   +G+ G+E               
Sbjct: 109 SGYF---------------GDVTVIGLDSS---QPELDDGHIGRENYGWIESTFST---- 146

Query: 186 GFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           G F++  +HH   P+  T    N +       +++   G +L+L GH H+  +  +    
Sbjct: 147 GSFKVFALHHHLIPIPKTGRGNNVLVDAGDVLELLDRSGVNLVLCGHWHIPWVWRLN--- 203

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYI---EKKNEYWTLEGKRY 286
             + ++   +        K    YNL  +   E +   W L   R 
Sbjct: 204 -DMFIISAGTVCSSKIRGKTSQCYNLIELETPESECTRWHLRITRV 248


>gi|83942073|ref|ZP_00954535.1| possible phospodiesterase [Sulfitobacter sp. EE-36]
 gi|83847893|gb|EAP85768.1| possible phospodiesterase [Sulfitobacter sp. EE-36]
          Length = 268

 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/296 (16%), Positives = 97/296 (32%), Gaps = 41/296 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               ++   L++ +   N D V
Sbjct: 1   MSTLVHLSDLHFGK-------------------------DRPDLLEPLLSCVNELNPDIV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +I+GD        +   + ++++ I  P  +  VPGNHD  +    ++    W+ Y    
Sbjct: 36  AISGDFTQRARRSQFEEAHNFIQRINAP--VLGVPGNHDVLLDRPFQRFFMPWRRYRKWI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               T +         +++ +IG ++          G     +     K +     +   
Sbjct: 94  NADLTPR------YEDDDMVVIGINSV--DRFSWQTGKLTAGRIAHACKAMDDTAAR-KA 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++++HHP      +    + G +   + +   GA+LIL GH H         E      
Sbjct: 145 RVLVVHHPLEHPNHTKKKPIPGAEIALEKLLSCGANLILSGHLHTWHAENFTVESGGTTA 204

Query: 249 VG-IASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           +   A  S           +NL  I        +   R + + D    +   +  F
Sbjct: 205 IQLHAGTSLSSRVRGEPNDFNLVKISDD----QVCVDRLSFNEDKRVFETTEARTF 256


>gi|268316953|ref|YP_003290672.1| metallophosphoesterase [Rhodothermus marinus DSM 4252]
 gi|262334487|gb|ACY48284.1| metallophosphoesterase [Rhodothermus marinus DSM 4252]
          Length = 273

 Score =  120 bits (299), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 50/288 (17%), Positives = 96/288 (33%), Gaps = 41/288 (14%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           + H+SD+H     S                          V   L+ ++     D V ++
Sbjct: 3   IVHLSDLHFGRLASG------------------------AVVEDLLVEVRRQRPDLVVVS 38

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+      R+   +  +L ++  P    +VPGNHD Y        L           T 
Sbjct: 39  GDLTQRARPRQFRAARAFLEAL--PAPTLVVPGNHDVYPWWRPLSRLVRPLARYRRYLTD 96

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
                      + + +A++G +TA         G    E                   ++
Sbjct: 97  DLRPA-----FVHDAVAVLGLNTAHGATV--KGGRLSAEDLAYLQTFFATVPPSAVRVLV 149

Query: 192 MMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI----KNEKKLIP 247
           + HH   L     ++   G +R  ++I   G + IL GH H+  +  +       + +I 
Sbjct: 150 IHHHLVQLQAVGPHDVARGARRALEVIARAGIEFILCGHLHVAHVEPVVVQPDGHRVVIV 209

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
             G A++S+    ++ +  YN+  IE       ++ +     P   + 
Sbjct: 210 SAGTATSSRGRGPHRNRNFYNVLRIEAD----AVQVEERCYEPARRAF 253


>gi|108802988|ref|YP_642925.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
 gi|108764231|gb|ABG03113.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
          Length = 311

 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 56/310 (18%), Positives = 99/310 (31%), Gaps = 45/310 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD+H      +                        E    L   +       V
Sbjct: 1   MTRIVHISDLHFGKPAVY------------------------ERLEALRALLSGMRPAAV 36

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEK------SLHAWK 122
           +++GD+     NRE   ++ +LR +       +VPGNHD    GA  +            
Sbjct: 37  AVSGDLTQRCANREFEQASSYLRELERTAPCIVVPGNHDIRWLGAVARNLGLAGLFRRKA 96

Query: 123 DYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSAN---------GYFGQEQAH 173
                        +            + G +TA      S           G+  ++   
Sbjct: 97  HEFKYSRYRRHICEELNPFLEVPGAVIAGLNTAHGISRGSLTRRLRDLGVIGHVRRQDVE 156

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
              +   +A   G  RI+M+HH P+    S  + +       + +   G +LIL GH H 
Sbjct: 157 RVRRRFEQAPP-GAARIVMIHHNPIKGQLSGRHGLSNTGWALETLAALGTELILCGHDHQ 215

Query: 234 NSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
            ++H  +     + V+  A            +S+NL  I ++    +L    YT +  + 
Sbjct: 216 EAIHATERTSPGL-VISTAGTISNRVRPGRSSSFNLVDIGEE----SLRIVTYTWNNTAK 270

Query: 294 SIQKDYSDIF 303
                   +F
Sbjct: 271 DFLPSTERLF 280


>gi|51244721|ref|YP_064605.1| hypothetical protein DP0869 [Desulfotalea psychrophila LSv54]
 gi|50875758|emb|CAG35598.1| hypothetical protein DP0869 [Desulfotalea psychrophila LSv54]
          Length = 1076

 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 59/315 (18%), Positives = 105/315 (33%), Gaps = 44/315 (13%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + H+SD+    +  FF+ +        +    R +         ++        D + 
Sbjct: 7   LTILHLSDLQFGKNHRFFQSNISEENFNFSTLQARLQTDL-----KIVKSKYDLEPDLIV 61

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGN-----PHDISIVPGNHDA---------------- 108
           ITGD+V +    E   +  +   + +       ++ IVPGNHD                 
Sbjct: 62  ITGDLVEYGQQSEFDQAKVFFNELASFLNVHISNVLIVPGNHDINRKACEAYFAECEADE 121

Query: 109 ----YISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNN--IALIGCSTAIATPPFS 162
                    K +    + +   SD +     +            +A+   ++ +      
Sbjct: 122 KKPTLPYKPKWRHFKNFYNSFYSDISRKFDLETPFGCTEYPELKVAVANLNSTVQESHQE 181

Query: 163 --ANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH 220
               G  G+ QA   ++ L K   +G+F I  +HH  V       + +   +  Q++I  
Sbjct: 182 KDHYGLIGENQAQKIAEQLAKRKDEGWFNIAAVHHNVVRGAIEDDDNLRDSEMLQRVIGD 241

Query: 221 EGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQ--KVHSNKPQASYNLFYIEKKNEY 278
              DLILHGHTH   +HW       +PV+G  SAS       ++    Y L         
Sbjct: 242 H-IDLILHGHTHRGKMHWW---SPQLPVIGTGSASVEKSARPDEVPNQYQLLKFTGLGFT 297

Query: 279 WTLEGKRYTLSPDSL 293
                     +PD  
Sbjct: 298 RYC----RAFAPDEA 308


>gi|197119224|ref|YP_002139651.1| metallophosphoesterase [Geobacter bemidjiensis Bem]
 gi|197088584|gb|ACH39855.1| metallophosphoesterase [Geobacter bemidjiensis Bem]
          Length = 266

 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 49/290 (16%), Positives = 96/290 (33%), Gaps = 39/290 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD H                                VA  L+      + D +
Sbjct: 1   MSAILHISDTHFGTEI-------------------------PAVAEALLQLAGDLHPDLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+       +   +  +L  +  PH + ++PGNHD  +     +    + ++  S 
Sbjct: 36  VLSGDVTQRARGWQFKAAVDFLERMPVPH-LLVIPGNHDLPLFNILGRVFSPYGNFQRSF 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +     + ++G +T   +     +G     Q    S+ L+  + +   
Sbjct: 95  GRNLEP------VFESQELLVVGANTTRPS--RHKHGEVSPRQIETVSRRLQAGSPRQLR 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH---WIKNEKKL 245
            ++          S + N +   Q         GADLIL GH HL  +     +    + 
Sbjct: 147 VVVAHQPVRATRQSDVKNLLRNHQSAIHAWAEAGADLILGGHVHLPHVRLLKEVHGIPRA 206

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           +  V   +A  +        S NL    K++E  +   +R+    D+  +
Sbjct: 207 VWSVLAGTAVSRRVRGDIPNSVNLIRYRKEDEPRSCLVERWDY--DARGV 254


>gi|149185235|ref|ZP_01863552.1| hypothetical protein ED21_19317 [Erythrobacter sp. SD-21]
 gi|148831346|gb|EDL49780.1| hypothetical protein ED21_19317 [Erythrobacter sp. SD-21]
          Length = 286

 Score =  119 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 46/283 (16%), Positives = 95/283 (33%), Gaps = 39/283 (13%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + H+SDIH                             +    + +  +I     D V+I
Sbjct: 7   RIFHLSDIHFGLE-------------------------NNRALDWVKQEISEKRPDAVAI 41

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+     +RE   +THW+ S+  P  +++  GNHD       E+    +K +   +  
Sbjct: 42  TGDLTMRARHREFEAATHWINSLEAP--VTVEVGNHDMPYFNPIERFFAPYKRFRGMEEK 99

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKGFF 188
                           +A++   TA+   P    + G+   +        +  A  +G  
Sbjct: 100 VEKE-------IDLGCLAIVPLKTAVRAQPRLNWSKGWVTDDALAKCLAAI-DALPEGTR 151

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
            ++ +HHP     +          +    +     + +L GH H         E+  + +
Sbjct: 152 AVVAVHHPLREVGTQGTALTKNGDKALLALAKRPVEAVLSGHVHDAFDIMESTEEGPVRM 211

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
           +G  + S++  S     S+N    +      ++    +  + D
Sbjct: 212 IGAGTLSKRTRST--PPSFNEIEWDGATLSVSVRNLEHVETRD 252


>gi|254423681|ref|ZP_05037399.1| Ser/Thr protein phosphatase family protein [Synechococcus sp. PCC
           7335]
 gi|196191170|gb|EDX86134.1| Ser/Thr protein phosphatase family protein [Synechococcus sp. PCC
           7335]
          Length = 376

 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 47/308 (15%), Positives = 96/308 (31%), Gaps = 44/308 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H++   + ++                    S      +++ ++    D + 
Sbjct: 5   FKFAVVSDLHIALPHTIWDAPN----------RFHLVEVSIPAFEQILDQLVADRPDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAY--------ISGAKEKSLHAW 121
           + GD+V            + L  +  P  + +VPGNHD           +    +     
Sbjct: 55  LPGDLVQHGERDNHQWLANRLAQL--PFPVYVVPGNHDVPRKERTLANNNQTISRVALTD 112

Query: 122 KDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA--NGYFGQEQAHATSKLL 179
              I      +  K+L+    I   + LIG ++            G+  +EQ       L
Sbjct: 113 FPQIYRQFGYTDSKQLYYQQEILPGVHLIGLNSNTFDESGEQIGTGFIDEEQFSWLDAQL 172

Query: 180 RKANKKGFFRIIMMHHPPVLDTSS-------LYNRMFGIQRFQKMIWHEGADLILHGHTH 232
           +K    G F ++M+HH  +    +           +    +    +      L   GH H
Sbjct: 173 KKLA--GKFVMVMVHHNVLEHLPNQAKSKLGQRYMIKNAPKLVSRLQAAKVPLAFTGHLH 230

Query: 233 LNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT---LEGKRYTLS 289
           +  +     +      +   S     H       Y L  +    +      +E +R    
Sbjct: 231 VQDIA----KSGNFYAITTGSLVSYPHP------YRLMSVSTNAQGLRQVNIETRRVESL 280

Query: 290 PDSLSIQK 297
            D  ++Q+
Sbjct: 281 ADWPTLQQ 288


>gi|17232830|ref|NP_489378.1| 3',5'-cyclic-nucleotide phosphodiesterase [Nostoc sp. PCC 7120]
 gi|17134477|dbj|BAB77037.1| 3',5'-cyclic-nucleotide phosphodiesterase [Nostoc sp. PCC 7120]
          Length = 266

 Score =  118 bits (296), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 53/305 (17%), Positives = 95/305 (31%), Gaps = 56/305 (18%)

Query: 5   YTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
              +   +A I+DIHL                L +     +   + E    ++  +    
Sbjct: 2   NEKLPISIAQITDIHL----------------LASESQRLQGISTTESFLAVMKRLEELR 45

Query: 65  V--DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWK 122
              D + +TGD+ +           H+L S+        +PGNHD  I+  K  +L    
Sbjct: 46  PELDLLLMTGDLSDDGTPESYENLQHYLNSLQ--IATYWLPGNHDCAIAMDKILNLGMVS 103

Query: 123 DYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
                                R N   I  ++++    +   GY            L+  
Sbjct: 104 RRK---------------SFQRGNWNFILLNSSVTDCVY---GYLSATTLDWLDSELKML 145

Query: 183 NKKGFFRIIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWI 239
                  +I +HHPP+   S+    + +   Q    +I       L+L GH H       
Sbjct: 146 PNNPT--LIALHHPPLSVNSAWIDRSCLQNSQELFAVIDRYPQVKLVLFGHIHQEFRRQR 203

Query: 240 KNEKKLIPVVGIASASQKVHS-------NKPQASYNLFYIEKKNEYWTLEGKRYTLS-PD 291
            N    +  +G  S   +  S       N+    + L  +      WT + +R   S P 
Sbjct: 204 HN----VHYLGSPSTCYQFQSQSTTFAINQELPGFRLLKLYADG-TWTTKIERVPYSLPI 258

Query: 292 SLSIQ 296
             ++ 
Sbjct: 259 EPTVT 263


>gi|161528886|ref|YP_001582712.1| metallophosphoesterase [Nitrosopumilus maritimus SCM1]
 gi|160340187|gb|ABX13274.1| metallophosphoesterase [Nitrosopumilus maritimus SCM1]
          Length = 252

 Score =  118 bits (296), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 54/296 (18%), Positives = 93/296 (31%), Gaps = 49/296 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +  ISD+H+                           F +E  ++L++++   N D + IT
Sbjct: 3   IVQISDLHIGSQ------------------------FLEEKFDVLVSEVNELNPDVIVIT 38

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+ N    +E       L        I  + GNHD                    +T  
Sbjct: 39  GDLTNEGLMKEYEKCKSLLEKFNTK-KIIAISGNHDYR------------------NTGY 79

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
              KK FP+  +      +   T     P    G  G  Q     + ++K   K     +
Sbjct: 80  LLFKKFFPFQTVNELDNDVVLVTVGTARPDRNEGEVGYRQNLWLERTMKKYKDKIKIVAM 139

Query: 192 MMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGI 251
             H   + DT S    +       + +     D++L GH H             + VV  
Sbjct: 140 HHHLIAIPDTGSDQLTVVDAGDVLRTVLDSEVDVVLCGHKHRPWAWNF----GTLTVVNA 195

Query: 252 ASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDTL 307
            +A+ +      + +YN+  I+ K     L+       P    +       F+D L
Sbjct: 196 GTATSERVRGLFENTYNILTIKDKQVNVDLKIVGGKRVPIDEIV--KNYSQFHDEL 249


>gi|325568144|ref|ZP_08144585.1| hypothetical protein HMPREF9087_0874 [Enterococcus casseliflavus
           ATCC 12755]
 gi|325158345|gb|EGC70496.1| hypothetical protein HMPREF9087_0874 [Enterococcus casseliflavus
           ATCC 12755]
          Length = 270

 Score =  118 bits (296), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 49/273 (17%), Positives = 85/273 (31%), Gaps = 35/273 (12%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-VDHVSI 70
           + HISDIH   S    E   + ++  +                  I D      +D V I
Sbjct: 3   ILHISDIHFRESYLPCEEGYQGMLAAMQ--------NPLIPLEECIQDAKARGAIDLVVI 54

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+       +  +   +L        I +  GNHD             ++      + 
Sbjct: 55  SGDLTEDGAPADYASLKQYLEKAFGSVPIVVTLGNHD---------IKRHFRQGWQGKSV 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            +     F  +     +A++    +       A+G   + Q       L +  +K   +I
Sbjct: 106 ETASDTPFNQVYETETLAIVTFDNSCYG---YADGIVDERQFEWLQATLAQLKEK---KI 159

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           + + H  +L   +      G  R   ++       IL GHTH      I      IP   
Sbjct: 160 VFVTHHHLLPYQASTPAWAGANRLVALLQQYQISCILSGHTHHAFTGTIAG----IPYYT 215

Query: 251 IASASQKVHSNK-------PQASYNLFYIEKKN 276
           +AS S               +  YNL+  E+  
Sbjct: 216 VASMSFVGEDEGEGMVRFEERYGYNLYRFEEGA 248


>gi|146281671|ref|YP_001171824.1| DNA repair exonuclease [Pseudomonas stutzeri A1501]
 gi|145569876|gb|ABP78982.1| probable DNA repair exonuclease [Pseudomonas stutzeri A1501]
          Length = 373

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/290 (15%), Positives = 88/290 (30%), Gaps = 40/290 (13%)

Query: 7   TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
             M  +  ISD H                                V   L + +  H  D
Sbjct: 105 KPMTSIVQISDTHFGTE-------------------------QPAVVQALEDHVREHRAD 139

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNP--HDISIVPGNHDAYISGAKEKSLHAWKDY 124
            +  +GDI       +  ++  ++R +      D  ++PGNHD  +     +    + +Y
Sbjct: 140 LLVFSGDITQRARRGQFASAAAFVRRLEADGVGDTLVIPGNHDIPLYNVFARLFTPYGNY 199

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
                           +     + +IG +T         +G     Q    ++ L +++ 
Sbjct: 200 RQHFGDDLEP------VFENEQMLVIGLNTTHP--RRHKDGVVTARQVERVARRLGESDP 251

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL----HWIK 240
                ++       +  S L N   G +   +     G DL++ GH HL  +        
Sbjct: 252 GKIRIVVAHQPFGAMVPSDLSNLQHGAEPALQRWAEHGLDLVMGGHIHLPYVLPLSRQYP 311

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSP 290
              + I +V   +            S+N   +    +   +  +R+ LS 
Sbjct: 312 GLAREIWMVQAGTTLSTRLRGTSPNSFNRLKLHP-GDEKKVCVERWDLSA 360


>gi|254361381|ref|ZP_04977522.1| possible phosphohydrolase [Mannheimia haemolytica PHL213]
 gi|261494169|ref|ZP_05990671.1| putative phosphohydrolase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|153092887|gb|EDN73918.1| possible phosphohydrolase [Mannheimia haemolytica PHL213]
 gi|261310150|gb|EEY11351.1| putative phosphohydrolase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 280

 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/299 (14%), Positives = 88/299 (29%), Gaps = 48/299 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN---V 65
           +  L  I+D HL  +P    L+ K +                   + +I  I        
Sbjct: 17  VIKLLQITDPHLFSNPEETLLNVKTVKS----------------FSAVIEQINKQAKQYF 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D V  TGD++                S+ +P  I  + GNHD              +  +
Sbjct: 61  DLVLATGDLIQDNNIAGYHYFAQITNSLNSP--IVWLEGNHDV-------------QPSM 105

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           +              + +     L+  +T +   P+   G     Q     + L +  ++
Sbjct: 106 SEILAQYKHILPHKQILLGEQWQLLMLNTQVVGMPY---GELSYSQLKWLEEKLAQYPQR 162

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKK 244
                +  +  P        + +       ++         I+HGH H            
Sbjct: 163 FTLVALHHNILPTNSAWLDQHSLKNSNELSEIFAKFKNVKAIVHGHIHQQVDDIWHG--- 219

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            IP+    S   +   N  Q     F ++ + + W  E + +        +++  S+ F
Sbjct: 220 -IPIYATPSTCIQFKPNCDQ-----FTLDLQPQGWR-EIELHENGTIETVVKRLNSNDF 271


>gi|240102780|ref|YP_002959089.1| Metallophosphoesterase, Calcineurin-like phosphoesterase family
           [Thermococcus gammatolerans EJ3]
 gi|239910334|gb|ACS33225.1| Metallophosphoesterase, Calcineurin-like phosphoesterase family
           [Thermococcus gammatolerans EJ3]
          Length = 503

 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 49/296 (16%), Positives = 92/296 (31%), Gaps = 52/296 (17%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
            M  +AHISD H++   +F                           +L++ +I   + D 
Sbjct: 3   AMIKIAHISDTHITNEGAFKGY----------------------AFDLIVEEINRGDFDF 40

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V  TGDI N     E   +    +       + ++PGNHD                    
Sbjct: 41  VVHTGDITNQGLREEYEQAA--YQLGKIRKPLVVIPGNHDVRNV---------------G 83

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                        +   +N  LI   +   T P  ++G  G  +       L + + +  
Sbjct: 84  YKLFEKFIGPLNGVYEFDNGVLIWVDS---TIPDLSDGRIGGHKFRWLKAKLEEYSDR-R 139

Query: 188 FRIIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           F+I+  HH   P+ DT    N +F       ++      L   GH H+ +++ ++     
Sbjct: 140 FKIVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLRHEVTLYTCGHKHVPNVYRVE----D 195

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
           + +      S +        SYN+  +        +      ++ D          
Sbjct: 196 LVIDNAGCTSCRKTRRGDVNSYNIIKLHDDG---RVSVTIRRVTGDEERKDHKPIR 248



 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 49/245 (20%), Positives = 86/245 (35%), Gaps = 29/245 (11%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           RI+ L   + + + YF ++V   +I  I      D V   GD+V+    R    +  + R
Sbjct: 261 RIVQLSESNVSDRVYFRRKVFENVIRMINERLKPDLVIHNGDVVDAGIERYYERAYEYYR 320

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
           +I     +     +         E+                      P +   +   +I 
Sbjct: 321 AISAEKLVVPGHNDITYLGHELFEEYF------------------GEPEVIEFDGYVIIP 362

Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVL-DTSSLYNRMFG 210
             +A    P    G  GQ+      K+L +      FRI++MHH  +    S     +  
Sbjct: 363 VLSAQYETPIGVVGRMGQK---KLEKVLEEY--DDRFRIVVMHHNVIPIPRSREIGFLED 417

Query: 211 IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLF 270
                K++  EG +L+L GH        ++      P+V   S S ++H N    S+NL 
Sbjct: 418 GGDVLKLLTREGTELVLTGHGGNAYGVKVE----RTPIVNAGSVSWELHRNPFGNSFNLI 473

Query: 271 YIEKK 275
            +   
Sbjct: 474 DVYTD 478


>gi|152981968|ref|YP_001353567.1| DNA repair exonuclease [Janthinobacterium sp. Marseille]
 gi|151282045|gb|ABR90455.1| DNA repair exonuclease [Janthinobacterium sp. Marseille]
          Length = 281

 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/304 (15%), Positives = 87/304 (28%), Gaps = 38/304 (12%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD H                                V   L      H  + +
Sbjct: 1   MKTVLHISDPHFGTE-------------------------RAPVVKALERLAHAHAPNLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       E   +  ++  +  P  I ++ GNHD  +     +    +  Y  S 
Sbjct: 36  ILSGDITQRARAVEFKLARAFVERLAIPSHI-VIAGNHDIPLFDVMTRIFLPYTRYCRSF 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                     P         L+  +           G     Q    ++ L++A  K   
Sbjct: 95  GPELEPVHDSP--------DLLVLAVRTTRRYRHIEGEVSDVQIERVAQGLKQAGDKQLR 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE----KK 244
            ++      V       + + G QR        GADLIL GH H      +  E     +
Sbjct: 147 IVVTHQPVFVTHEVDEEHLLRGHQRAIGRWAEAGADLILGGHIHRPFTCALHEELADLPR 206

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
            +  V   +A      +    S N       +       +R+  + ++       S   +
Sbjct: 207 RVWAVQAGTAVSSRIRHDSNNSVNFIRYGCADAPLRCIVERWDYNDEADEFLLKDSIDMH 266

Query: 305 DTLV 308
            +++
Sbjct: 267 RSIL 270


>gi|304314070|ref|YP_003849217.1| phosphohydrolase [Methanothermobacter marburgensis str. Marburg]
 gi|302587529|gb|ADL57904.1| predicted phosphohydrolase [Methanothermobacter marburgensis str.
           Marburg]
          Length = 265

 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/266 (18%), Positives = 95/266 (35%), Gaps = 46/266 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +A ISDIH                         +K FS ++   L+  +   N D + +
Sbjct: 4   KIAQISDIHFG-----------------------EKNFSSKLRENLLGQLQDENPDLIVV 40

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+       E   +  +   + +     I+PGNHDA   G         K        
Sbjct: 41  SGDLTTEGYAHEYELAAEFADELRSITATYIIPGNHDARNVGLVHFEKMIGKRKF----- 95

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                     +   +  A+IG  ++    P   +G  G +Q    ++ L +        +
Sbjct: 96  ----------VHHDSEFAVIGLDSS---EPDINDGQIGMDQLEWLARELERVPDHLCKIV 142

Query: 191 IMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
              HH  P+ +T    N +       +++   G D +L+GH H+ ++  I+     +  +
Sbjct: 143 TFHHHLLPIPNTGRERNILLDSGDLLRLLNSYGVDFVLNGHKHVPNVWMIEG----MVTL 198

Query: 250 GIASASQKVHSNKPQASYNLFYIEKK 275
              +A+ +    +   S+N   I++ 
Sbjct: 199 NSGTATTRKLRGETFPSHNQLRIDED 224


>gi|329766400|ref|ZP_08257946.1| metallophosphoesterase [Candidatus Nitrosoarchaeum limnia SFB1]
 gi|329137169|gb|EGG41459.1| metallophosphoesterase [Candidatus Nitrosoarchaeum limnia SFB1]
          Length = 248

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 50/265 (18%), Positives = 84/265 (31%), Gaps = 48/265 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +  ISD+H+                           F ++  + L++++   N + +
Sbjct: 1   ML-IVQISDLHVGSQ------------------------FLQDKFDQLVDEVNQLNPNVI 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ N     E       L    +   I  + GNHD                    +
Sbjct: 36  VVTGDLTNEGLMHEYERCRELLTKFKSK-KIITISGNHDYR------------------N 76

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           T     KK FP+  I      +   T     P    G  G  Q     + ++K   K   
Sbjct: 77  TGYLLFKKFFPFEAINELSDDVVLVTLGTARPDRNEGEVGYRQNLWLERTMKKYKDKVKI 136

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
             +  H   + DT S    +       + I   G DL+L GH H             + V
Sbjct: 137 LAMHHHLIAIPDTGSDQLTVVDAGDVLRTILDTGVDLVLCGHKHRPWEWNF----GKLMV 192

Query: 249 VGIASASQKVHSNKPQASYNLFYIE 273
           V   +A+ +      + +YN+  I 
Sbjct: 193 VNAGTATSERVRGLFENTYNIITIS 217


>gi|312136711|ref|YP_004004048.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
 gi|311224430|gb|ADP77286.1| metallophosphoesterase [Methanothermus fervidus DSM 2088]
          Length = 273

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 55/273 (20%), Positives = 97/273 (35%), Gaps = 46/273 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + H+SDIH        EL      G                       I   N D + +
Sbjct: 17  TIIHLSDIHFGDKTFSSELKRNLTSG-----------------------IENINPDIIVV 53

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
            GD+       E   ++ ++  + +  D  +VPGNHDA   G                  
Sbjct: 54  AGDVTTNGYKYEYELASEFIEELNDIADTYVVPGNHDARNVGLVH-------------FE 100

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G + F ++      A+IG  ++    P   +G  G +Q       L++    GF +I
Sbjct: 101 KLIGHRKFLHIDKSGEFAIIGLDSS---QPDIDDGQIGIDQMEWAHDKLKRIPN-GFIKI 156

Query: 191 IMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           +  HH   P+  T    N +       K++   G D +L+GH H+ ++  I+     +  
Sbjct: 157 VTFHHHLLPIPQTGRERNILLDCGDVLKLLIDCGVDFVLNGHKHVPNVWMIE----KMAT 212

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
           +   +A+ +    +   SYN   I  +  +  L
Sbjct: 213 INSGTATTRRLRGESFPSYNELTITDEKIHVNL 245


>gi|288923746|ref|ZP_06417841.1| metallophosphoesterase [Frankia sp. EUN1f]
 gi|288344906|gb|EFC79340.1| metallophosphoesterase [Frankia sp. EUN1f]
          Length = 290

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 82/301 (27%), Gaps = 47/301 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHV 68
            +  ISD H+    S                    K  +       +  +      VD +
Sbjct: 13  TVIQISDTHIVPEGSLM----------------MGKVDTHANLVAALEQVEKSGVQVDAL 56

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            +TGD+ +             +  +       +  V GNHD+     +            
Sbjct: 57  LLTGDLADKGELDAYRRLRDTVEPVAERIGAPVLYVMGNHDSRGPFRE-----------G 105

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                 +      Y+    ++ +I   +   T P    G     Q    +  L  A   G
Sbjct: 106 LLGAEPSADTPHDYVHWVGDLRIIVLDS---TEPDEHAGLLSDAQLRWLADELATAAPAG 162

Query: 187 FFRIIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
              ++ +HHPPV     +     +        ++      +++ GH H  S         
Sbjct: 163 T--VLALHHPPVPSPVEMLNGMILSQSAELADVLRGSDVKIVVCGHAHHAS----AGSIG 216

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
            +PV    + +    +  P   +           +      + L   + S+  D     Y
Sbjct: 217 GVPVWVAGATAYSARTLGPADQFAGLT-----GGFYTRLDVFPLGAVATSVPVDPGAAVY 271

Query: 305 D 305
           +
Sbjct: 272 E 272


>gi|269302686|gb|ACZ32786.1| Ser/Thr protein phosphatase family protein [Chlamydophila
           pneumoniae LPCoLN]
          Length = 295

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/284 (18%), Positives = 106/284 (37%), Gaps = 15/284 (5%)

Query: 11  VLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            + HISD+H    P +      KR+ GL+   F    + +  +       +     D V 
Sbjct: 10  RIIHISDVHFHVLPVNPVHCFNKRLKGLLRKVFGLVHFQATTIGQRFPKVVRSLGADSVC 69

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD      + E   + H++ ++     + ++PGNHD Y   +      A + + T   
Sbjct: 70  ITGDFSLTAMDGEFLLAKHFVETLAKHSSVYLLPGNHDVYTPKSL-----AQQTFYTHFP 124

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                +    + +I ++  LI    +     FSANG     Q  A    L   + +    
Sbjct: 125 NDQLQQNKVSFHKITDHWWLILLDCSCLNGWFSANGVVHLAQISAIETFLLSLSPEE--N 182

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPV 248
           +I+ +H P+L + +  + +      Q ++       L LHGH H  +++   +      +
Sbjct: 183 VIIANHYPLLSSQNPSHDLINNTHLQNVLKKYPKVRLYLHGHEHQAAVYNCADTS-PSYI 241

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
           +   S S         + +++  +  +         +  L  D+
Sbjct: 242 LNSGSISL-----PTNSRFHVIDLYPEKYQVHTMILKNLLDFDA 280


>gi|298490696|ref|YP_003720873.1| metallophosphoesterase ['Nostoc azollae' 0708]
 gi|298232614|gb|ADI63750.1| metallophosphoesterase ['Nostoc azollae' 0708]
          Length = 369

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/299 (15%), Positives = 86/299 (28%), Gaps = 31/299 (10%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H+    + +E                    S      ++  +   ++D + 
Sbjct: 5   FRFAIVSDLHIGLPHTIWEHPS----------RFHLVEVSIPAFESVLEHLTQLDLDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKS-LHAWKDYITSD 128
           I GD+               L  +  P  + +VPGNHD  +  A E+S       +    
Sbjct: 55  IPGDLTQHGEPENHAWLQTRLSQL--PFPVYVVPGNHDVPVLIANEQSIAFGDFPHYYRQ 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                  + +   +I   + LIG ++          G     Q       L     +   
Sbjct: 113 FGYKNPDQCYYNHQILPGVRLIGLNSNSYDQKGKQIGRLDGNQFRWLEAELAAVTDELVL 172

Query: 189 RIIMMH---HPP--VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            II  +   H P       +    +        ++   G  L+  GH H+  +       
Sbjct: 173 VIIHHNIVEHLPNQSDHPMASRYMLGNALELLDLLCKYGVRLVFTGHLHVQDVACADGVY 232

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY---WTLEGKRYTLSPDSLSIQKDY 299
                +   S     H       Y +   ++ +       +   R    PD   +Q+  
Sbjct: 233 D----ITTGSLVSYPHP------YRVLEFQRDHIGREWLQIVSHRVESVPDFPDLQQSS 281


>gi|240950105|ref|ZP_04754400.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Actinobacillus minor NM305]
 gi|240295406|gb|EER46175.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Actinobacillus minor NM305]
          Length = 275

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 47/296 (15%), Positives = 94/296 (31%), Gaps = 47/296 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH--V 68
            L  I+D HL   PS   L                   + +    ++ ++   NV+   +
Sbjct: 15  RLLQITDPHLFSEPSTCLLG----------------VNTHQSLQAVLAEVQKTNVNFHAI 58

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD++     +        +     P  +  V GNHD     +   S      YI  +
Sbjct: 59  LATGDLIQDHQIQGYHHFARMIEPFKKP--VFWVEGNHDEQPQMSLCLS---EYPYIQPE 113

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G              ++  ++ +A  P   +GY  + Q     K L + + +   
Sbjct: 114 KQIFAGNY----------WQILMLNSQVAGAP---SGYLSRGQLAWLEKSLSENSDRFSL 160

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  +  P        + +    +  K++        ILHGH H       +N    I 
Sbjct: 161 IVLHHNILPTHSAWLDQHSLKNADKLAKILARFPKVKAILHGHIHQEVNAIWQN----IQ 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           ++   S   +   N  +     F ++   + W  E   +        +++  S+ F
Sbjct: 217 ILATPSTCIQFKPNCDE-----FTLDILPQGWR-EISLFEDGRIETEVKRLKSNDF 266


>gi|15618806|ref|NP_225092.1| phosphohydrolase [Chlamydophila pneumoniae CWL029]
 gi|15836430|ref|NP_300954.1| phosphohydrolase [Chlamydophila pneumoniae J138]
 gi|16752139|ref|NP_445506.1| hypothetical protein CP0969 [Chlamydophila pneumoniae AR39]
 gi|33242259|ref|NP_877200.1| 3,5'-cyclic-nucleotide phosphodiesterase [Chlamydophila pneumoniae
           TW-183]
 gi|4377217|gb|AAD19035.1| predicted phosphohydrolase [Chlamydophila pneumoniae CWL029]
 gi|7189882|gb|AAF38749.1| conserved hypothetical protein [Chlamydophila pneumoniae AR39]
 gi|8979271|dbj|BAA99105.1| phosphohydrolase [Chlamydophila pneumoniae J138]
 gi|33236770|gb|AAP98857.1| 3,5'-cyclic-nucleotide phosphodiesterase [Chlamydophila pneumoniae
           TW-183]
          Length = 295

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/284 (18%), Positives = 106/284 (37%), Gaps = 15/284 (5%)

Query: 11  VLAHISDIHLSYSP-SFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
            + HISD+H    P +      KR+ GL+   F    + +  +       +     D V 
Sbjct: 10  RIIHISDVHFHVLPVNPVHCFNKRLKGLLRKVFGLVHFQATTIGQRFPKVVRSLGADSVC 69

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD      + E   + H++ ++     + ++PGNHD Y   +      A + + T   
Sbjct: 70  ITGDFSLTAMDGEFLLAKHFVETLAKHSSVYLLPGNHDVYTLKSL-----AQQTFYTHFP 124

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                +    + +I ++  LI    +     FSANG     Q  A    L   + +    
Sbjct: 125 NDQLQQNKVSFHKITDHWWLILLDCSCLNGWFSANGVVHLAQISAIETFLLSLSPEE--N 182

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPV 248
           +I+ +H P+L + +  + +      Q ++       L LHGH H  +++   +      +
Sbjct: 183 VIIANHYPLLSSQNPSHDLINNTHLQNVLKKYPKVRLYLHGHEHQAAVYNCADTS-PSYI 241

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
           +   S S         + +++  +  +         +  L  D+
Sbjct: 242 LNSGSISL-----PTNSRFHVIDLYPEKYQVHTMILKNLLDFDA 280


>gi|261495566|ref|ZP_05992012.1| putative phosphohydrolase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261308673|gb|EEY09930.1| putative phosphohydrolase [Mannheimia haemolytica serotype A2 str.
           OVINE]
          Length = 280

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/299 (14%), Positives = 88/299 (29%), Gaps = 48/299 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN---V 65
           +  L  I+D HL  +P    L+ K +                   + +I  I        
Sbjct: 17  VIKLLQITDPHLFSNPEETLLNVKTVKS----------------FSAVIEQINKQAKQYF 60

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D V  TGD++                S+ +P  I  + GNHD              +  +
Sbjct: 61  DLVLATGDLIQDHNIAGYHYFAQITNSLNSP--IVWLEGNHDV-------------QPSM 105

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           +              + +     L+  +T +   P+   G     Q     + L +  ++
Sbjct: 106 SEILAQYKHILPHKQILLGEQWQLLMLNTQVVGMPY---GELSYSQLKWLEEKLAQYPQR 162

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKK 244
                +  +  P        + +       ++         I+HGH H            
Sbjct: 163 FTLVALHHNILPTNSAWLDQHSLKNSNELSEIFAKFKNVKAIVHGHIHQQVDDIWHG--- 219

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            IP+    S   +   N  Q     F ++ + + W  E + +        +++  S+ F
Sbjct: 220 -IPIYATPSTCIQFKPNCDQ-----FTLDLQPQGWR-EIELHENGTIETVVKRLNSNDF 271


>gi|242398150|ref|YP_002993574.1| Predicted phosphohydrolase [Thermococcus sibiricus MM 739]
 gi|242264543|gb|ACS89225.1| Predicted phosphohydrolase [Thermococcus sibiricus MM 739]
          Length = 504

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 59/297 (19%), Positives = 110/297 (37%), Gaps = 50/297 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   ++   +                       +L+ N+I   + + V
Sbjct: 1   MIKIAHISDTHITSGEAYKGYAY----------------------DLIANEINTLDYNLV 38

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ N     E   +++ L+ I  P  + ++PGNHD         + +   +     
Sbjct: 39  IHTGDVTNDGLREEYERASYELKKIQKP--LIVLPGNHD---------ARNVGYELFQKY 87

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G      +    ++ +I   +   T P   +G  G  +     + L + + K  F
Sbjct: 88  IGPLNG------IYEWKDLVIIWTDS---TIPDLNDGRIGGYKFRWLKEKLEEYSHK-KF 137

Query: 189 RIIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +I+  HH   P+ DT    N +F      +++     +L L GH H+ +++ ++     +
Sbjct: 138 KIVASHHHLVPLPDTGRERNVLFNAGDVLELLLKHEVNLYLCGHKHVPNIYSVEG----L 193

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            V      S +        SYN+  I K N   ++  KR T              IF
Sbjct: 194 VVANSGCTSCRKTRKGDVNSYNMIKI-KDNGKISVTIKRVTEDIHKRDFTVKKQRIF 249



 Score = 76.9 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 80/268 (29%), Gaps = 51/268 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHV 68
           F +  IS                        + + + YF ++V    I  I      D V
Sbjct: 257 FRIIQIS----------------------ESNVSDRIYFREKVLKNAIKAINERYKPDLV 294

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
              GDIV     R    +      I     I     +          +            
Sbjct: 295 VHCGDIVEVGIERYYKKAYALWEKIKGKKIIVPGHNDITYLGYELFREYF---------- 344

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                     P +    N   I   +A    P    G  GQ+      + L+    +  F
Sbjct: 345 --------GEPEIIENENFTFIPIISAQYETPIGVVGRIGQKI---LREHLK--KYEDTF 391

Query: 189 RIIMMHHPPVL-DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           R+I+MHH       S     +       K++  E A+L+L GH   +    I+      P
Sbjct: 392 RVIIMHHNITPIPKSREIGFLEDGGNVLKILTDEKANLVLTGHGGNSLGMKIE----QTP 447

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKK 275
           +V   S S ++H N    S+NL  I + 
Sbjct: 448 IVNAGSISWELHRNPFGNSFNLIDIYED 475


>gi|75908792|ref|YP_323088.1| metallophosphoesterase [Anabaena variabilis ATCC 29413]
 gi|75702517|gb|ABA22193.1| Metallophosphoesterase [Anabaena variabilis ATCC 29413]
          Length = 266

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 58/305 (19%), Positives = 93/305 (30%), Gaps = 56/305 (18%)

Query: 5   YTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
              +   +A I+DIHL  S S        I   +                 ++  +    
Sbjct: 2   NEKLPISIAQITDIHLLASESQRLQGISTIESFL----------------AVMKRLEELR 45

Query: 65  V--DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWK 122
              D + +TGD+             H+L S+        +PGNHD  I+  K  +L    
Sbjct: 46  PELDLLLMTGDLSEDGTPESYENLQHYLNSLQIAA--YWLPGNHDCAIAMDKILNLGMVS 103

Query: 123 DYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
                                R N   I  +++I    +   GY            LR  
Sbjct: 104 RRK---------------SFQRGNWNFILLNSSIPDCVY---GYLSATTLDWLDSELRML 145

Query: 183 NKKGFFRIIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWI 239
                  +I +HHPPV   S+    + +   Q    +I       L+L GH H    H  
Sbjct: 146 PNNPT--LIALHHPPVSVNSAWIDGSCLRNSQELFAVIDRYPQVKLVLFGHIHQEFRHQR 203

Query: 240 KNEKKLIPVVGIASASQKVHSNKPQ-------ASYNLFYIEKKNEYWTLEGKRYTLS-PD 291
            N    +  +G  S   +  S  P          + L  +      WT + +R   S P 
Sbjct: 204 HN----VHYLGSPSTCYQFQSQSPIFAINQELPGFRLLKLYADG-TWTTKIERVPYSLPI 258

Query: 292 SLSIQ 296
             ++ 
Sbjct: 259 ESAVT 263


>gi|119510715|ref|ZP_01629843.1| hypothetical protein N9414_22123 [Nodularia spumigena CCY9414]
 gi|119464669|gb|EAW45578.1| hypothetical protein N9414_22123 [Nodularia spumigena CCY9414]
          Length = 376

 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/277 (16%), Positives = 92/277 (33%), Gaps = 32/277 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H++   + ++                    S       I  +   N+D + 
Sbjct: 5   FRFAVVSDLHIALPHTIWDHPS----------RFHLVEVSIPAFESAIEHLTQLNLDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSL-HAWKDYITSD 128
           + GD+   +           L  +  P    +VPGNHD  +  A E+S+  A   +    
Sbjct: 55  LPGDLTQHSEPENHLWLQERLAKL--PFPTYVVPGNHDVPVVIANEQSIGFADFPHYYRK 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 ++L+   ++   + LIG ++          G    EQ     ++L  A  +   
Sbjct: 113 FGYENPQQLYYTHQLLPGVRLIGLNSNFFNEDGEQVGRLDAEQLKWLEEVLAAAGDE--L 170

Query: 189 RIIMMHHPPVL-------DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+HH  V                +    +  +++   G  L+  GH H+  +   + 
Sbjct: 171 VLVMVHHNVVEHLPEQSRHPLGKRYMLENSAQLLEILRRYGVKLVFTGHLHIQDVACSQG 230

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY 278
                  +   S     H       Y +F  ++ N  
Sbjct: 231 VYD----ITTGSLVSYPHP------YRVFEFQQDNYG 257


>gi|289523113|ref|ZP_06439967.1| alkaline phosphatase [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503656|gb|EFD24820.1| alkaline phosphatase [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 750

 Score =  117 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/270 (14%), Positives = 87/270 (32%), Gaps = 33/270 (12%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL-LHNVDHVSI 70
            A +SD+HL+ +                    +  ++++++    I++I    +VD V +
Sbjct: 452 FAVLSDLHLALNEPENTW--------------KMFHYNQDILAWAIDEINKRQDVDFVLV 497

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD-AYISGAKEKSLHAWKDYITSDT 129
            GD+   +      +    L  +  P+   ++PGNHD       +               
Sbjct: 498 PGDLTKDSEPYNHRSVKAMLDKLNVPY--YVIPGNHDVKKDWMPQGNFGVVDFARYYEGH 555

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTA-IATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 + +  +   + + LIG  +A       S  G    EQ     + L      G  
Sbjct: 556 GYDGSGRSWYSVDPVSGLHLIGLDSASHPKFSNSWGGAVADEQIKWLEQDLM--ANSGKE 613

Query: 189 RIIMMHHPPVLDT--SSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            I+M+HH  +         N +      ++++       ++ GH H+  +          
Sbjct: 614 VIVMVHHALIKHEGKDDPRNYVENADAVKEILRKYRIKTVITGHLHVTDIAEENGLYD-- 671

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKN 276
             +   + S          +Y +  I  + 
Sbjct: 672 --ISSPAISSFPL------AYRIMEINGEK 693


>gi|126462743|ref|YP_001043857.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17029]
 gi|126104407|gb|ABN77085.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17029]
          Length = 273

 Score =  117 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 51/296 (17%), Positives = 97/296 (32%), Gaps = 42/296 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               E+   L+  +     D V
Sbjct: 1   MKRLLHLSDLHFG-------------------------RDRPELLRPLVETVNRLEPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +I+GD+       +   +  ++ ++  P  + +VPGNHD  +     + +  WK Y    
Sbjct: 36  AISGDLTQRATESQFRAAAAFVAALKPP--VLVVPGNHDVPLHNLFVRLVKPWKRYRRWF 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                           + + ++G +T          G+F         +    A ++   
Sbjct: 94  GRDLEP------CWENDEMIVVGANTVNPLAWQQ--GWFRSRSLARIRRSF--AAEERRV 143

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++++HHP           M G +R    +   GAD+IL GH H   +           V
Sbjct: 144 RVVVVHHPMEHTPDDTKELMRGAERAIDELADCGADVILSGHLHTWRVAPFAEVAGRGVV 203

Query: 249 VGI-ASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + + A              +NL  +        +  +R+T   D+   +   +  F
Sbjct: 204 LQVHAGTGLSTRVRGEPNDFNLLEVASD----RIHIERHTAQEDASGFRLAETRTF 255


>gi|108803821|ref|YP_643758.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
 gi|108765064|gb|ABG03946.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
          Length = 271

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 46/292 (15%), Positives = 84/292 (28%), Gaps = 44/292 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +  +SDIH+                           F  E+    + +      D V+
Sbjct: 1   MRIVQMSDIHVGSG-----------------------LFRPELLEAAVRETNELRPDLVA 37

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           + GD+       E   +   L  +  PH + +V GNHDA   G +           +   
Sbjct: 38  VAGDLTMEGYRWEFEEARRHLDRLECPH-VVVVMGNHDAKSVGYRHFEDIFGSRARSLVV 96

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                              ++   +   T P    G  G+E         R   +     
Sbjct: 97  PSPQ-----------GEAKVVAIDS---TKPDLDEGEVGREYYAWIDSEFRGWERGPKIL 142

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +I  H   V  T    N +        M+     D++L GH H+  +  I      + V+
Sbjct: 143 MIHHHILAVPGTGRDVNILRDAGDVMAMLRELKVDMVLSGHRHVPYVWSISG----VRVI 198

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
              + S          SYNL  ++ +     +  +      +  +    +S 
Sbjct: 199 HSGTVSSLRVRGTMPPSYNLIDLDDE--TVRITLREPGKGKEGETPLASFSR 248


>gi|77463909|ref|YP_353413.1| phospodiesterase [Rhodobacter sphaeroides 2.4.1]
 gi|221639765|ref|YP_002526027.1| Metallophosphoesterase [Rhodobacter sphaeroides KD131]
 gi|332558781|ref|ZP_08413103.1| Metallophosphoesterase [Rhodobacter sphaeroides WS8N]
 gi|77388327|gb|ABA79512.1| possible phospodiesterase [Rhodobacter sphaeroides 2.4.1]
 gi|221160546|gb|ACM01526.1| Metallophosphoesterase [Rhodobacter sphaeroides KD131]
 gi|332276493|gb|EGJ21808.1| Metallophosphoesterase [Rhodobacter sphaeroides WS8N]
          Length = 273

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 51/296 (17%), Positives = 97/296 (32%), Gaps = 42/296 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               E+   L+  +     D V
Sbjct: 1   MKRLLHLSDLHFG-------------------------RDRPELLRPLVETVNRLEPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +I+GD+       +   +  ++ ++  P  + +VPGNHD  +     + +  WK Y    
Sbjct: 36  AISGDLTQRATESQFRAAAAFVAALKPP--VLVVPGNHDVPLHNLYVRLVKPWKRYRRWF 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                           + + ++G +T          G+F         +    A ++   
Sbjct: 94  GRDLEP------CWENDEMIVVGANTVNPLAWQQ--GWFRSRSLARIRRSF--AAEERRV 143

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++++HHP           M G +R    +   GAD+IL GH H   +           V
Sbjct: 144 RVVVVHHPMEHTPEDTKELMRGAERAIDELADCGADVILSGHLHTWRVAPFAEVAGRGVV 203

Query: 249 VGI-ASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + + A              +NL  +        +  +R+T   D+   +   +  F
Sbjct: 204 LQVHAGTGLSTRVRGEPNDFNLLEVASD----RIHIERHTAQEDASGFRLAETRTF 255


>gi|281357041|ref|ZP_06243531.1| metallophosphoesterase [Victivallis vadensis ATCC BAA-548]
 gi|281316599|gb|EFB00623.1| metallophosphoesterase [Victivallis vadensis ATCC BAA-548]
          Length = 267

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 44/262 (16%), Positives = 90/262 (34%), Gaps = 10/262 (3%)

Query: 10  FVLAHISDIHLS-YSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
             + H SD H    +  +     KR +G+ N+ F R+           ++ IL    D  
Sbjct: 1   MKIIHFSDPHAGGPAEDWLAYVDKRWVGVFNYRFRRQFRHDMSKLKKAVDYILDVKPDVA 60

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIG-NPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
             TGD+ +     E       L+ +  +   +  +PGNHD Y+   K            S
Sbjct: 61  VCTGDLTSTGQPGEFEQVRPILQPLRDSSIPLLYLPGNHDCYVKRPKCVRAVNEMVEYLS 120

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +   P +R    +  +  + +  +    + G+     +    ++     +   
Sbjct: 121 RGDYRFAE--LPLVREYAGVEFLLLNCSRPSNLLCSWGFVDPRDSEYLDRVCSAPKRGPR 178

Query: 188 FRIIMMHHPPVLDTSS---LYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
              +++ H P+ +      + +R+FG +R  +++     DL L GH H   L   +  + 
Sbjct: 179 ---VLLSHYPMFEEHPILRMRHRLFGQKRILELMKEGKIDLSLCGHVHRPYLKVDERGRG 235

Query: 245 LIPVVGIASASQKVHSNKPQAS 266
                 +      V  +   A 
Sbjct: 236 ESCAGSVTRNGSMVEVDCDPAG 257


>gi|223041526|ref|ZP_03611727.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Actinobacillus minor 202]
 gi|223017621|gb|EEF16031.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Actinobacillus minor 202]
          Length = 275

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/296 (15%), Positives = 93/296 (31%), Gaps = 47/296 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH--V 68
            L  I+D HL   PS   L                   + +    ++ +I   NVD   +
Sbjct: 15  RLLQITDPHLFSEPSTCLLG----------------VNTHQSLQAVLAEIQKTNVDFHAI 58

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD++     +        +     P  +  V GNHD     +          YI  +
Sbjct: 59  LATGDLIQDHQVQGYHHFARMIEPFKKP--VFWVEGNHDEQPQMSLCLG---EYSYIQPE 113

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G+             ++  ++ +A  P   +GY  + Q     K L + + +   
Sbjct: 114 KQIFAGRY----------WQILLLNSQVAEAP---SGYLSRGQLAWLEKSLSENSDRFSL 160

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  +  P        + +    +  +++        ILHGH H       +N    I 
Sbjct: 161 IVLHHNILPTHSAWLDQHSLKNADKLAEILARFPKVKAILHGHIHQEVNAIWQN----IQ 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           +    S   +   N  +     F ++   + W  E   +        +++  S+ F
Sbjct: 217 IFATPSTCIQFKPNCDE-----FTLDMLPQGWR-EISLFEDGRIETEVKRLKSNDF 266


>gi|288958245|ref|YP_003448586.1| 3',5'-cyclic-nucleotide phosphodiesterase [Azospirillum sp. B510]
 gi|288910553|dbj|BAI72042.1| 3',5'-cyclic-nucleotide phosphodiesterase [Azospirillum sp. B510]
          Length = 291

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 58/289 (20%), Positives = 104/289 (35%), Gaps = 44/289 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  LAHISD+H                                V + L++D+     D +
Sbjct: 1   MKRLAHISDLHFG-------------------------RIDPRVVDGLLSDLTAQAPDLI 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD V     R    +  +LR +  P     VPGNHD  +     +    +  Y T  
Sbjct: 36  VISGDFVQRAKPRHFEEARAFLRKL--PFPYMAVPGNHDIPVYNVFRRFTDPFGHYRTYI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           T   +       L I + +A++G +TA       + G   + Q     ++      +  F
Sbjct: 94  TNDLSP------LHIDDELAVLGINTARPVIMDFSEGRMNRRQITRVREVFCGM-PETVF 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRF-QKMIWHEGADLILHGHTHLNSLHWIKNEK---- 243
           +++  HHP +        ++ G  +     +   G DL+L GH H      I +      
Sbjct: 147 KVLFTHHPFLPPPDLPRTQLVGRHKLVLPALESCGVDLLLAGHLHKAYSGDIMSFHTQVA 206

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
           + I V   ++A+     N+   +YNL  +     + T+  +  +    +
Sbjct: 207 RSILVAQASTATSTRLRNE-ANAYNLITV----AHPTVTFEVRSWEGAA 250


>gi|171911751|ref|ZP_02927221.1| probable DNA repair exonuclease [Verrucomicrobium spinosum DSM
           4136]
          Length = 301

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 41/294 (13%), Positives = 91/294 (30%), Gaps = 40/294 (13%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             L H+SD+H                                    L + +     D   
Sbjct: 1   MRLVHLSDLHFGAITMGRP-------------------------EALRDAVQAVGADLTV 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+     +RE   +  +L ++  P    +VPGNHD                      
Sbjct: 36  ISGDLTQKGRHREFVAAREFLETL--PGPRFVVPGNHDMPHGVHLWARFEHPWRTYR--- 90

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKGF 187
               G+++ P L     + + G +++     +   + G     Q     +   +A  +  
Sbjct: 91  -EVMGEEMEPTLHAPGMV-VAGMNSSRPGGLYVDWSRGRLSAGQLIRLRQQYLEATPEAL 148

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHW--IKNEKKL 245
             +++ H P      +  + +         +   G DL+L GH HL+      +      
Sbjct: 149 RVLVVHHPPAAPPQGTRRHLIDKRPALFGALNEAGVDLVLSGHFHLSYAVPVKLPGVHPR 208

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
             V+ + S +           +++       +   L+ + +T + ++    + +
Sbjct: 209 HFVLSVTSTATSHRLKGEPNGFHVIE----GDRQHLQVQAWTWNDETYVPTRMW 258


>gi|77164766|ref|YP_343291.1| metallophosphoesterase [Nitrosococcus oceani ATCC 19707]
 gi|254434086|ref|ZP_05047594.1| Ser/Thr protein phosphatase family protein [Nitrosococcus oceani
           AFC27]
 gi|76883080|gb|ABA57761.1| Metallophosphoesterase [Nitrosococcus oceani ATCC 19707]
 gi|207090419|gb|EDZ67690.1| Ser/Thr protein phosphatase family protein [Nitrosococcus oceani
           AFC27]
          Length = 296

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 51/276 (18%), Positives = 87/276 (31%), Gaps = 40/276 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISD+H                            F  ++   L++ I   + D +
Sbjct: 1   MLNLLHISDLHFG------------------------NPFLPDIGEALLHKISGLSPDIL 36

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GDI       E   +  +   +  P    +VPGNHD  +    E+    +K Y    
Sbjct: 37  VISGDITQRARPEEFKAARAYFDRM-PPIPQLVVPGNHDIPLYRIFERLFQPYKLYHRYI 95

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                  K    +  +NN  ++G  +         NG   +EQ    ++    A  +   
Sbjct: 96  ------DKERNIVLRQNNAVIVGLDSTNPY-FAITNGRIRREQLDFCAEAFAMAPPEAAR 148

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH----WIKNEKK 244
            ++  HH            M   +R          DLIL GH H   +         E +
Sbjct: 149 IVVAHHHFAPAPDYKGGEIMPKAKRALDFFTGLKVDLILAGHLHRAYIGNSLDVYPGEDR 208

Query: 245 LIPVVGIASASQKVHSNK----PQASYNLFYIEKKN 276
              ++     +      +     + S+N   I K +
Sbjct: 209 EHGIIIAQCGTSTSRRGRVREQEKNSFNRIEIMKDS 244


>gi|284050230|ref|ZP_06380440.1| hypothetical protein AplaP_02015 [Arthrospira platensis str.
           Paraca]
 gi|291570724|dbj|BAI92996.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 363

 Score =  116 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 49/304 (16%), Positives = 100/304 (32%), Gaps = 38/304 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A  SD+H+   P      PKR               S      +   +   ++D + 
Sbjct: 5   FRFAIASDLHI-ALPDTIWDHPKRF---------HLVEVSIAALEQVFEHLERLDIDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI-SGAKEKSLHAWKDYITSD 128
           + GD+            +  L+++  P+   +VPGNHD  +  G       +        
Sbjct: 55  LPGDLTQHGERDNHAWLSDRLKNL--PYPAYVVPGNHDVPLAVGEGSLIGLSEFPEYYPH 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                   L+    +R+ + LIG ++       +  GY  ++Q      +L  A      
Sbjct: 113 CGYQDRSCLYYTCELRSGVRLIGLNSNGFDEQGNQIGYVDEKQLDWLRDVL--AKSTDEL 170

Query: 189 RIIMMHHPPVLD-------TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+HH  +                +    +  +++   G  L+  GH H+  +   + 
Sbjct: 171 VLVMIHHNIIEHLPGQSTNPLGRRYMLSNAPQLLEVLERGGVQLVFTGHLHVQDIAKWRG 230

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY-WTLEGKRYTLS-----PDSLSI 295
                  +   S     H       Y +    + ++    LE + + +      PD  SI
Sbjct: 231 VYD----ITTGSLVSYPHP------YRILNFSRDDQGQQRLEIESHRIVSVPGFPDLPSI 280

Query: 296 QKDY 299
            +++
Sbjct: 281 SREW 284


>gi|197122549|ref|YP_002134500.1| metallophosphoesterase [Anaeromyxobacter sp. K]
 gi|196172398|gb|ACG73371.1| metallophosphoesterase [Anaeromyxobacter sp. K]
          Length = 268

 Score =  116 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 48/242 (19%), Positives = 88/242 (36%), Gaps = 8/242 (3%)

Query: 43  NRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIV 102
              +  S  +A  L++ +    VDH+ +TGD+      RE   +   LR       +++V
Sbjct: 15  RDCERHSTRLAKGLLDALREIGVDHLVVTGDLTFSGEPREFERAAELLRPFAEAGKLTVV 74

Query: 103 PGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIA-TPPF 161
           PGNHD +   + E                         + + +   L+   +A     P+
Sbjct: 75  PGNHDVWTEESVETGRFLRALGPDGKGMKKAAPSYPHVVPLGDEAVLVALDSARYGDDPW 134

Query: 162 SANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH----PPVLDTSSLYNRMF---GIQRF 214
           +  G  G EQ  A  +L R+  + G   ++  HH    PP    S  +          + 
Sbjct: 135 TTPGRLGGEQLRAARELAREHARLGRAVLLAFHHHVVLPPERVPSDAHVCRMPLADADQV 194

Query: 215 QKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEK 274
            +++       +LHGH H      +       PV+   SAS+       +A   L+ +++
Sbjct: 195 VRLVAEVPVAAVLHGHRHTAFRVDLPGAAGPTPVLCAGSASRTADEPVRRARAYLYEVDR 254

Query: 275 KN 276
             
Sbjct: 255 TG 256


>gi|86158130|ref|YP_464915.1| metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85774641|gb|ABC81478.1| Metallophosphoesterase [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 268

 Score =  116 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 49/253 (19%), Positives = 87/253 (34%), Gaps = 9/253 (3%)

Query: 33  RIIGLVNWHFNRKKYFSKEVANL-LINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91
           R     N    R            L++ +    VDH+ +TGD+      RE   +   LR
Sbjct: 4   RGRYPRNGFAARDCERHSARLAKGLLDALREIGVDHLVVTGDLTFSGEPREFERAAELLR 63

Query: 92  SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151
                  +++VPGNHD +   + E                         + + +   L+ 
Sbjct: 64  PFAEAGKLTVVPGNHDVWTEESVETGRFLRAIGPDGKGMKKAAPSYPQVVPLGDEAVLVA 123

Query: 152 CSTAIA-TPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHH----PPVLDTSSLYN 206
             +A     P++  G  G EQ  A  +L R+  + G   ++  HH    PP    S  + 
Sbjct: 124 LDSARYGDDPWTTPGRLGGEQLRAARELAREHARLGRAVLLAFHHHVVLPPERVPSDAHV 183

Query: 207 RMF---GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKP 263
                    +  +++       +LHGH H      +       PV+   SAS+       
Sbjct: 184 CRMPLADADQVVRLVAEVPIAAVLHGHRHTAFRVDLPGAAGPTPVLCAGSASRTADEPVR 243

Query: 264 QASYNLFYIEKKN 276
           +A   L+ +++  
Sbjct: 244 RARAYLYEVDRTG 256


>gi|146277006|ref|YP_001167165.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17025]
 gi|145555247|gb|ABP69860.1| metallophosphoesterase [Rhodobacter sphaeroides ATCC 17025]
          Length = 270

 Score =  116 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 53/296 (17%), Positives = 95/296 (32%), Gaps = 42/296 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               E+   LI  +     D V
Sbjct: 1   MKRLLHLSDLHFG-------------------------RDRPELLRPLIETVNGLAPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +I+GD+       +   +  ++  +  P  + +VPGNHD  +     + +  WK Y    
Sbjct: 36  AISGDLTQRATEAQFRAAAAFVERLKPP--VLVVPGNHDVPLHNLYVRLVKPWKRYRRWF 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                           + + + G +T          G+F         ++   AN++   
Sbjct: 94  GRDLEP------CWEDDEMIVAGANTVNPLAWQQ--GWFRSRSLARIRRIF--ANEESRV 143

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R++++HHP           M G  R    +   GAD+IL GH H   +           V
Sbjct: 144 RVVVVHHPMEHTPEDTKELMRGAGRAIGELAECGADVILSGHLHTWRVGPFAEVDGRGVV 203

Query: 249 VGI-ASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + + A              +NL  +        +  +R+T   D    +   +  F
Sbjct: 204 LQVHAGTGLSTRVRGEPNDFNLLEVSAD----RIHVQRHTALEDGSGFRPTETRTF 255


>gi|330443879|ref|YP_004376865.1| Calcineurin-like phosphoesterase [Chlamydophila pecorum E58]
 gi|328806989|gb|AEB41162.1| Calcineurin-like phosphoesterase [Chlamydophila pecorum E58]
          Length = 302

 Score =  116 bits (289), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 60/276 (21%), Positives = 103/276 (37%), Gaps = 15/276 (5%)

Query: 10  FVLAHISDIHLSYSPS-FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           F L HISD+H    P   F    KR    +   F    +    + N   + I   + + V
Sbjct: 9   FRLVHISDVHCRVFPKNLFYCFNKRFKSFLRQVFCSVDFQDVTICNRFPDLIRSLHTNSV 68

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+     + E   + H++  +     I +VPGNHD Y   + ++     + +    
Sbjct: 69  CLTGDLTLTALHAEFSLARHFIDHLAQYAKIHLVPGNHDVYTKTSYQE-----QTFYHYF 123

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                 K      R+  +  +I    +     FSANG     Q  A   LLR   +    
Sbjct: 124 PNVRLQKNKVAKYRLTPDWWIILLDCSCLNGWFSANGKVFLSQIAALESLLRSIPQSE-- 181

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            II+ +H P+L +   ++ +      Q+ +       L LHGH H      +   K L P
Sbjct: 182 NIIIANHYPLLTSKKKFHTLLNNSLLQETLRDFPNIRLYLHGHDHQ---ATLYANKDLSP 238

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
            + + S S  + S    A + +  +  ++       
Sbjct: 239 GLILNSGSISLPS---NARFYIIDLYPQDYQVHTAV 271


>gi|14590054|ref|NP_142118.1| hypothetical protein PH0104 [Pyrococcus horikoshii OT3]
 gi|3256490|dbj|BAA29173.1| 505aa long hypothetical protein [Pyrococcus horikoshii OT3]
          Length = 505

 Score =  116 bits (289), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 57/289 (19%), Positives = 102/289 (35%), Gaps = 52/289 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   +F   +                       +L++N+I     D V
Sbjct: 4   ML-IAHISDTHITNEVAFKSYAY----------------------DLIVNEINTKPFDLV 40

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ N     E   +++ ++ I  P  + +VPGNHDA                    
Sbjct: 41  VHTGDVTNNGLREEYEHASYLIKKIEKP--LVVVPGNHDARNV---------------GY 83

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +   +N  +I   +   T P  ++G  G  +     + L   + K   
Sbjct: 84  ELFEKYIGPLYGVYEFDNGVIIWLDS---TIPDLSDGRVGGYKFKWLKEKLEAYSHKKIK 140

Query: 189 RIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            +   HH  P+ DT    N +F       ++      L + GH H+ +++ ++     + 
Sbjct: 141 IVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLTHEVTLYMCGHKHVPNVYRVE----DLV 196

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
           V     AS +        SYN+  I  K     ++     L+ D  S +
Sbjct: 197 VDNAGCASCRKTRKGDVNSYNIVKITDKG----VKVVIRRLTGDEESKE 241



 Score = 72.7 bits (176), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 45/252 (17%), Positives = 78/252 (30%), Gaps = 29/252 (11%)

Query: 26  FFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHVSITGDIVNFTCNREIF 84
                  RI+ +   + + + YF K      I  I      D V   GD+V     R   
Sbjct: 252 PRGRRLLRIVQISESNVSDRVYFRKRTLENAIKAINEKYKPDIVIHCGDVVEKGIERYYE 311

Query: 85  TSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIR 144
            +  +   +     I +   N  +Y+     +                      P +   
Sbjct: 312 KAMEYYEKVK-GEKIIVPGHNDISYLGYELFREYF-----------------GEPEVLEL 353

Query: 145 NNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVL-DTSS 203
            +   I   +A         G  GQ+      +  R+      FRI++MHH  V      
Sbjct: 354 GDFVFIPILSAQYETQIGVVGRTGQKMLSRMLEEFRE-----KFRIVIMHHNLVPVPGVK 408

Query: 204 LYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKP 263
               +       K+I     +L L GH    S   ++      P++   S S ++H N  
Sbjct: 409 EIGYLEDAGNVLKIITENETELTLTGHGGNTSAVKVE----KSPIINAGSISWELHRNPF 464

Query: 264 QASYNLFYIEKK 275
             S+N+  I + 
Sbjct: 465 GNSFNIIDIYED 476


>gi|323691114|ref|ZP_08105394.1| hypothetical protein HMPREF9475_00255 [Clostridium symbiosum
           WAL-14673]
 gi|323504811|gb|EGB20593.1| hypothetical protein HMPREF9475_00255 [Clostridium symbiosum
           WAL-14673]
          Length = 588

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 39/311 (12%), Positives = 95/311 (30%), Gaps = 32/311 (10%)

Query: 16  SDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIV 75
           SD+H            + +     W+      +   +A+  + ++++     + ++GDI 
Sbjct: 173 SDLHY--QSPKMTDFRESLDTYTEWNDGTVVPYLDVIADAFLEEVMMKKPSVLILSGDIS 230

Query: 76  NFTCNREIFT-STHWLRSIGNPHDISIVPGNHDAYISGAKEKS--------------LHA 120
                      +    +       + ++PGNHD     A                   + 
Sbjct: 231 QNGEKVNHQELAKKLKQVQDAGIPVLVIPGNHDINHPWAASYFDNKKEEAKGTTPSEFYE 290

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRN-NIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
                  D   S  +    YL   + +  ++   + I  P     G   +E      + L
Sbjct: 291 IYHEFGYDQASSRDEDSLSYLYRLDEHYWIMMLDSCIYEPVHETGGRIKKETLAWMERQL 350

Query: 180 RKANKKGFFRIIMMHHPPVLDTS--SLYNRMFGIQRFQKMIWHEGADLILHGHTH----- 232
            +A + G   I + HH  + +++       +   +    ++      + + GH H     
Sbjct: 351 EEAKEAGAMVIPVAHHNLLKESTLYPEECTLENNREVIDLLEEYHLPVYISGHLHLQRIK 410

Query: 233 LNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
            N    ++  +  I  +  +S +       P   Y +         +    K   +S  +
Sbjct: 411 KNVRGPLEEGEYGIYEIVSSSLAI------PPCQYGIINWTNDGS-FRYHTKEVDISGWA 463

Query: 293 LSIQKDYSDIF 303
              Q++  ++ 
Sbjct: 464 ERYQEEDPNLL 474


>gi|323483387|ref|ZP_08088775.1| serine/threonine protein phosphatase [Clostridium symbiosum
           WAL-14163]
 gi|323403241|gb|EGA95551.1| serine/threonine protein phosphatase [Clostridium symbiosum
           WAL-14163]
          Length = 533

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 39/311 (12%), Positives = 95/311 (30%), Gaps = 32/311 (10%)

Query: 16  SDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIV 75
           SD+H            + +     W+      +   +A+  + ++++     + ++GDI 
Sbjct: 118 SDLHY--QSPKMTDFRESLDTYTEWNDGTVVPYLDVIADAFLEEVMMKKPSVLILSGDIS 175

Query: 76  NFTCNREIFT-STHWLRSIGNPHDISIVPGNHDAYISGAKEKS--------------LHA 120
                      +    +       + ++PGNHD     A                   + 
Sbjct: 176 QNGEKVNHQELAKKLKQVQDAGIPVLVIPGNHDINHPWAASYFDNKKEEAKGTTPSEFYE 235

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRN-NIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
                  D   S  +    YL   + +  ++   + I  P     G   +E      + L
Sbjct: 236 IYHEFGYDQASSRDEDSLSYLYRLDEHYWIMMLDSCIYEPVHETGGRIKKETLAWMERQL 295

Query: 180 RKANKKGFFRIIMMHHPPVLDTS--SLYNRMFGIQRFQKMIWHEGADLILHGHTH----- 232
            +A + G   I + HH  + +++       +   +    ++      + + GH H     
Sbjct: 296 EEAKEAGAMVIPVAHHNLLKESTLYPEECTLENNREVIDLLEEYHLPVYISGHLHLQRIK 355

Query: 233 LNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
            N    ++  +  I  +  +S +       P   Y +         +    K   +S  +
Sbjct: 356 KNVRGPLEEGEYGIYEIVSSSLAI------PPCQYGIINWTNDGS-FRYHTKEVDISGWA 408

Query: 293 LSIQKDYSDIF 303
              Q++  ++ 
Sbjct: 409 ERYQEEDPNLL 419


>gi|167644056|ref|YP_001681719.1| metallophosphoesterase [Caulobacter sp. K31]
 gi|167346486|gb|ABZ69221.1| metallophosphoesterase [Caulobacter sp. K31]
          Length = 286

 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 47/266 (17%), Positives = 81/266 (30%), Gaps = 32/266 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             L  +SDIH                                     +  I     D + 
Sbjct: 9   LKLVQVSDIHFGGEHK-------------------------AAVEAAVERINAEAPDLLI 43

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
             GD+     + E   +  WL  +  P    + PGNHD    G  E        +   ++
Sbjct: 44  AAGDLTKDGKSTEFDAAQAWLDRL--PRPRLVTPGNHDTPFVGPSEILTRLVAPWRRYES 101

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
               G+    +   R  +A +  + A       + G   + Q       L +A   G  +
Sbjct: 102 -RFGGRHNSDWDDPRATVATLNSARAFQLRLNWSKGAVSRGQVREVCADL-EAAAPGAVK 159

Query: 190 IIMMHHPPVLDTSSLYN-RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           I++ HHP +         ++ G     +     G DL+L GH H   +H           
Sbjct: 160 IVVCHHPLIEMLGGPMTAKVRGGTAAAQAFSQAGVDLVLTGHIHAPFVHPYPFSDGCTQA 219

Query: 249 VGIASASQKVHSNKPQASYNLFYIEK 274
           VG  + S +        S+N+  ++ 
Sbjct: 220 VGSGTLSVR--ERGVPPSFNVIEVDD 243


>gi|20093348|ref|NP_619423.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina acetivorans
           C2A]
 gi|19918712|gb|AAM07903.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina acetivorans
           C2A]
          Length = 246

 Score =  115 bits (288), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 54/291 (18%), Positives = 100/291 (34%), Gaps = 55/291 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             L H+SDIH S                       + ++  E+A+ ++  I  +N D V 
Sbjct: 1   MRLVHLSDIHFS-----------------------EAFYMPEIADTMLEKINQNNPDIVV 37

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+       E   + +++  I   + + IVPGNHD+  +G             +   
Sbjct: 38  ITGDLTENGLAAEYNGAKNFIDRIECKNKV-IVPGNHDSRNAGYLFFEDIFKARSSSG-- 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                            + ++G  ++    P    G+ G+E      +    A     F+
Sbjct: 95  -------------SFGEVTVVGLDSS---QPELEEGHIGRENYGWIEEAFSTAG----FK 134

Query: 190 IIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           +  +HH   P+  T    N +       +++   G +L+L GH H+  +  +      + 
Sbjct: 135 VFALHHHLIPIPRTGRGNNVLVDAGDVLELLDRSGVNLVLCGHWHIPWVWRLN----DML 190

Query: 248 VVGIASASQKVHSNKPQASYNLFYI---EKKNEYWTLEGKRYTLSPDSLSI 295
           VV   +        K    YN   +   E     W L+  R+        +
Sbjct: 191 VVSAGTVCSSKVRGKATQCYNYIELEMPESDCTRWHLQVHRFFYGGKKERV 241


>gi|152992897|ref|YP_001358618.1| metallophosphoesterase [Sulfurovum sp. NBC37-1]
 gi|151424758|dbj|BAF72261.1| metallophosphoesterase [Sulfurovum sp. NBC37-1]
          Length = 294

 Score =  115 bits (288), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 57/267 (21%), Positives = 99/267 (37%), Gaps = 15/267 (5%)

Query: 10  FVLAHISDIHLSYSPSFFEL---SPKRIIGLVNWHFNR--KKYFSKEVANLLINDILLHN 64
             + H SDIH++             KR IG +N    R      +++    L+     ++
Sbjct: 5   LRILHFSDIHVNIQIRHMHWKKWFSKRAIGAINLLRGRASYFDDTEKKLAALVRFKEEND 64

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISI-VPGNHDAYIS--GAKEKSLHAW 121
           +D V  TGD        E+  +   L  +  P    I VPGNHD Y+    +  +    +
Sbjct: 65  IDIVINTGDYTALGLRSELILARQLLDPLMTPPQNYITVPGNHDIYVHEGNSHYRFSEQF 124

Query: 122 KDYITSDTTCSTGKKLFPYLRIRN-NIALIGCSTAIATP-PFSANGYFGQEQAHATSKLL 179
              + +D         +P +R+   + A+I   +A   P P+ ++G    EQ  A  ++L
Sbjct: 125 CSVLQNDLPEYCRGGHWPLIRLLGDDAAVIAIDSARPNPVPWKSSGEIPPEQLQALEEIL 184

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMF---GIQRFQKMIWHEGADLILHGHTHLNSL 236
           +    KG F  +M H+ P L       ++        F +         IL GH H    
Sbjct: 185 KDERVKGRFLFVMTHYAPRLSNGEPDKKLHGLINADDFLETCKGIENGAILFGHIHK--T 242

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNKP 263
           + +        +    SA+ + H    
Sbjct: 243 YRLHVPGVKSELFCAGSATMQGHEGCW 269


>gi|257877870|ref|ZP_05657523.1| phosphoesterase [Enterococcus casseliflavus EC20]
 gi|257812036|gb|EEV40856.1| phosphoesterase [Enterococcus casseliflavus EC20]
          Length = 270

 Score =  115 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 49/273 (17%), Positives = 85/273 (31%), Gaps = 35/273 (12%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-VDHVSI 70
           + HISDIH   S    E   + ++  +                  I D      +D V I
Sbjct: 3   VLHISDIHFRESYLPCEEGYQGMLAAMQ--------NPLIPLEECIQDAKARAAIDLVVI 54

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+       +  +   +L        I +  GNHD             ++      + 
Sbjct: 55  SGDLTEDGAPADYASLKQYLEKAFGSVPIVVTLGNHD---------IKRHFRQGWQGKSV 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            +     F  +     +A++    +       A+G   + Q       L +  +K   +I
Sbjct: 106 ETASDTPFNQVYETETLAIVTFDNSCYG---YADGIVDERQFEWLQATLAQLKEK---KI 159

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           + + H  +L   +      G  R   ++       IL GHTH      I      IP   
Sbjct: 160 VFVTHHHLLPDQASTPAWAGANRLVALLQQYQISCILSGHTHHAFTGTIAG----IPYYT 215

Query: 251 IASASQKVHSNKP-------QASYNLFYIEKKN 276
           +AS S               +  YNL+  E+  
Sbjct: 216 VASMSFVGEDEGDGMVRFEERYGYNLYRFEEGA 248


>gi|289644186|ref|ZP_06476277.1| metallophosphoesterase [Frankia symbiont of Datisca glomerata]
 gi|289505993|gb|EFD27001.1| metallophosphoesterase [Frankia symbiont of Datisca glomerata]
          Length = 606

 Score =  115 bits (287), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 47/302 (15%), Positives = 94/302 (31%), Gaps = 48/302 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHV 68
            L  ISD H+                         K  S      ++  I      +D +
Sbjct: 334 TLIQISDTHIVREDELLH----------------GKIDSYATLRTVLEQIEAAGTTIDAL 377

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNP--HDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            +TGD+ +             +  +       +    GNHD+               +  
Sbjct: 378 LLTGDLADSGDLAAYQRLRDLVEPVAARLGAPVLYAVGNHDSR------------GPFRA 425

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    + + ++   +++ +I   T   T P   +G     Q    +  L      G
Sbjct: 426 GLLGAEPTAEPYDHVHWIDDLRVIVLDT---TRPGRHSGALSTAQLRWLADELATPAAAG 482

Query: 187 FFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
              ++ +HHPPV    SL N +     ++   ++      ++L GH H +S         
Sbjct: 483 T--VLALHHPPVPSPISLVNALLLAEPEKLADVLAGSDVKILLAGHAHHSS----AGAIG 536

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
            +PV    S++ +  +  P   +         EY  ++   Y     + +I    +++ Y
Sbjct: 537 AVPVWVAGSSAYRAGTIGPTDRFTGL---AGGEYTRVDV--YPAGAVATAIPIADTEVIY 591

Query: 305 DT 306
           D 
Sbjct: 592 DR 593


>gi|327479919|gb|AEA83229.1| DNA repair exonuclease [Pseudomonas stutzeri DSM 4166]
          Length = 267

 Score =  115 bits (287), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 44/288 (15%), Positives = 88/288 (30%), Gaps = 40/288 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +  ISD H                                V   L + +  H  D +
Sbjct: 1   MTSIVQISDTHFGTE-------------------------QPAVVQALEDHVREHRADLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSLHAWKDYIT 126
             +GDI       +  ++  ++R +      D  ++PGNHD  +     +    + +Y  
Sbjct: 36  VFSGDITQRARRGQFASAAAFVRRLEADGVGDTLVIPGNHDIPLYNVFARLFTPYGNYRQ 95

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                         +     + +IG +T         +G     Q    ++ L +++   
Sbjct: 96  HFGDDLEP------VFENEQMLVIGLNTTHP--RRHKDGVVTARQVERVARRLEESDPGK 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL----HWIKNE 242
              ++       +  S L N   G +   +     G DL++ GH HL  +          
Sbjct: 148 IRIVVAHQPFGAMVPSDLSNLQHGAEPALQRWAEHGLDLVMGGHIHLPYVLPLSRQYPGL 207

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSP 290
            + I +V   +            S+N   +    +   +  +R+ LS 
Sbjct: 208 AREIWMVQAGTTLSTRLRGTSPNSFNRLKLHP-GDEKKVCVERWDLSA 254


>gi|124267369|ref|YP_001021373.1| putative DNA repair exonuclease [Methylibium petroleiphilum PM1]
 gi|124260144|gb|ABM95138.1| putative DNA repair exonuclease [Methylibium petroleiphilum PM1]
          Length = 274

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/292 (14%), Positives = 83/292 (28%), Gaps = 39/292 (13%)

Query: 13  AHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITG 72
             ISD H                                V   L+  +     D   ++G
Sbjct: 5   IQISDPHFGTE-------------------------QPAVVEALLQLVREQAPDVAVLSG 39

Query: 73  DIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCS 132
           DI       +   +  ++  +G P    ++PGNHD  +     +    + ++  +     
Sbjct: 40  DITQRASRAQFRAARAFVDRLGTPV-TLVIPGNHDIPLFNPLARLFAPYANHRQAFGAEL 98

Query: 133 TGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIM 192
                +P         L+  +     P    +G     Q    +  L  A       +++
Sbjct: 99  EPMAAWP--------DLLLLTVNTTRPWRHKDGEVSDAQVARVAAQLHAAQPGQLRVVVV 150

Query: 193 MHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE----KKLIPV 248
                V       NR+       +     GADL+L GH HL  +  +        + +  
Sbjct: 151 HQPLAVTREEDEPNRLHRGTEAARAWSQAGADLVLGGHIHLPFVLPLHERFEALARPLWA 210

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKK-NEYWTLEGKRYTLSPDSLSIQKDY 299
           V   +A  +   ++   S NL     +         +R+     S   +   
Sbjct: 211 VQAGTAVSRRVRDEAGNSVNLVRSRGRVGPRREALVERWDYRAASQRFEPVS 262


>gi|113476904|ref|YP_722965.1| metallophosphoesterase [Trichodesmium erythraeum IMS101]
 gi|110167952|gb|ABG52492.1| metallophosphoesterase [Trichodesmium erythraeum IMS101]
          Length = 363

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/291 (16%), Positives = 102/291 (35%), Gaps = 35/291 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A  SD+H++   +  E +          H       S     L++  +   ++D + 
Sbjct: 5   FRFAVASDLHIAVPHTISEKT----------HSFHLVEVSIPALELVLEHLSKLDIDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH-AWKDYITSD 128
           + GD+            +  L ++  P+ + +VPGNHD  +  A + S+  A        
Sbjct: 55  LPGDLTQDGEPENHTWLSQRLSAL--PYPVYVVPGNHDVPVKFANDYSIGLANFPSYYHH 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA--NGYFGQEQAHATSKLLRKANKKG 186
                 ++L+   ++   + +IG ++            G    EQ     ++L  A ++ 
Sbjct: 113 CGYDYQQRLYYSEQVLPGVRIIGLNSNQFDTSGKQKYTGGLESEQLDWLQQVLSIAEEE- 171

Query: 187 FFRIIMMHHPPVLD-------TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI 239
              I+M+HH  +         +      +        ++   G  LI  GH H+  +   
Sbjct: 172 -LVIVMLHHNVIEHLPDQSHNSLGRRYMLENRSVLLDILQSAGVQLIFTGHLHVQDVA-- 228

Query: 240 KNEKKLIPVVGIASASQKVHSNKPQASYNLFY-IEKKNEYWTLEGKRYTLS 289
             + + I  +   S     H       Y +   I   +   +L+ + Y ++
Sbjct: 229 --KDQGIYEITTGSLVSYPHP------YRIIDFITNASGQKSLKIESYRIN 271


>gi|323359390|ref|YP_004225786.1| phosphohydrolase [Microbacterium testaceum StLB037]
 gi|323275761|dbj|BAJ75906.1| predicted phosphohydrolase [Microbacterium testaceum StLB037]
          Length = 311

 Score =  115 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 46/305 (15%), Positives = 87/305 (28%), Gaps = 57/305 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVS 69
           L H+SD HL    +                    +  S+      +  I       D + 
Sbjct: 13  LLHLSDTHLRAGGAPLYD----------------RVDSEAYLARAVAAIEASGVRPDALV 56

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +F            +  +       +  V GNHD            A       
Sbjct: 57  FTGDLADFGEGDAYDRVRSLVEPLAERLETRVVWVMGNHDDR----------ATFRSHLL 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
               +        +   + + ++   T++   P   +G    EQ    + +L      G 
Sbjct: 107 PGDAADPTAPVDRVDEFDGLRIVTLDTSV---PGFHHGEVTPEQLAWLADVLATPAPLGT 163

Query: 188 FRIIMMHHPPVLD--TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ +HHPPV      +    +   +    ++       IL GH H ++          
Sbjct: 164 --ILALHHPPVPSVLDLAASVELRDQRSLAAVLRGTDVRAILAGHLHYSTFATFAG---- 217

Query: 246 IPVVGIASASQK---------VHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
           IPV   ++                      +NL ++         E   +++ P   + +
Sbjct: 218 IPVSVASATCYTQDLMVPVGGTRPQDGAQGFNLVHVYD-------ETIVHSVVPLGAAEE 270

Query: 297 KDYSD 301
             Y D
Sbjct: 271 LQYVD 275


>gi|257868270|ref|ZP_05647923.1| phosphoesterase [Enterococcus casseliflavus EC30]
 gi|257874457|ref|ZP_05654110.1| phosphoesterase [Enterococcus casseliflavus EC10]
 gi|257802384|gb|EEV31256.1| phosphoesterase [Enterococcus casseliflavus EC30]
 gi|257808621|gb|EEV37443.1| phosphoesterase [Enterococcus casseliflavus EC10]
          Length = 270

 Score =  115 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 50/273 (18%), Positives = 85/273 (31%), Gaps = 35/273 (12%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHVSI 70
           + HISDIH   S    E   + ++  +                  I D      +D V I
Sbjct: 3   VLHISDIHFRESYLPCEEGYQGMLAAMQ--------NPLIPLEECIQDAKARVAIDLVVI 54

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+       +  +   +L        I +  GNHD             ++      + 
Sbjct: 55  SGDLTEDGAPADYASLKRYLEKAFGSVPIVVTLGNHD---------IKRHFRQGWQGKSV 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            +     F  +     +A++    +       ANG   + Q       L +  +K   +I
Sbjct: 106 ETASDTPFNQVYETETLAIVTFDNSCYG---YANGIVDERQFEWLQATLAQLKEK---KI 159

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           + + H  +L   +      G  R   ++       IL GHTH      I      IP   
Sbjct: 160 VFVTHHHLLPDQASTPAWAGANRLVALLQQYQISCILSGHTHHAFTGTIAG----IPYYT 215

Query: 251 IASASQKVHSNKP-------QASYNLFYIEKKN 276
           +AS S               +  YNL+  E+  
Sbjct: 216 VASMSFVGEDEGDGMVRFEERYGYNLYRFEEGA 248


>gi|126660514|ref|ZP_01731621.1| hypothetical protein CY0110_11032 [Cyanothece sp. CCY0110]
 gi|126618214|gb|EAZ88976.1| hypothetical protein CY0110_11032 [Cyanothece sp. CCY0110]
          Length = 363

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/295 (16%), Positives = 99/295 (33%), Gaps = 30/295 (10%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A ISD H++ S +    S +  +  V+                ++N +   N+D + 
Sbjct: 3   FRFAIISDPHIAVSHTIQHHSSRFHLVEVSIL----------ALEKVLNHLEQVNLDFLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           + GD+               LRS+  P  + +VPGNHD  +    E  +   +     + 
Sbjct: 53  LPGDLTQDGETDNHNWLVKRLRSL--PFPVFVVPGNHDVPLIDPTENKIGLHQFPSYYNH 110

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                ++L+    I   + +IG ++          GY  ++Q     KLL +   +    
Sbjct: 111 FGYENQQLYYTQEILPGVRIIGLNSNHFDEEGRQLGYLDEQQLTWLEKLLPQVKDQLLLV 170

Query: 190 IIMMHHPPVLDTSSLY-----NRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +I  +    L   + +       +        ++      LI  GH H+  + + +    
Sbjct: 171 MIHHNVIEHLPGQNDHILGKRYMLKNASSLLNLLMSADCKLIFTGHLHVQDIAYHQG--- 227

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY---WTLEGKRYTLSPDSLSIQ 296
            I  +   S     H       Y +  +++         +   R    P   +++
Sbjct: 228 -IYEITTGSLVSYPHP------YRIIEVKRPPHGSLTLNVTSHRVKSVPGWENLE 275


>gi|20090538|ref|NP_616613.1| 3',5'-cyclic-nucleotide phosphodiesterase [Methanosarcina
           acetivorans C2A]
 gi|19915566|gb|AAM05093.1| 3',5'-cyclic-nucleotide phosphodiesterase [Methanosarcina
           acetivorans C2A]
          Length = 244

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 55/278 (19%), Positives = 96/278 (34%), Gaps = 53/278 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           + H+SDIH S                       + YF  E+A  ++  I   + D V IT
Sbjct: 3   IVHLSDIHFS-----------------------EAYFVPEIAESMLQKINQLDPDIVVIT 39

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+     + E      ++  I     + +VPGNHD+  +G                   
Sbjct: 40  GDLTENGFSAEYDGVKEFIDKIECKDKV-LVPGNHDSKNAGYLHF--------------E 84

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
              +  FP  R   N+ ++G  ++    P    G+ G+E      +     N    F++ 
Sbjct: 85  DLFENRFPT-RNLGNVTVVGADSS---QPDLDEGHLGRENYGWIKEAFSGEN----FKVF 136

Query: 192 MMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            +HH   P+         +        ++     +L+L GH H+  +  + N    + VV
Sbjct: 137 ALHHHLVPIPLAGRENTVLVDAGDVLDLLNRCKVNLVLCGHCHIPHVWNLNN----MLVV 192

Query: 250 GIASASQKVHSNKPQASYNLFYIE-KKNEYWTLEGKRY 286
              +        K    +NL   E  +N  W +   R 
Sbjct: 193 NAGTFCSSKTRGKTTQCFNLIQAENGENNNWNVRVSRV 230


>gi|307942373|ref|ZP_07657724.1| phosphohydrolase [Roseibium sp. TrichSKD4]
 gi|307774659|gb|EFO33869.1| phosphohydrolase [Roseibium sp. TrichSKD4]
          Length = 306

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 49/286 (17%), Positives = 91/286 (31%), Gaps = 40/286 (13%)

Query: 2   TKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL 61
            KR    M ++A ISD+HL    +                   +   +   A   +  + 
Sbjct: 25  DKRDCPFMTLIAQISDLHLRPRGATC----------------FRVSDTNMFAERAVLALK 68

Query: 62  LHN--VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
                 D V +TGD+ +    RE   +   L  +  P  + +VPGNHD  ++ A+    +
Sbjct: 69  NLPQMPDAVVVTGDLTDGNDPREYDLAREILSRL--PMPVYVVPGNHDGTLAMAQAFKDY 126

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
                       +  K    Y      + L+   ++I   P+   G  G++Q       L
Sbjct: 127 PGIR-------AADQKPKLSYTAQIGELQLVALDSSIPGKPY---GQIGEDQLLWLEAAL 176

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSL 236
              +      +I +HHPP+       + +          ++        I+ GH H    
Sbjct: 177 ---SANTAPTLIAVHHPPIQTGMHFMDTIGLKDADALGNVVQRHSHVKRIMCGHAHRAVT 233

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
                      V    S +     +  + +   F +E    Y  + 
Sbjct: 234 AEFAG----TVVTLAPSTAHNSALDFSKDAPAHFRLEPAQYYIHVT 275


>gi|290474838|ref|YP_003467718.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Xenorhabdus
           bovienii SS-2004]
 gi|289174151|emb|CBJ80938.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Xenorhabdus
           bovienii SS-2004]
          Length = 279

 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/304 (15%), Positives = 85/304 (27%), Gaps = 50/304 (16%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
                 +  I+D HL  S     L                      V + ++      ++
Sbjct: 11  EGATARILQITDTHLFASKGDSLLGINTYRSY------------HAVLDAILEQ--SIDI 56

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D +  TGD+V              +  +  P     +PGNHD   +              
Sbjct: 57  DLIVATGDLVQDQTIGAYQNFAEGIARL--PAPCVWLPGNHDYQPAMV------------ 102

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D   + G      + I  +  L+   + +   P    G     Q     K L K N +
Sbjct: 103 --DVLAAAGISPSKQVLIGQHWQLVMLDSQVQGVPH---GELTDYQLEWLQKCLDKHNDR 157

Query: 186 GFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIW-HEGADLILHGHTHLNSLHWIKNE 242
               I+M+HH PV    +  ++          + +        IL GH H          
Sbjct: 158 NT--IVMLHHHPVPSGCTWLDQHSLRNAPALAESLKDKLQVKAILCGHIHQELDRMWNG- 214

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS---LSIQKDY 299
              I V+   S   +   +        F ++     W         + ++     + +  
Sbjct: 215 ---IRVMATPSTCMQFKPHCTN-----FMLDTVAPGWRYLELSVADNREAKLQTQVHRLK 266

Query: 300 SDIF 303
           S+ F
Sbjct: 267 SNEF 270


>gi|84683430|ref|ZP_01011333.1| possible phospodiesterase [Maritimibacter alkaliphilus HTCC2654]
 gi|84668173|gb|EAQ14640.1| possible phospodiesterase [Rhodobacterales bacterium HTCC2654]
          Length = 278

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 51/296 (17%), Positives = 87/296 (29%), Gaps = 41/296 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H   +                           E+   L + I   + D V
Sbjct: 1   MSRLVHLSDLHFGRA-------------------------RPELLAPLSDAINAAHPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+     +RE   +  +L  +G       VPGNHD  +    ++ L  ++ Y  + 
Sbjct: 36  VVSGDLTQRARSREFAAAREFLDGLGA--RWLAVPGNHDIPLYQPWDRFLKPFRKYRENI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                            +  + G +T             G          L        F
Sbjct: 94  ALDLEP------CHEGEDYLVAGLNTVDRFAGQRGRARAGA---IRRVCSLFDGGPDDRF 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI-P 247
            I+M HHP   D +S    M   +   + +   G  ++L GH H+            + P
Sbjct: 145 NILMAHHPFEQDHASHKTPMKRAEPMLERLKACGTHVVLSGHLHMWHTGPFLTRPGHVGP 204

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           +   A  S           + L  +        L   R  +  D     +     F
Sbjct: 205 IQVHAGTSLSSRLRGEVNDFALLDMTGD----RLTVTRMAVEADGTDFTERTQARF 256


>gi|313679720|ref|YP_004057459.1| metallophosphoesterase [Oceanithermus profundus DSM 14977]
 gi|313152435|gb|ADR36286.1| metallophosphoesterase [Oceanithermus profundus DSM 14977]
          Length = 247

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/273 (17%), Positives = 89/273 (32%), Gaps = 48/273 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISDIH+                         KYF  ++   L++++     D +
Sbjct: 1   MTRLYHISDIHV-----------------------ASKYFQPQLMEQLVDEVNRERPDLL 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+ +     E   +  W      P    + PGNHD+   G           Y    
Sbjct: 38  VISGDLTDRGLAYEYEEAARWTGRFEVPM--LVTPGNHDSRNVGYVHFEELYGSRYR--- 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +     + ++   ++    P    G  G+       + L  A +    
Sbjct: 93  ------------VVRLPGVHIVAADSS---EPDLDEGRIGRSIYPWLHEALDSAAEGDLK 137

Query: 189 RIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
             +  HH  PV       N +       K++   G +L+L+GH H+  +   +     + 
Sbjct: 138 VFVTHHHLLPVPGAGRERNILQDAGDLLKVLVDHGVELVLNGHKHVPWVWRFE----EML 193

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
           +V   +A+      K + S+ +  +  +     
Sbjct: 194 IVNAGTATTNRLRGKGRPSFAIIDLTDEAITVR 226


>gi|33151917|ref|NP_873270.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           ducreyi 35000HP]
 gi|33148138|gb|AAP95659.1| 3-prime,5-prime cyclic nucleotide phosphodiesterase [Haemophilus
           ducreyi 35000HP]
          Length = 275

 Score =  114 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 87/300 (29%), Gaps = 47/300 (15%)

Query: 7   TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV- 65
             +  L  I+D HL  S S   L                   + E    +I  I   +  
Sbjct: 11  EPVIRLLQITDCHLFSSESECLLG----------------INTTETFQAVIEHIHQTDFA 54

Query: 66  -DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            D V  TGD++               +    P  +  + GNHD              +  
Sbjct: 55  YDAVLATGDLIQDHNPEAYHRFAEMAKQFVKP--LFWLEGNHDK-------------QPQ 99

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
           ++         +    L       ++  ++ +A  P   +GY    Q    +  L K   
Sbjct: 100 MSLYLGKHPHIQPEKQLLAGEKWQILLLNSQVAGAP---SGYLSAGQLAWLNSKLAKHLD 156

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
           +    ++  +  P        + +   ++  K++        ILHGH H       +   
Sbjct: 157 RYALVVLHHNILPTNSAWLDQHCLKNSEQLAKVLKSYRNVKAILHGHIHQEVDRVWQG-- 214

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
               V+   S   +   N        F ++   + W  E           ++++  S+ F
Sbjct: 215 --YRVLATPSTCIQFKPNCRD-----FTLDMLPQGWR-EISLLEDGSIETTVKRLASNQF 266


>gi|209527369|ref|ZP_03275877.1| metallophosphoesterase [Arthrospira maxima CS-328]
 gi|209492227|gb|EDZ92574.1| metallophosphoesterase [Arthrospira maxima CS-328]
          Length = 360

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 44/304 (14%), Positives = 98/304 (32%), Gaps = 38/304 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A  SD+H++   +             +         S      +   +   ++D + 
Sbjct: 5   FRFAIASDLHIALPETI----------WDHPQRFHLVEVSIPALEQVFKHLEKLDIDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI-SGAKEKSLHAWKDYITSD 128
           + GD+            +  L+++  P+   +VPGNHD  +  G       +        
Sbjct: 55  LPGDLTQHGERDNHAWLSDRLKNL--PYPAYVVPGNHDVPLAVGEGSLIGLSEFPEYYPH 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                   L+    + + + LIG ++       +  GY  ++Q      +L  A      
Sbjct: 113 CGYQDRSCLYYTCELTSGVRLIGINSNWFDEQGNQIGYVDEKQLDWLKGVL--AKSTDEL 170

Query: 189 RIIMMHHPPVLD-------TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+HH  +                +    +  +++   G  L+  GH H+  +   + 
Sbjct: 171 VLVMIHHNIIEHLPGQSTNPLGRRYMLSNAPQLLEVLEEGGVKLVFTGHLHVQDIAQWRG 230

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT-LEGKRYTLS-----PDSLSI 295
                  +   S     H       Y +    + ++    LE + + +      PD  SI
Sbjct: 231 VYD----ITTGSLVSYPHP------YRILDFSRDDQGQQKLEIESHRIVSVPDFPDLASI 280

Query: 296 QKDY 299
            +++
Sbjct: 281 SREW 284


>gi|32476883|ref|NP_869877.1| 3,5-cyclic-nucleotide phosphodiesterase cpdA-like protein
           [Rhodopirellula baltica SH 1]
 gi|32447431|emb|CAD79020.1| 3,5-cyclic-nucleotide phosphodiesterase cpdA homolog
           [Rhodopirellula baltica SH 1]
          Length = 304

 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/311 (11%), Positives = 80/311 (25%), Gaps = 51/311 (16%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISD+H                                    L+      + D V 
Sbjct: 1   MKILHISDVHFGPPYLPNVG------------------------EALLRTAPSIDPDVVV 36

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ++GD+      ++   +  +++ + +     ++PGNHD  +    E+     + Y     
Sbjct: 37  VSGDLTQRAKPQQFQQAAEFIKQLPD-VPRIVIPGNHDVPLYRIMERLTDPHRYYRQYI- 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                      +    +   +G  +        +NG     Q                  
Sbjct: 95  -----SNELNTVLQTPDALFVGLDSTAP-RSAISNGRIHPSQLDFCRDAFGSVPDGLAKI 148

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNS------LHWIKNEK 243
           ++  HH            M   +R   +    G +LIL GH H          +      
Sbjct: 149 VVAHHHFAPAPDYLHDQTMPKAKRAINLFVKLGVELILGGHLHRAFIGNTLDFYPGAGRA 208

Query: 244 KLIPVVGIASASQKVHSNK--PQASYNLFYIE-----------KKNEYWTLEGKRYTLSP 290
             I +V   + + +    +   + S+N   +                       R+  + 
Sbjct: 209 HGIVIVQCGTTTSRRGRGREKEKNSFNEIDVTEQTIIVTHHIFDDQTGQFAPLSRHEFAR 268

Query: 291 DSLSIQKDYSD 301
               ++     
Sbjct: 269 GGRRLENASPR 279


>gi|89067405|ref|ZP_01154918.1| possible phospodiesterase [Oceanicola granulosus HTCC2516]
 gi|89046974|gb|EAR53028.1| possible phospodiesterase [Oceanicola granulosus HTCC2516]
          Length = 263

 Score =  113 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 52/285 (18%), Positives = 92/285 (32%), Gaps = 43/285 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + H+SD+H     +  E                           L+  +     D V
Sbjct: 1   MSRILHLSDLHFGRDRAELEAP-------------------------LLRSVDKLAPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +I+GD        +   +  +L  IG P     VPGNHD  +     ++   WK Y  + 
Sbjct: 36  AISGDFTQRARVGQFERARRFLEKIGQP--WLAVPGNHDTPLDNLLVRAFAPWKRYREAI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           +                N+ + G +T          G+  +   +        AN +   
Sbjct: 94  SDDLEPN------FENENVVVAGVNTVNPFSW--QRGHISRRTVNRVCAAF--ANIERRV 143

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           RI+M+HHP           M G       +   GAD++L GH H   +   +     +  
Sbjct: 144 RIVMLHHPLQHGPEVDKRLMRGANEALARLEECGADIVLSGHLHNTIVRPFRAAPG-LLF 202

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
           V   ++       +P  ++NL  +        +    Y+   D+ 
Sbjct: 203 VQAGTSLSDRLRGEP-NTFNLLDVAHG----EVAITSYSAGDDAE 242


>gi|310829969|ref|YP_003962326.1| metallophosphoesterase [Eubacterium limosum KIST612]
 gi|308741703|gb|ADO39363.1| metallophosphoesterase [Eubacterium limosum KIST612]
          Length = 285

 Score =  113 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 56/298 (18%), Positives = 99/298 (33%), Gaps = 42/298 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDHV 68
             AH+SD+H+                +        +    EV   +   +      +D V
Sbjct: 5   TFAHLSDLHILKDYG---------NSMFKDMVCHMEKKPCEVLEGIAGWLRGNAGKLDFV 55

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+V+     E       L    +   +  V GNHD                +    
Sbjct: 56  LLTGDLVHEGGADEYRYLKMLLEEYFDGTPVCPVLGNHD------------RVAAFHEGY 103

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                  +   Y R  + + LI   +++       +G F + Q     K L K   +G  
Sbjct: 104 ENREPDTEPVCYAREFDGLQLIVLDSSVGCDATHHSGRFDEAQFVFLEKALEKKMPRG-- 161

Query: 189 RIIMMHHPPVLDTSSLY---NRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
            I+  HHP   + +        + G +R +++I  +    +L GHTH N           
Sbjct: 162 HIVAFHHPAFDEWADERVSAFGVEGSERLKEIISGKNVLALLSGHTHENINTTFYG---- 217

Query: 246 IPVVGIASASQKVHSNK------PQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
           +P     S +  V  N+      P A +NL  +  +    TL  +  +  P+   I +
Sbjct: 218 VPAYTAESTAFGVALNEKGMYMTPAAGFNLCTVTDR----TLRVETLSYPPNDQPITE 271


>gi|119513455|ref|ZP_01632482.1| Metallophosphoesterase [Nodularia spumigena CCY9414]
 gi|119461887|gb|EAW42897.1| Metallophosphoesterase [Nodularia spumigena CCY9414]
          Length = 265

 Score =  113 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 44/289 (15%), Positives = 86/289 (29%), Gaps = 55/289 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHVS 69
           +A I+D HL  S +   L    I                     +++ +      VD + 
Sbjct: 9   IAQITDTHLFASENHKMLGMPTIQS----------------FQAVVDRLKELKSEVDLLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+      +        L  +  P     +PGNHD  I+     ++           
Sbjct: 53  LTGDLSGDGNPQSYDNLQTLLNPLQIPA--YWLPGNHDCAIAMEDILNMGMVSRRK---- 106

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                        +R     I   +++   P   +G+   +        L+      +  
Sbjct: 107 -----------SFVRGGWNFILLDSSV---PGCLHGHLSGKTLDWLDSELKFLG--NYPT 150

Query: 190 IIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HHPP    S+      +   Q F  ++       L+L GH H       + ++  +
Sbjct: 151 LVALHHPPFPVNSAWLDSTTLKNPQEFFAVLDRHPQVKLVLFGHIHQ----EFQRQRHQV 206

Query: 247 PVVGIASASQKVHSNKPQ-------ASYNLFYIEKKNEYWTLEGKRYTL 288
             +   S   +  S  P          + L  +      W    +R   
Sbjct: 207 EYLSTPSTGLQFRSKSPTLIIDSKYPGFRLLKLYPNG-MWETSVERVPY 254


>gi|92114672|ref|YP_574600.1| metallophosphoesterase [Chromohalobacter salexigens DSM 3043]
 gi|91797762|gb|ABE59901.1| metallophosphoesterase [Chromohalobacter salexigens DSM 3043]
          Length = 244

 Score =  113 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/277 (15%), Positives = 74/277 (26%), Gaps = 55/277 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             L  ISD HL  +P                       +       ++        D V 
Sbjct: 1   MRLVQISDCHLCANPEARSRIG----------------YPLHQLRAVVARARQLRPDIVL 44

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGDI           +     +         + GNHD     A                
Sbjct: 45  VTGDISQDESPAAYRHAYEVFSAFE--CPWFWMTGNHDHPEFMA---------------- 86

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                   F          L+   + +   P  A G  GQ      +  L +        
Sbjct: 87  ----ELHPFHDELDLGEWRLLLLDSRV---PGQAAGELGQGPLQDLAARLEE---DDRPT 136

Query: 190 IIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ MHHPP+   S+  + +     +   + +   G    IL GH H        + +  I
Sbjct: 137 LLAMHHPPLEIGSAWMDALGLADREALWQTLAAYGQVRAILCGHIHQAFAARHASSQGEI 196

Query: 247 PVVGIASASQKV--------HSNKPQASYNLFYIEKK 275
            V G  + + +              +  + +  +E +
Sbjct: 197 AVYGCPATADQFLPRQADFALDEASRPGFRVIDLEGE 233


>gi|295691380|ref|YP_003595073.1| metallophosphoesterase [Caulobacter segnis ATCC 21756]
 gi|295433283|gb|ADG12455.1| metallophosphoesterase [Caulobacter segnis ATCC 21756]
          Length = 261

 Score =  113 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 51/280 (18%), Positives = 81/280 (28%), Gaps = 36/280 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             L  ISDIH                             ++E        I     D V 
Sbjct: 1   MKLVQISDIHFGGE-------------------------NQEAVEAATQWIRDAAPDLVV 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           + GD+       E   +  WL  +  P  + +VPGNHD    G  E      + +     
Sbjct: 36  VAGDLTLDGKATEFDAAAAWLERL--PDPMLVVPGNHDTPFVGPGELWTRFTRPWRRFSE 93

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATP--PFSANGYFGQEQAHATSKLLRKANKKGF 187
                            I +   +TA A       + G   + Q       L  A  +  
Sbjct: 94  RFGLEDGAEW---RGPGITVTSINTARAAQLRWNWSKGAVSRRQIRRVCDRLAAAPSEDL 150

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
             ++  H    +    +  R+ G         H   DL+L GH HL  +  +        
Sbjct: 151 KVVVCHHPLMEVLGGPMTARVRGGVDAANRFAHASVDLVLSGHIHLPFVTTVPFGDGKTQ 210

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
           +VG  + S +     P   +NL  I+  +    +    Y 
Sbjct: 211 LVGSGTLSLRERGAAP--GFNL--IDADSGCVRVTALAYE 246


>gi|254411986|ref|ZP_05025761.1| Ser/Thr protein phosphatase family protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196180952|gb|EDX75941.1| Ser/Thr protein phosphatase family protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 368

 Score =  113 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 44/278 (15%), Positives = 89/278 (32%), Gaps = 32/278 (11%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
             A ISD+H++   + +++                   S     L+ N +   ++D + +
Sbjct: 6   RFAVISDLHIALPQTIWDIP----------TRFHLVEISIPALELVFNHLERLDLDFLLL 55

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH-AWKDYITSDT 129
            GD+     +         L  +  P+ + +VPGNHD       E+S+      +     
Sbjct: 56  PGDLTQHGESTNHDWLQRRLSQL--PYPVYVVPGNHDVPTLLPNERSIGLKDFPHYYRQF 113

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +L+   +I   + LIG ++          G     Q      +L +   K    
Sbjct: 114 GYDNPDQLYYTRKIFPGVQLIGLNSNQFDQTGKQRGCLDAPQLAWLEDVLAQTKDK--LI 171

Query: 190 IIMMHHPPVLDTSS-------LYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
           ++M+HH  +                +        ++   G +LI  GH H+  + + +  
Sbjct: 172 VVMVHHNVIEHLPDQAKHPLGRRYMLDNAPTLLNLLKAAGVNLIFTGHLHVQDIAYHQG- 230

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
              I  +   S     H       Y +  +   N    
Sbjct: 231 ---IYDITTGSLVSYPHP------YRVLELRTDNLGNR 259


>gi|103487725|ref|YP_617286.1| metallophosphoesterase [Sphingopyxis alaskensis RB2256]
 gi|98977802|gb|ABF53953.1| metallophosphoesterase [Sphingopyxis alaskensis RB2256]
          Length = 282

 Score =  113 bits (281), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 47/285 (16%), Positives = 88/285 (30%), Gaps = 39/285 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISD+H                                  +   + +     D V
Sbjct: 1   MTRLFHISDLHFGLE-------------------------DPAALDWFTDCVRAERPDAV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD+       E   +  W+ ++  P  +++  GNHD        +  H ++      
Sbjct: 36  LITGDLTMRARAHEFAAACDWIETLDVP--VTVEVGNHDLPYFNPVARFFHPYRRIRR-- 91

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKG 186
                 ++L         +A++   T          + G+   +    T   +      G
Sbjct: 92  -----IERLVEREIDLPGLAIVSLKTTARAQWRLDWSKGWVTDKALARTLAAIDALPP-G 145

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
              ++  HHP V   +       G +R    +   G   +L GH H       +     I
Sbjct: 146 AMPLVTAHHPLVEAGTKGRALTRGGERALAALAKRGVAAVLTGHVHDAFDLVKQTAGGPI 205

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
            ++G  + SQ++ S     S+N   +  +     +       +PD
Sbjct: 206 RMIGAGTLSQRIRST--PPSFNDLLVRGRALSVRVRNLADVPTPD 248


>gi|282895913|ref|ZP_06303953.1| Metallophosphoesterase [Raphidiopsis brookii D9]
 gi|281199158|gb|EFA74027.1| Metallophosphoesterase [Raphidiopsis brookii D9]
          Length = 367

 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/274 (15%), Positives = 82/274 (29%), Gaps = 32/274 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H++   +             +         S      ++  +   ++D + 
Sbjct: 3   FRFAIVSDLHIALPHTI----------WDHPDRFHLVEVSIPALESVLEHLTQLDLDFLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSL-HAWKDYITSD 128
           + GD+            T+ L  +  P    +VPGNHD  +     +S+      Y    
Sbjct: 53  LPGDLTQHGEPENHAWLTNRLSQL--PFPSYVVPGNHDVPVLLTNHQSIGFIEFPYYYHK 110

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                    +   +I   + LIG ++          G    +Q       L  A  K   
Sbjct: 111 FGYDHPDHCYYNRQILPGVRLIGLNSNTFDHHGKQIGVLDPKQFQWLESEL--AKIKDEL 168

Query: 189 RIIMMHHPPVL-------DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+HH  V           +    +   +    ++   G  L+  GH H+  +     
Sbjct: 169 VLVMIHHNVVEHLPNQATHPMANRYMLENARELVDLLGRHGVKLVFTGHLHVQDVAQFNG 228

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKK 275
                  +   S     H       Y +   E+ 
Sbjct: 229 VYD----ITTGSLVSYPHP------YRVLEYERD 252


>gi|304413730|ref|ZP_07395174.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Candidatus
           Regiella insecticola LSR1]
 gi|304283821|gb|EFL92215.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Candidatus
           Regiella insecticola LSR1]
          Length = 283

 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 84/303 (27%), Gaps = 53/303 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  ++D HL        L                      V   +         D +  
Sbjct: 23  RILQLTDTHLFADKKKTLLGINTADSYS------------AVLEAI--ATQKQRFDLIIT 68

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD     A              D  
Sbjct: 69  TGDLAQEPAITSYQYFARGMAEL-LPTPCVWLPGNHDNQKIMA--------------DVL 113

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      + I +N  ++   + ++  P+   G+    Q     + L+       + +
Sbjct: 114 FDEGITATKQVTISDNWQILLLDSQVSEQPY---GHLSDHQLLWMEQCLQMFP--QHYTL 168

Query: 191 IMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           + +HHPP+         N +       +++        +L GH H         +     
Sbjct: 169 VALHHPPLACGCRWLDQNNLRNASMLAEIVLRYPRVTTLLCGHIHQEIDLNWCGK----R 224

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLS---IQKDYSDIFY 304
           ++   S   +   +        F ++     W        L PD      +++  + +FY
Sbjct: 225 LLATPSTCIQFKPDH-----ATFTLDNAAPGWRC----INLQPDGTVKTQVKRLANGLFY 275

Query: 305 DTL 307
             +
Sbjct: 276 PDI 278


>gi|119484457|ref|ZP_01619074.1| hypothetical protein L8106_02027 [Lyngbya sp. PCC 8106]
 gi|119457931|gb|EAW39054.1| hypothetical protein L8106_02027 [Lyngbya sp. PCC 8106]
          Length = 361

 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/305 (15%), Positives = 102/305 (33%), Gaps = 38/305 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H++ S +             +         S     L++  +   ++D + 
Sbjct: 5   FRFAIVSDLHIALSHTI----------WDHPTRFHLVEASIPALELVLEHLAESDLDFLL 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI-SGAKEKSLHAWKDYITSD 128
           + GD+            +  L  +  P+ + +VPGNHD  +  G  + +  +        
Sbjct: 55  LPGDLTQDGEIDNHVWLSKRLAKL--PYPVYVVPGNHDVPLAVGNDKVTGLSDFPRYYHQ 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                  +L+    I   + LIG ++ I        GY  Q+Q      +L     +   
Sbjct: 113 FGYENIDQLYYTHEILPGVRLIGLNSNIFDQTGRQIGYLDQQQLDWLQAVLATTEDE--L 170

Query: 189 RIIMMHHPPVLD-------TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+HH  +                +    +  +++      L+  GH H+  +   +N
Sbjct: 171 VMVMLHHNVIEHLPGQATNPLGRRYMLKNAPQLLEILDQADVKLVFTGHLHVQDIAQWQN 230

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY-WTLEGKRYTLS-----PDSLSI 295
               I  +   S     H       Y +     +++    L+ + + ++     PD    
Sbjct: 231 ----IYEITTGSLVSYPHP------YRIVNFRTESDGKQQLQIESHRITSVAGWPDLTEQ 280

Query: 296 QKDYS 300
            ++  
Sbjct: 281 SRERI 285


>gi|188532589|ref|YP_001906386.1| Putative Icc protein [Erwinia tasmaniensis Et1/99]
 gi|188027631|emb|CAO95481.1| Putative Icc protein [Erwinia tasmaniensis Et1/99]
          Length = 275

 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 37/298 (12%), Positives = 83/298 (27%), Gaps = 52/298 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHV 68
            +  I+D HL        L                   +    + +++ I   +   D +
Sbjct: 16  RILQITDTHLFSGKHETLLG----------------VNTWASFDAVLDAIAAEHAHYDLI 59

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+               +  +  P     +PGNHD   +  +     +  D     
Sbjct: 60  VATGDLAQDHSMEAYQHFAEGISRL--PAPCVWLPGNHDYQPTMFRTLGASSIADQKQ-- 115

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       + + +   ++   + +   P    G     Q     + +  A +    
Sbjct: 116 ------------VLLGDRWQVVLLDSQVYGVPH---GELSDYQLEWLERAM--AAEPQRH 158

Query: 189 RIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
            +I++HH P+    S  ++           ++     A  +L GH H       +     
Sbjct: 159 TLILLHHHPLPSGCSWLDQHSLRNPHMLDAVLQRYPLAKTLLCGHIHQELDLNWQGR--- 215

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             V+   S   +   +        F I+ +   W               +++  + +F
Sbjct: 216 -RVLATPSTCVQFKPHCTN-----FTIDAEAPGWRC-LDLQEDGRLETEVRRLNTRMF 266


>gi|87201333|ref|YP_498590.1| metallophosphoesterase [Novosphingobium aromaticivorans DSM 12444]
 gi|87137014|gb|ABD27756.1| metallophosphoesterase [Novosphingobium aromaticivorans DSM 12444]
          Length = 282

 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 51/283 (18%), Positives = 92/283 (32%), Gaps = 39/283 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISDIH                              +   + +   I     D V
Sbjct: 1   MTRLFHISDIHFGLE-------------------------DRRALDWVAQCIAREKPDAV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +ITGD+     +RE   +  W+R++  P  +++  GNHD       E+ +  ++ +    
Sbjct: 36  AITGDLTMRARHREFAAACQWIRALDVP--VTVEVGNHDLPYFNLVERFVDPYRRFR--- 90

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKG 186
               + + L         +A++   T          + G  G      T   +  A  +G
Sbjct: 91  ----SIEALVEREIDLPGVAIVPLKTTARAQWRLNWSKGVVGNAALAHTLCAI-DALPEG 145

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
              I+  HHP V   +       G  R    +       ++ GH H             +
Sbjct: 146 TRAIVACHHPLVEAGTRGKALTRGGSRALAELARRDVIAVISGHVHDAFDLIHPTPNGPV 205

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
            ++G  + SQ+V S     S+N   +E       +    +  +
Sbjct: 206 RMIGAGTLSQRVRST--PPSFNELTLEDGRITVRVRNLEHVPT 246


>gi|251795905|ref|YP_003010636.1| metallophosphoesterase [Paenibacillus sp. JDR-2]
 gi|247543531|gb|ACT00550.1| metallophosphoesterase [Paenibacillus sp. JDR-2]
          Length = 276

 Score =  112 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 42/268 (15%), Positives = 78/268 (29%), Gaps = 42/268 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDHVS 69
            AH++D H++                                  +  +I  L      + 
Sbjct: 6   FAHLTDTHVNVPGKT----------------PLFSIDGGAKLRAVFAEIGRLSEKPAFIV 49

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGN--PHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           I+GD+       +       +          + +  GNHD+               +   
Sbjct: 50  ISGDLTQDGDVEDYKFLRQLIDEEQAALGIPVYVALGNHDSRPF------------FREG 97

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  ++ + Y  +   + +I  +T +   P   +G   + Q    S  L      G 
Sbjct: 98  YLNEEPSEESYHYSFMHEELRIIMLNTQV---PGKHDGRLDEAQLDWLSNELASTAPAGT 154

Query: 188 FRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNS---LHWIKNE 242
             I+++HHP V   S L +       +    +I       +L GH H NS      I + 
Sbjct: 155 --IVVLHHPVVATPSELMDSHLLENPEALADVIAGTDVIGLLSGHIHFNSIGLFRNIPSA 212

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLF 270
                  G+   S+        + YNL 
Sbjct: 213 AGTGVAFGLDPTSKGSMKFIDNSGYNLV 240


>gi|328950407|ref|YP_004367742.1| metallophosphoesterase [Marinithermus hydrothermalis DSM 14884]
 gi|328450731|gb|AEB11632.1| metallophosphoesterase [Marinithermus hydrothermalis DSM 14884]
          Length = 248

 Score =  112 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 53/273 (19%), Positives = 90/273 (32%), Gaps = 48/273 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M +L HISDIH+                         KYF  E+   LI++I     D V
Sbjct: 1   MPLLYHISDIHV-----------------------ASKYFLPELMERLIDEINTVGPDLV 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+ +     E   +  W   I  P    + PGNHD+   G           Y T  
Sbjct: 38  VLSGDLTDRGLRHEFEEAKAWTDRIQVPM--LVTPGNHDSRNVGYIHFEELYGPRYAT-- 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                        R    + ++   ++    P    G  G+       + L  A      
Sbjct: 94  -------------RRLEGVYVVAADSS---EPDLDEGRIGRTIYPWLEEALSTAEPSEIK 137

Query: 189 RIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
             +  HH  PV       N +       K++     DL+L+GH H+  +   +     + 
Sbjct: 138 VFVTHHHLLPVPGAGRERNILQDAGDLLKILVDHKVDLVLNGHKHVPWVWRFEG----ML 193

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
           +V   +++      + + SY +  I+       
Sbjct: 194 IVNAGTSTTNRVRGRGRPSYTVIEIDGGEITVR 226


>gi|298293393|ref|YP_003695332.1| metallophosphoesterase [Starkeya novella DSM 506]
 gi|296929904|gb|ADH90713.1| metallophosphoesterase [Starkeya novella DSM 506]
          Length = 270

 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 46/289 (15%), Positives = 82/289 (28%), Gaps = 51/289 (17%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + H+SD+H                              + +A  L  ++     D V 
Sbjct: 1   MRIVHLSDLHFG-------------------------RHDERLAEGLAEEVTRQAPDLVV 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ++GD        E  ++  ++  +  P  +  VPGNHD        + +  ++ Y     
Sbjct: 36  VSGDFTQVGSVAEFMSARRFIDQLAAP--VFAVPGNHDVPAWNLPLRLVDPYRRYRRHIH 93

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAI--ATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                            IAL G  T+         ++G     Q       L     K  
Sbjct: 94  PEPEP------FLNLEGIALAGIKTSRRLRAGLDWSHGSISHGQLERLEARLSGV-HKDK 146

Query: 188 FRIIMMHHP---PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
            RI++ HHP   P    +     +    R           L+L GH H++ +      + 
Sbjct: 147 LRIVVAHHPLMQPETPMARPMRLVDRADRALATFARLDVRLVLSGHFHMSYVRHHHRVEG 206

Query: 245 -----------LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
                       + VV   S       +  +  YN+  I        + 
Sbjct: 207 ERTGPVHAAVAPLLVVQAGSTISTRLRD-HRNGYNVIDISDGKIAVAVR 254


>gi|68249002|ref|YP_248114.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           influenzae 86-028NP]
 gi|68057201|gb|AAX87454.1| predicted phosphohydrolase [Haemophilus influenzae 86-028NP]
          Length = 274

 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 85/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-- 63
              +  L  I+D HL    S   L                   ++     ++ +I     
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  QFDVILATGDLVQDSSDEGYIRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                           +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NAAKHLLLGEHWQALLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFSNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + Y+       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELYSDGSIRTEVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|220909228|ref|YP_002484539.1| metallophosphoesterase [Cyanothece sp. PCC 7425]
 gi|219865839|gb|ACL46178.1| metallophosphoesterase [Cyanothece sp. PCC 7425]
          Length = 266

 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 36/290 (12%), Positives = 81/290 (27%), Gaps = 55/290 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +  +SD HL                            + +    +++ +       D + 
Sbjct: 10  IVQLSDTHLFAD----------------LQGQLVGLNTADALKAVLDQVAQLSPRPDLLL 53

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+      +       WL  +  P  +  +PGNHD   + A                
Sbjct: 54  LTGDLSQDESVQSYTHLRDWLAPLDIP--VHWLPGNHDNLQAMA---------------Q 96

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                    P          +  ++ +    +   G    +        L+    +    
Sbjct: 97  VLLPPLYSGPSTFYLGGWQFLLLNSQVPGKVY---GELSPDTLLWLENNLQAHPDRPS-- 151

Query: 190 IIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           +I +HHPP+  ++     +R+   +   ++I       L+  GH H         E++ +
Sbjct: 152 LIALHHPPLSISTPWLDSSRLRNPEPLLELIDRHPQVKLVSFGHIHQ----EFAAERRGV 207

Query: 247 PVVGIASASQKVHS-------NKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
             +   S   +          +     +    +    + +  E  R   S
Sbjct: 208 IYLSSPSTCVQFLPCSSQFAIDPMPPGFRRLMLYPDGQ-FHTEVMRVEFS 256


>gi|257422573|ref|ZP_05599563.1| predicted protein [Enterococcus faecalis X98]
 gi|257164397|gb|EEU94357.1| predicted protein [Enterococcus faecalis X98]
 gi|315155715|gb|EFT99731.1| Ser/Thr protein phosphatase family protein [Enterococcus faecalis
           TX0043]
          Length = 272

 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 92/272 (33%), Gaps = 38/272 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-VDHVSI 70
           + H+SDIH   +    +   K ++         K           +  +L    +D V I
Sbjct: 3   ILHLSDIHFRRNYEKAKDGYKGMLT--------KMENPLIRLESSLTSLLKIKKIDLVII 54

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+       +       L++I     + +  GNHD              K++      
Sbjct: 55  SGDLTEDGEPEDYAFLKQKLQTILQGIPMIVTLGNHDI------------KKNFRIGWLN 102

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               ++ +  ++      +I    +    P   +G+  +EQ       L+K + K    I
Sbjct: 103 QIGSEQPYNVVQTYPEFHIISLDNSEYDNP---DGHMNKEQKDWLQITLKKLSDKP---I 156

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           +++ H  +L   S    +   +   +++       IL GHTH   LH I      IP   
Sbjct: 157 LLVMHHHLLREQSSMPTLPEAEEIIQLLKDFDILGILTGHTHHPYLHHING----IPYYT 212

Query: 251 IASASQKVHSNKP-------QASYNLFYIEKK 275
           +A  S                  YNL+ I+K 
Sbjct: 213 VAGMSFVGEDEGQGIVRFEENYGYNLYSIDKG 244


>gi|220906877|ref|YP_002482188.1| metallophosphoesterase [Cyanothece sp. PCC 7425]
 gi|219863488|gb|ACL43827.1| metallophosphoesterase [Cyanothece sp. PCC 7425]
          Length = 361

 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 44/294 (14%), Positives = 84/294 (28%), Gaps = 31/294 (10%)

Query: 8   IMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67
           + F    +SD H+  + +  +                    S      ++  +    VD 
Sbjct: 3   LQFRFGVLSDPHIGLAQTIRDQKN----------RFHLVEVSIPALEQVLQQMTAAEVDF 52

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI-SGAKEKSLHAWKDYIT 126
           + I GD+            +  L  +  P    ++PGNHD  +          +      
Sbjct: 53  LLIPGDLTQHGEPDNHAWLSDRLAQL--PFPAYVIPGNHDVPVPFRDGYSIGWSEFPGYY 110

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    +L+    +   + LI  ++          G    EQ      +L  +  K 
Sbjct: 111 RGYGYGNSDRLYYTCELLPGVRLIALNSNQFDHEGVQIGAVDGEQLRWLETVLADSQAKL 170

Query: 187 FFRIIMMH---HPP--VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
              +I  +   H P   L        +   +   +++   G  L+  GH H+  +     
Sbjct: 171 HLVMIHHNVIEHLPNQTLHPMGQRYMLRQAETLLQILRAGGVKLVFTGHLHVQDIA---- 226

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY---WTLEGKRYTLSPDS 292
           E   I  +   S     H       Y +  I+ +        +E  R    PD 
Sbjct: 227 EAGGIYDITTGSLVSYPHP------YRIVQIQTEPCGQIQVQIESDRVKSLPDW 274


>gi|33863822|ref|NP_895382.1| Serine/threonine specific protein phosphatase [Prochlorococcus
           marinus str. MIT 9313]
 gi|33635405|emb|CAE21730.1| Serine/threonine specific protein phosphatase [Prochlorococcus
           marinus str. MIT 9313]
          Length = 263

 Score =  112 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 49/289 (16%), Positives = 98/289 (33%), Gaps = 46/289 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             L  +SD HL           +R++   N   N             +     H+ D + 
Sbjct: 1   MRLVQLSDPHLVA-------FNQRLVRGQNPLLN---------FQCALQHGASHSPDLLL 44

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+ +           H L+++     ++++PGNHD  +        HA+        
Sbjct: 45  ITGDLCHDETWCGYILLRHELQNLSPSIKVAVLPGNHDNPLFIKAALGRHAF-------- 96

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                    P     + + LI  S+ +   P    G  G+ Q       L    + G   
Sbjct: 97  -------TAPADLNVDGVRLILLSSHV---PGRTAGQLGESQLQWLDARLSDFQQSGRPL 146

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGAD---LILHGHTHLNSLHWIKNEKKLI 246
           ++ +HHPP+   SS  + +  +     +      D    ++ GH H +    +   K  +
Sbjct: 147 VVAVHHPPLPIGSSWLDAIGLVDGEALIKLLTPVDELCAVVCGHIHQHWQGGLPGRKD-V 205

Query: 247 PVVGIASASQKVH-------SNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
            V+G  S               + +    L  ++++  ++  +  R++ 
Sbjct: 206 LVLGCPSTLCSFKAVQPCLLGREDEPGGRLIELDERGNFFE-KLLRWSY 253


>gi|172035705|ref|YP_001802206.1| hypothetical protein cce_0789 [Cyanothece sp. ATCC 51142]
 gi|171697159|gb|ACB50140.1| hypothetical protein cce_0789 [Cyanothece sp. ATCC 51142]
          Length = 365

 Score =  112 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 49/295 (16%), Positives = 93/295 (31%), Gaps = 30/295 (10%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A ISD H++   +    S          H       S      ++N +   N+D + 
Sbjct: 4   FRFAIISDPHVAVPHTIPNHS----------HRFHLVEVSILALEKVLNHLEQLNLDFLL 53

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           + GD+               L+S+  P  + +VPGNHD       E  +   +       
Sbjct: 54  LPGDLTQDGEMDNHEWLAKRLQSL--PFPVFVVPGNHDVPNLNETETKIGLSQFPSYYSH 111

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                ++L+    I   + +IG ++          GY  ++Q     KLL +   +    
Sbjct: 112 CGYESQQLYYTQEILPGVRIIGLNSNHFDEEGRQLGYLDKQQLTWLEKLLPQVKDQLLLV 171

Query: 190 IIMMH---HPPV--LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +I  +   H P            +       K++      LI  GH H+  +   +    
Sbjct: 172 MIHHNIIEHLPEQSNHELGKRYMLDNASLLLKLLRSANCQLIFTGHLHVQDIACHQG--- 228

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY---WTLEGKRYTLSPDSLSIQ 296
            I  +   S     H       Y +  +++         +   R    P   +++
Sbjct: 229 -IYEITTGSLVSYPHP------YRIIEVKRPPNGSLSLNITSHRVKSVPGWENLE 276


>gi|292492919|ref|YP_003528358.1| metallophosphoesterase [Nitrosococcus halophilus Nc4]
 gi|291581514|gb|ADE15971.1| metallophosphoesterase [Nitrosococcus halophilus Nc4]
          Length = 284

 Score =  112 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 49/304 (16%), Positives = 92/304 (30%), Gaps = 52/304 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISD+H                            F  EV   L+  I   + + +
Sbjct: 1   MLNLLHISDLHFGKP------------------------FLPEVGEALLGKIEKLSPELL 36

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+      +E   +  +L  + +   + +VPGNHD  +    E+    ++ Y    
Sbjct: 37  VVSGDLTQRAKAQEFRAARAYLDLMPSIPQV-VVPGNHDIPLYRIFERLFQPYELYRRYI 95

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                  +    +  +N   ++G  +         NG   ++Q    +K   +A  +   
Sbjct: 96  ------SEQRDTVLHQNKAVIVGLDSTNPY-FAITNGRIHRKQLAFCAKAFTEAPAEAVR 148

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH----WIKNEKK 244
            ++  HH            M   +R   +      DLIL GH H   +         E +
Sbjct: 149 IVVAHHHFAPAPDYKGGEVMPKAKRALDLFTQLKVDLILAGHLHRAYVGNSLDVYPGEDR 208

Query: 245 LIPVVGIASASQKVHSNK----PQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
              ++     +            + S+N   I       ++    Y              
Sbjct: 209 EHGIIIAQCGTSTSRRGVAREQEKNSFNWIEILAD----SIRIFHYMY--------FKDY 256

Query: 301 DIFY 304
             FY
Sbjct: 257 RNFY 260


>gi|259417953|ref|ZP_05741872.1| metallophosphoesterase [Silicibacter sp. TrichCH4B]
 gi|259346859|gb|EEW58673.1| metallophosphoesterase [Silicibacter sp. TrichCH4B]
          Length = 267

 Score =  112 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 53/300 (17%), Positives = 92/300 (30%), Gaps = 42/300 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               E+ + LI  I     D V
Sbjct: 1   MKRLLHLSDLHFG-------------------------RDRPELLDPLIEQINGLAPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +I+GD+     + +   +   +  I  P    +VPGNHD  +    E++L  W+ Y    
Sbjct: 36  AISGDLTQRARDWQFMRAREMIDRIKAPC--LVVPGNHDTPLDNLFERALMPWRRYRKWI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           +     +          + +++G ++             G        +       +  +
Sbjct: 94  SCDLEPQIHDV------DWSVVGVNSVNPLGWQRGRFSLGD---IRRVQTCFAQTPEDAY 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           RI++ HHP             G Q  +  +   G D+IL GH H              P 
Sbjct: 145 RIVVAHHPLEHQPGETKRLTRGAQHARAELSRIGTDIILSGHLHSWYADTFAMVPDQTPA 204

Query: 249 V--GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDT 306
           V       S        +  +NL  +++      +   RY    D        +  F  T
Sbjct: 205 VLQIHVGTSLSDRLRGEENDFNLLTLKRS----AVRVDRYACRADRSGYDLSRTVYFSRT 260


>gi|119492931|ref|ZP_01623961.1| 3',5'-cyclic-nucleotide phosphodiesterase [Lyngbya sp. PCC 8106]
 gi|119452857|gb|EAW34031.1| 3',5'-cyclic-nucleotide phosphodiesterase [Lyngbya sp. PCC 8106]
          Length = 276

 Score =  112 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 40/280 (14%), Positives = 81/280 (28%), Gaps = 55/280 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHVS 69
           +  ISD HL                  N         + +    +++ I   N   D + 
Sbjct: 9   VIQISDTHL----------------FANPDQKMMGLTTADSLIAVLDRIRQLNINPDVLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+     ++        ++          +PGNHD                   +++
Sbjct: 53  ITGDLSQDETSKSYQQLQALIQPFNTST--YWIPGNHDDLSV---------------AES 95

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                          +N   I  ++          G    E  +     L++  ++    
Sbjct: 96  ILKKTPISIKKAFNISNWKFILLNSQCPGKVH---GELTPESLNDLDSQLQQHPEQPT-- 150

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLI 246
           +I +HHPPVL  S   +++     +    +I       L++ GH H       +  +  +
Sbjct: 151 LIALHHPPVLIGSEWMDKIKLRNSEDLFAVIDRYSQVKLVIFGHIHQ----EFETIRNGV 206

Query: 247 PVVGIASASQKVHSNKPQ--------ASYNLFYIEKKNEY 278
              G  S   +      +          + +  +    EY
Sbjct: 207 VYWGCPSTCVQFKPQSVELTFDQVATPGFRVLTLYSNGEY 246


>gi|20093732|ref|NP_613579.1| phosphohydrolase [Methanopyrus kandleri AV19]
 gi|19886629|gb|AAM01509.1| Predicted phosphohydrolase [Methanopyrus kandleri AV19]
          Length = 290

 Score =  112 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 50/280 (17%), Positives = 99/280 (35%), Gaps = 33/280 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +AH+SD+HL                         +   K V    I  +   + D V 
Sbjct: 3   LRIAHVSDLHLD------------------------ESRDKSVLEAAIERVKELHPDVVV 38

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAY----ISGAKEKSLHAWKDYI 125
           ++GDIV     R    +    R++     +++VP NHD      +   K           
Sbjct: 39  VSGDIVKGWRPRHYGETERIFRALDVGKLLAVVPDNHDEMRGGEVVFRKHPYFRRKYREF 98

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           T  +       ++P +   + + +I   +  A     ++G  G +Q     +L+R+   +
Sbjct: 99  TVKSPSFGELLMYPIILEGDGLCVIALDSTEADR---SDGEVGLDQLLRAEELIREIEPE 155

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
            F  + M HH          + +      ++     G DL+L GH H+  + +  +++  
Sbjct: 156 -FIVLTMHHHVTPFPGLIDVSTVLDAGNLREFCVANGVDLVLVGHKHIPRVDYFASKEGG 214

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKR 285
             V    +   +V    P A +N+  +E+      +   R
Sbjct: 215 CAVSHAGTLCPEVARYVPPA-FNVVDVERGEVVVQVLEYR 253


>gi|212711187|ref|ZP_03319315.1| hypothetical protein PROVALCAL_02259 [Providencia alcalifaciens DSM
           30120]
 gi|212686355|gb|EEB45883.1| hypothetical protein PROVALCAL_02259 [Providencia alcalifaciens DSM
           30120]
          Length = 279

 Score =  112 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/300 (13%), Positives = 84/300 (28%), Gaps = 48/300 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VD 66
           +  +  ++D HL        L                          +++ I   N  VD
Sbjct: 14  VIRILQVTDTHLFADTENTLLGINTYRSY----------------QAVLDAIAEQNLPVD 57

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            +  TGD+V     +        +  I  P     +PGNHD   +               
Sbjct: 58  LIVATGDLVQDQSPKAYQHFAAGIERI--PAPCVWLPGNHDYPPAMVGT----------- 104

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                  G      + I ++  ++   + +      A+G   ++Q     + L +   + 
Sbjct: 105 ---LKIAGISSAKQVFIGDDWQILMLDSQLQD---VAHGELSEQQLEWMQQCLDEQPTRT 158

Query: 187 FFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
              +IM+HH P+    +  ++            + +      +L GH H           
Sbjct: 159 T--LIMLHHHPLPSGCTWLDQHSLRNSHILADYLKNYPNVKAMLCGHIHQEMDENWHG-- 214

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             I ++   S   +   +     + L  +     Y  L             + +  +  F
Sbjct: 215 --IRLLATPSTCVQFKPHCTN--FALDTVAPGWRYLELTVNENGEKVIETQVHRLNTQAF 270


>gi|113460726|ref|YP_718793.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           somnus 129PT]
 gi|170719113|ref|YP_001784262.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           somnus 2336]
 gi|112822769|gb|ABI24858.1| 3',5'-cyclic-nucleotide phosphodiesterase [Haemophilus somnus
           129PT]
 gi|168827242|gb|ACA32613.1| Calcineurin phosphoesterase domain protein [Haemophilus somnus
           2336]
          Length = 276

 Score =  112 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/296 (15%), Positives = 90/296 (30%), Gaps = 46/296 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD--HV 68
            L  I+D HL                    +       + +  N +++++L    D   V
Sbjct: 15  RLIQITDPHL----------------FKEKNGELLGINTYDSFNQVLSEVLQSKFDYELV 58

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+V  +           ++ +     +  +PGNHD         S +    Y    
Sbjct: 59  LATGDLVQDSSEEGYQYFAESVKLLNK--KVFWIPGNHDFQPKMFDVLSQYQEYIY---- 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      ++ +  N  ++   + ++  P    GY GQ Q    S  LR   K+   
Sbjct: 113 --------PTKHVLVGKNWQILMLDSQVSGVPH---GYLGQYQLDWLSAKLRDYPKRHAL 161

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  H           + +       +++        IL+GH H       +  K    
Sbjct: 162 VVLHHHIVSTNSAWLDQHNLRNSLDLMQVLLPFRKVRGILYGHIHQAMDTKWQGYK---- 217

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           ++   S   +   +      N F ++     W  E + Y        +++     F
Sbjct: 218 IMATPSTCIQFKPDS-----NHFSLDTSQPGWR-EIELYDDGRIETRVKRIQQTSF 267


>gi|319775672|ref|YP_004138160.1| phosphohydrolase [Haemophilus influenzae F3047]
 gi|317450263|emb|CBY86479.1| predicted phosphohydrolase [Haemophilus influenzae F3047]
          Length = 274

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/303 (13%), Positives = 87/303 (28%), Gaps = 48/303 (15%)

Query: 4   RYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           +    +  L  I+D HL    S   L                   ++     ++ +I   
Sbjct: 8   QTEKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQE 51

Query: 64  --NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAW 121
               D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +    
Sbjct: 52  NNQFDVILATGDLVQDSSDEGYTRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM 109

Query: 122 KDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
                          +  +L +  +   +   + +   P    G   Q Q     + L K
Sbjct: 110 --------------NVAKHLLLGEHWQALLLDSQVYGVPH---GQLSQHQLDLLKETLEK 152

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIK 240
             ++    ++  H  P        + +       +++        IL+GH H        
Sbjct: 153 NPERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLEPFSNVKAILYGHIHQEVNSEWN 212

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
                  V+   +   +   +        F ++     W  E + Y+       +++   
Sbjct: 213 G----YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELYSDGSIRTEVKRIQQ 262

Query: 301 DIF 303
             F
Sbjct: 263 AEF 265


>gi|167042721|gb|ABZ07441.1| putative calcineurin-like phosphoesterase [uncultured marine
           crenarchaeote HF4000_ANIW133O4]
          Length = 247

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/274 (17%), Positives = 83/274 (30%), Gaps = 53/274 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +  +SDIH+                           F +E    +I++I     D V IT
Sbjct: 3   IVQLSDIHVGSQ------------------------FREETFQKVIDEINSLKPDVVVIT 38

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+ N     +       +  I     I ++ GNHD   +G      +            
Sbjct: 39  GDLTNEGLIEQYEKCKKLISQIDVEKKI-VISGNHDYRNTGYLLFKKYFPIRAENKLGDD 97

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
           +                     T  +  P    G  G  Q     + L+        +I+
Sbjct: 98  TI------------------LVTIGSARPDRDEGEVGHHQNLWLERTLK--KYDDKLKIV 137

Query: 192 MMHHPPV--LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            MHH  +   DT S    +       + I      L+L GH H   +         + + 
Sbjct: 138 AMHHHLISIPDTGSDRLTVIDAGDVLRTILDSNVSLVLCGHKHRPWIWDFN----TLSIA 193

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
              +AS +      + SYN+  +  +N  + ++ 
Sbjct: 194 NAGTASSERVRGFFENSYNIVNV--QNGTFRVDL 225


>gi|332185406|ref|ZP_08387154.1| calcineurin-like phosphoesterase family protein [Sphingomonas sp.
           S17]
 gi|332014384|gb|EGI56441.1| calcineurin-like phosphoesterase family protein [Sphingomonas sp.
           S17]
          Length = 257

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 47/295 (15%), Positives = 83/295 (28%), Gaps = 42/295 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                                        +     D V
Sbjct: 1   MIRLFHVSDVHFGAE-------------------------DPAALAWFAERVAAEKPDAV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+      RE      WL+S+G P  +++  GNHD        +   A      + 
Sbjct: 36  IMTGDLTMRATKREFQAGGEWLQSLGVP--VTVEVGNHDIPYYWDPFRRFFAPYQRYAAV 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSAN--GYFGQEQAHATSKLLRKANKKG 186
                     P       + ++   T            G            L+ +A  K 
Sbjct: 94  ERMIEKPLDLP------GVTVVPLKTTARAQWRWNWSKGRVSSGSLRRALALIAQA-PKD 146

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
              ++  HHP +   +    +          +   GA  +L GH H      I     +I
Sbjct: 147 HLILVAAHHPLIEGGTKGTAKTRNGDEALSQLAAAGAHAVLSGHVHDPFDVPIDRNGWII 206

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
            ++G  + S++    K   ++N   IE +      E         +  +  +   
Sbjct: 207 RMIGAGTLSKRTR--KTPPAFNEIRIEGQGF----ETLVRRFGETAPHVITEDMR 255


>gi|18976460|ref|NP_577817.1| icc related protein [Pyrococcus furiosus DSM 3638]
 gi|18891999|gb|AAL80212.1| icc related protein [Pyrococcus furiosus DSM 3638]
          Length = 501

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 51/294 (17%), Positives = 102/294 (34%), Gaps = 52/294 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   +F                           +L++N+I     D V
Sbjct: 1   ML-IAHISDTHITNEVAFKAY----------------------AFDLIVNEINTRPFDLV 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ N     E   +++ L+ I  P  + + PGNHD         + +   +     
Sbjct: 38  IHTGDVTNNGLREEYEHASYLLKKIEKP--LIVAPGNHD---------ARNVGYELFERY 86

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G      +    +  +I   +   T P  ++G  G  +     + L + + K   
Sbjct: 87  IGPLFG------VYEFKDGVIIWVDS---TIPDLSDGRIGGYKFRWLKEKLEEYSNKKIK 137

Query: 189 RIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
             +  HH  P+ DT    N ++       ++      L + GH H+ +++ ++     + 
Sbjct: 138 IAVAHHHLVPLPDTGRERNVLYNAGDVLDLLLSHDVTLYMCGHKHVPNVYRVE----DLV 193

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
           V      S +        SYN+  I +K     ++     ++ +    +     
Sbjct: 194 VANAGCTSCRKTRKGDVNSYNIVKISEKG----VKVVIRRVTGEEKGKEHVPIR 243



 Score = 80.0 bits (195), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 45/269 (16%), Positives = 84/269 (31%), Gaps = 51/269 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDH 67
           +F + H+S                        + + +KYF K V   ++  I      D 
Sbjct: 254 IFRIVHLS----------------------ESNVSDRKYFRKNVIENVVKAINEKYKPDL 291

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V   GD+V     R    +  +  SI +   +     ++         +           
Sbjct: 292 VIHCGDVVEKGIERFFDMAIDYYESIKSEKLVIPGHNDYTYLGPELFREYF--------- 342

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                      P +   N+   I   +A    P    G  GQ+      +   +      
Sbjct: 343 ---------GEPEIIELNDFVFIPLISAQYETPIGVVGRIGQKMLANLLEEYSE-----K 388

Query: 188 FRIIMMHHPPVLDTSSLYNRM-FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           FR++++HH  V    +             K+I     +L+L GH   +    ++      
Sbjct: 389 FRVVVLHHNLVPIPRAKEIGYLEDAGNVLKIITDANTELVLTGHGGNSHAVKVE----ST 444

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKK 275
           P+V   S S ++H N    S+N+  I + 
Sbjct: 445 PLVNAGSVSWELHRNPFGNSFNIVDIYED 473


>gi|170734930|ref|YP_001774044.1| metallophosphoesterase [Burkholderia cenocepacia MC0-3]
 gi|169820968|gb|ACA95549.1| metallophosphoesterase [Burkholderia cenocepacia MC0-3]
          Length = 266

 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/268 (18%), Positives = 92/268 (34%), Gaps = 46/268 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--D 66
           M V+A +SDIH+      ++                    S  + +  ++ +       D
Sbjct: 1   MTVIAQLSDIHVRPHGVLYQD----------------AVDSNAMFSAAVDSLNRIRPEPD 44

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V I+GD+ +     E       L  +  P    ++PGNHD   +       HAW     
Sbjct: 45  LVVISGDLTDEGTEGEYRKLRELLVELRRP--FVVLPGNHDDRGNLRAAFPDHAWLP--- 99

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                   +    +      + L+   T++   P   +G  G E        L +   + 
Sbjct: 100 -------DEGALSFALDVGELRLVALDTSV---PGLHHGELGAETLAWLDTELAEH--RN 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEK 243
              +I+MHHPP +      +       + F  ++      D IL GH H +    +    
Sbjct: 148 RTVVIVMHHPPFMTGIPYLDIYGLRNAEAFAAVLARHDNVDRILAGHVHRSMQTRL---- 203

Query: 244 KLIPVVGIASA----SQKVHSNKPQASY 267
             +PV+   S     + +V ++   AS+
Sbjct: 204 GRVPVLTCPSTITQIALRVEADAQPASF 231


>gi|16272348|ref|NP_438561.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           influenzae Rd KW20]
 gi|260580538|ref|ZP_05848366.1| lacZ expression regulator [Haemophilus influenzae RdAW]
 gi|1170472|sp|P44685|ICC_HAEIN RecName: Full=Protein icc homolog
 gi|1573370|gb|AAC22058.1| lacZ expression regulator (icc) [Haemophilus influenzae Rd KW20]
 gi|260092880|gb|EEW76815.1| lacZ expression regulator [Haemophilus influenzae RdAW]
          Length = 274

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/302 (13%), Positives = 87/302 (28%), Gaps = 48/302 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN- 64
              +  L  I+D HL    S   L                   ++     ++ +I   N 
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  EFDVILATGDLVQDSSDEGYIRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                           +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NAAKHLLLGEHWQALLLDSQVYGVPH---GQLSQHQLDLLKETLGKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFTNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTEVKRIQQAE 264

Query: 303 FY 304
           F+
Sbjct: 265 FF 266


>gi|260913019|ref|ZP_05919504.1| 3',5'-cyclic-nucleotide phosphodiesterase [Pasteurella dagmatis
           ATCC 43325]
 gi|260633009|gb|EEX51175.1| 3',5'-cyclic-nucleotide phosphodiesterase [Pasteurella dagmatis
           ATCC 43325]
          Length = 264

 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/292 (13%), Positives = 79/292 (27%), Gaps = 46/292 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--D 66
           MF    ++D HL    +   L  K     V                 ++++I   +   D
Sbjct: 1   MFKFIQVTDPHLFREENSELLGVKTYQSFV----------------QVLDEIKEQDFDYD 44

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V  TGD+V    +         ++ +     +  +PGNHD                   
Sbjct: 45  FVLATGDLVQDNSDEGYLLFCEQVKRLDKT--VFWIPGNHDFQPKM------------FA 90

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                        ++ +     ++   + +   P    G   Q Q       L+   ++ 
Sbjct: 91  ILNQNQGNLNAKKHIVLGKYWQILMLDSQVFGVPH---GELSQYQIDWLVSKLKDNPERY 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
              ++  H  P        + +         +        ILHGH H             
Sbjct: 148 TLIVLHHHILPTNSAWLDQHNLRNAHELAYALSPFDKVKGILHGHIHQEVDAEWNG---- 203

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
             V+   +   +   +      N F ++     W  E + Y        +++
Sbjct: 204 YRVMATPATCIQFKPDN-----NTFALDCAQPGWR-EIELYADGRIETRVKR 249


>gi|86741523|ref|YP_481923.1| metallophosphoesterase [Frankia sp. CcI3]
 gi|86568385|gb|ABD12194.1| metallophosphoesterase [Frankia sp. CcI3]
          Length = 287

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 88/300 (29%), Gaps = 48/300 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVS 69
           L  ISD H+                         K  +      +++ I      +  + 
Sbjct: 16  LIQISDTHIVREGELMH----------------GKVDTYAALRTVLDQIEASTLKIGALL 59

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +TGD+ +             +          +    GNHD+               +   
Sbjct: 60  LTGDLADRGDLLAYQRLRDLVEPAAARLGTPVLYGVGNHDSR------------GPFREG 107

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                   +   Y+    ++ +I   T   T P   +G+    Q    +  L  A   G 
Sbjct: 108 LLGAEPTAEAHDYVHWVGDLRIIMLDT---TEPGEHSGFLSTAQLRWLADELATAAPDGT 164

Query: 188 FRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ +HHPPV    ++ N +     Q    ++      ++L GH H  S   +      
Sbjct: 165 --ILALHHPPVPSPLAMVNSLLLAEPQNLADVLAGSDVKIVLAGHAHHASAGVLSG---- 218

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYD 305
           +PV    + + ++ +  P        I             Y     + ++    S++ YD
Sbjct: 219 VPVWVAGATAYRIRTLGPAD-----RITGLVGGEYTRIDVYPEGAVATAVPIATSEVVYD 273


>gi|52425748|ref|YP_088885.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Mannheimia
           succiniciproducens MBEL55E]
 gi|52307800|gb|AAU38300.1| Icc protein [Mannheimia succiniciproducens MBEL55E]
          Length = 277

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/295 (12%), Positives = 83/295 (28%), Gaps = 46/295 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
            + +     I+D HL                            +++    ++ ++  +  
Sbjct: 11  DSDVIRFVQITDPHLFKDE----------------QGELLGVNTQQSLTQVLTELKENQF 54

Query: 66  --DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D V  TGDIV  +           ++ +     +  +PGNHD                
Sbjct: 55  NYDFVLATGDIVQDSSEEAYLRFCKSVQQLDK--MVFWIPGNHDFQPKM----------- 101

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                           +L + +   ++   + +   P    G  GQ Q       L+   
Sbjct: 102 -FDILVQEHGNLSPKKHLLLGDKWQILMLDSQVFGVPH---GQLGQYQLEWLDSKLKDNP 157

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
            +    ++  H  P   +    + +       +++        IL+GH H          
Sbjct: 158 DRYSLVVLHHHILPTHSSWLDQHNLRNAHELAQVLAQYDNVRGILYGHIHQAM----DGT 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
            K   ++   S   +   +      N+F ++     W  E + ++       + +
Sbjct: 214 WKDYQIMATPSTCIQFKPDS-----NVFALDTLQPGWR-EVELHSDGSIITRVNR 262


>gi|158336836|ref|YP_001518010.1| 3',5'-cyclic-nucleotide phosphodiesterase [Acaryochloris marina
           MBIC11017]
 gi|158307077|gb|ABW28694.1| 3',5'-cyclic-nucleotide phosphodiesterase [Acaryochloris marina
           MBIC11017]
          Length = 265

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/277 (12%), Positives = 83/277 (29%), Gaps = 54/277 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHVS 69
           +A +SD+HL  +P    L                          ++  +       D + 
Sbjct: 9   IAQLSDLHLFANPDRDLLGLNTFSS----------------LEAVVQKLKQLPVLPDQLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+               +  +  P     +PGNHD   +     +  +++ + +   
Sbjct: 53  LTGDLAQDETPIAYQQIQSLIAPLQIPT--YWLPGNHDHLPTMQATFTAPSFQAHKSYQM 110

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                           +   +   +++    +   G    E     ++ L +        
Sbjct: 111 ---------------GDWHFLLLDSSVTGKVY---GGLSPESLDWLNQELEQC--DPQPT 150

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLI 246
           +I +HHPP    S   +++          ++       L++ GH H       +++++ I
Sbjct: 151 LIALHHPPFAIKSDWLDQIGLQNSDDLFAILDRHSHVKLVVFGHIHQ----QFEHQRRSI 206

Query: 247 PVVGIASASQKVHSN-------KPQASYNLFYIEKKN 276
             +   S   +   +         Q  + LF +    
Sbjct: 207 HYLSTPSTCIQFAPHSKTFALDHAQPGFRLFQLYGDG 243


>gi|89901135|ref|YP_523606.1| metallophosphoesterase [Rhodoferax ferrireducens T118]
 gi|89345872|gb|ABD70075.1| metallophosphoesterase [Rhodoferax ferrireducens T118]
          Length = 272

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/287 (15%), Positives = 88/287 (30%), Gaps = 35/287 (12%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M VL  ISD H                                V   L+        D +
Sbjct: 1   MSVLLQISDPHFGTE-------------------------QAAVVEALVALSQHQQPDLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  ++  +G P  +  + GNHD  +    ++  H +  Y  + 
Sbjct: 36  VLSGDITQRARRAQFAAARAFMDRLGAP--LLAIAGNHDIPLFDLGQRLFHPYARYSHAF 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                         +  +  L+             NG     Q    ++ L  A  +   
Sbjct: 94  GDELEP--------VYGSRDLLVLGVNTTRWYRHKNGEVSLAQTERVARRLGSAEPEQLR 145

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
            +++     VL     +N + G    Q+     G DL++ GH HL  +  +    + +  
Sbjct: 146 VVVVHQPVAVLRAGEDHNLLRGHAGAQQRWAAAGCDLVMGGHIHLPYVTPLAGLARPMWA 205

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           V   +A  K   +    S NL    +         +++  +  + + 
Sbjct: 206 VQAGTAVSKRVRDGAPNSVNLLRWGRHAPSGCCMIEQWDYAASAQAF 252


>gi|145638690|ref|ZP_01794299.1| predicted phosphohydrolase [Haemophilus influenzae PittII]
 gi|145272285|gb|EDK12193.1| predicted phosphohydrolase [Haemophilus influenzae PittII]
 gi|309750183|gb|ADO80167.1| cyclic 3,5-adenosine monophosphate phosphodiesterase [Haemophilus
           influenzae R2866]
          Length = 274

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 86/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN- 64
              +  L  I+D HL    S   L                   ++     ++ +I   N 
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  EFDVILATGDLVQDSSDEGYTRFVEIMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                           +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NAAKHLLLGEHWQALLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFSNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTEVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|323483394|ref|ZP_08088782.1| serine/threonine protein phosphatase [Clostridium symbiosum
           WAL-14163]
 gi|323403248|gb|EGA95558.1| serine/threonine protein phosphatase [Clostridium symbiosum
           WAL-14163]
          Length = 485

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/327 (15%), Positives = 97/327 (29%), Gaps = 31/327 (9%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +   +DIH            +  +  V     R   +  E+ +  I+D++    D V +
Sbjct: 78  KIIVATDIHYLAE-ELAGNRCQSFMSSVESGDGRVLQYGWEILDAFIDDVVEQKPDLVIL 136

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGN-PHDISIVPGNHDAYISGAKE-------------- 115
           TGD+      +        L ++     +++++PGNHD     A++              
Sbjct: 137 TGDLTMNGEKQSHEELAQKLETLSENGIEVAVIPGNHDINNPYARKFTSDGTVKTDSITA 196

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNI-ALIGCSTAIATPPFSANGYFGQEQAHA 174
                           S       YL   ++   L+   +    P     G    E    
Sbjct: 197 DEFAQIYSDFGYVAADSRDPASLSYLYKLDDYYWLLMLDSCQYDPVNRVGGMIRGETYDW 256

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI-----QRFQKMIWHEGADLILHG 229
             K L  A ++G   I + HH  +  +               +   +M++     L L G
Sbjct: 257 MEKQLESAWEEGAQVITVSHHNLLDQSGVSREFYDDCTIEHNEEMIRMLYDYDVRLHLSG 316

Query: 230 HTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIE-----KKNEYWTLEGK 284
           H HL      ++E   I  +   S             +N   IE        + W     
Sbjct: 317 HLHLQHYK--EDEDNGISEIVTGSLVMAPCHYGVLKIWNSGDIEYNAKSADVDGWAKRNS 374

Query: 285 R--YTLSPDSLSIQKDYSDIFYDTLVL 309
                L+      ++  + + Y   VL
Sbjct: 375 YKNRDLADFRTFSERFLNQVTYRNAVL 401


>gi|166367373|ref|YP_001659646.1| metallophosphoesterase [Microcystis aeruginosa NIES-843]
 gi|166089746|dbj|BAG04454.1| metallophosphoesterase [Microcystis aeruginosa NIES-843]
          Length = 362

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/270 (16%), Positives = 87/270 (32%), Gaps = 32/270 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD H++   +    S                  S     ++++ ++  N+D + 
Sbjct: 3   FRFAILSDPHIALPTTILNHSN----------RFHLVEVSIPALKIVLDHLITLNLDFLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGA-KEKSLHAWKDYITSD 128
           I GD+               L ++  P  + +VPGNHD     A + +       +    
Sbjct: 53  IAGDLTQDGEPENHRWLADCLATL--PFPVYVVPGNHDVLSLTATENQIGLGDFPFYYQQ 110

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              S  ++++    I   + LIG ++          G    EQ H   ++L         
Sbjct: 111 FGYSNPEQIYYQKEILPGVQLIGLNSNQFDDQGKQIGSLDAEQLHWLKQILPALKND--L 168

Query: 189 RIIMMHHPPV-------LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+HH  +                +        ++   G  L++ GH H+  L + + 
Sbjct: 169 VMVMIHHNVIEHLPGQSNHELGKRYMLANAVELLDILQENGVKLLITGHLHVQDLAFTRG 228

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFY 271
               I  +   S     H       Y +  
Sbjct: 229 ----IYEITTGSLVSYPHP------YRVLE 248


>gi|229844438|ref|ZP_04464578.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           influenzae 6P18H1]
 gi|229812687|gb|EEP48376.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           influenzae 6P18H1]
          Length = 274

 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 87/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN- 64
              +  L  I+D HL    S   L                   ++     ++ +I   N 
Sbjct: 10  EKPIIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  EFDVILATGDLVQDSSDEGYIRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                        +  +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NVAKHLLLGEHWQALLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFSNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + Y+       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELYSDGSIRTEVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|323691107|ref|ZP_08105387.1| hypothetical protein HMPREF9475_00248 [Clostridium symbiosum
           WAL-14673]
 gi|323504804|gb|EGB20586.1| hypothetical protein HMPREF9475_00248 [Clostridium symbiosum
           WAL-14673]
          Length = 485

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/327 (15%), Positives = 97/327 (29%), Gaps = 31/327 (9%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +   +DIH            +  +  V     R   +  E+ +  I+D++    D V +
Sbjct: 78  KIIVATDIHYLAE-ELAGNRCQSFMSSVESGDGRVLQYGWEILDAFIDDVVEQKPDLVIL 136

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGN-PHDISIVPGNHDAYISGAKE-------------- 115
           TGD+      +        L ++     +++++PGNHD     A++              
Sbjct: 137 TGDLTMNGEKQSHEELAQKLETLSENGIEVAVIPGNHDINNPYARKFTSDGTVKTDSITA 196

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNI-ALIGCSTAIATPPFSANGYFGQEQAHA 174
                           S       YL   ++   L+   +    P     G    E    
Sbjct: 197 DEFAQIYSDFGYVAADSRDPASLSYLYKLDDYYWLLMLDSCQYDPVNRVGGMIRGETYDW 256

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGI-----QRFQKMIWHEGADLILHG 229
             K L  A ++G   I + HH  +  +               +   +M++     L L G
Sbjct: 257 MEKQLESAWEEGAQVITVSHHNLLDQSGVSREFYDDCTIEHNEEMIRMLYDYDVRLHLSG 316

Query: 230 HTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIE-----KKNEYWTLEGK 284
           H HL      ++E   I  +   S             +N   IE        + W     
Sbjct: 317 HLHLQHYK--EDEDNGISEIVTGSLVMAPCHYGVLKIWNSGDIEYNAKSADVDGWAKRNS 374

Query: 285 R--YTLSPDSLSIQKDYSDIFYDTLVL 309
                L+      ++  + + Y   VL
Sbjct: 375 YKNRDLADFRTFSERFLNQVTYRNAVL 401


>gi|269128492|ref|YP_003301862.1| metallophosphoesterase [Thermomonospora curvata DSM 43183]
 gi|268313450|gb|ACY99824.1| metallophosphoesterase [Thermomonospora curvata DSM 43183]
          Length = 270

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 48/284 (16%), Positives = 87/284 (30%), Gaps = 37/284 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVD 66
           M ++A +SDIHL+                        +          ++ +L      D
Sbjct: 1   MTIIAQLSDIHLAAGADG---------------RVDDRSGPVRALRSAVSSLLALPQRPD 45

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ +     E       L  +  P  +  +PGNHD         +L       T
Sbjct: 46  CVVLTGDLADRGLPVEYERLRALLSPL--PMPVFPLPGNHDDR------AALREAFADRT 97

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           +       +  F Y      + L+ C T   T P  ++G   +E+       L  A    
Sbjct: 98  AACAAPDPQAPFQYAVQVRGVRLVCCDT---TVPGESHGELDEERLQWLDAALAAAPD-- 152

Query: 187 FFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
              ++  HHPP            +        ++      + ++ GH H  ++  I    
Sbjct: 153 VPTVVATHHPPFPIGVRFLDEAGLRDAAALGAVLARHPQVERVISGHVHRAAVGRI---- 208

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
             I  V   S  ++++ +           E       L G+   
Sbjct: 209 GEITAVTCPSTYRQIYLDTTSPGQAAVTGEPGGFSLHLVGEGRP 252


>gi|145640358|ref|ZP_01795942.1| predicted phosphohydrolase [Haemophilus influenzae R3021]
 gi|145274944|gb|EDK14806.1| predicted phosphohydrolase [Haemophilus influenzae 22.4-21]
          Length = 274

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 85/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-- 63
              +  L  I+D HL    S   L                   ++     ++ +I     
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  QFDVILATGDLVQDSSDEGYTRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                           +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NAAKHLLLGEHWQAVLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFSNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTQVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|83594620|ref|YP_428372.1| metallophosphoesterase [Rhodospirillum rubrum ATCC 11170]
 gi|83577534|gb|ABC24085.1| Metallophosphoesterase [Rhodospirillum rubrum ATCC 11170]
          Length = 289

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 56/308 (18%), Positives = 98/308 (31%), Gaps = 47/308 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD+H                               +    L  +++    D V
Sbjct: 1   MRRIAHISDLHFG-------------------------RVDPDAVIALGQELIAQAPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+     +R+   +  +L S+  P  I +VPGNHD       ++ L     +    
Sbjct: 36  VVSGDLTQRARSRQFLDARAFLDSLKLP--ILVVPGNHDVPWHNPVQRFLGPHGRFRKMI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               +     P + +      I  S A+      ANG    ++A   + LL  A      
Sbjct: 94  GKDLSPVLRDPEMTVAG----ITTSRALVPHWNWANGRISTKRARRVATLLA-AEPAEKL 148

Query: 189 RIIMMHHPPVL-------DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI-- 239
           R+++ HHP           +       F      + +     DL+L GH H++    +  
Sbjct: 149 RVVVTHHPLAFAPSPTGGASPDGTLPTFNAAGALRALGAARVDLMLSGHMHVSRAACLSF 208

Query: 240 -----KNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLS 294
                        VV  ASA       +P A YN+           +          +  
Sbjct: 209 PGPKPDGTPWTAVVVQAASAISTRLRGEPNA-YNMIETSANGLDVHIRAWTVGAQDFATV 267

Query: 295 IQKDYSDI 302
             + ++ I
Sbjct: 268 ATRHFARI 275


>gi|229846486|ref|ZP_04466594.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           influenzae 7P49H1]
 gi|229810579|gb|EEP46297.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           influenzae 7P49H1]
          Length = 274

 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/301 (13%), Positives = 86/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN- 64
              +  L  I+D HL    S   L                   ++     ++ +I   N 
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  EFDVILATGDLVQDSSDEGYTRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                           +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NAAKHLLLGEHWQAVLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLVPFTNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + Y+       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELYSDGSIRTEVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|15679714|ref|NP_276832.1| transcriptional regulator Icc related protein [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|2622852|gb|AAB86192.1| transcriptional regulator Icc related protein [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 262

 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/266 (17%), Positives = 93/266 (34%), Gaps = 46/266 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +A ISD+H                         +K FS ++   L++ +   N D + +
Sbjct: 4   KIAQISDVHFG-----------------------EKNFSDQLRKNLLHQLENENPDLIIV 40

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+     + E   +  ++  +        +PGNHDA   G         +        
Sbjct: 41  SGDLTTEGYSHEYELAAAFVDELRTITSTYTIPGNHDARNVGLIHFEKLIGRRKF----- 95

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                     +   +  A+IG  ++    P   +G  G +Q     K L +        +
Sbjct: 96  ----------VHHDSEFAVIGLDSS---EPDINDGQIGMDQLDWLRKELERVPDHLCKIV 142

Query: 191 IMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
              HH  P+ +T    N +       K++   G D +L+GH H+ ++  I+     +  +
Sbjct: 143 TFHHHLLPIPNTGRERNILLDSGDLLKLLKEYGVDFVLNGHKHVPNVWMIEG----MVTL 198

Query: 250 GIASASQKVHSNKPQASYNLFYIEKK 275
              +A+ +    +   S+N   I   
Sbjct: 199 NSGTATTRKLRGETFPSHNQLRINDD 224


>gi|283798658|ref|ZP_06347811.1| serine/threonine protein phosphatase family protein [Clostridium
           sp. M62/1]
 gi|291073643|gb|EFE11007.1| serine/threonine protein phosphatase family protein [Clostridium
           sp. M62/1]
          Length = 566

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/302 (14%), Positives = 91/302 (30%), Gaps = 24/302 (7%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
               SDIH   SP   +   +     V W   +   +   + +  + +      D + ++
Sbjct: 109 FIVASDIHY-QSPKMTDFVGEAFCQFVRWDDGKVIPYLDTITDAFLEEAAEKQPDALILS 167

Query: 72  GDIVNFTCNREIFTSTH-WLRSIGNPHDISIVPGNHDAYISGAKE--------------K 116
           GD+                 +       + ++PGNHD     A                 
Sbjct: 168 GDLTQNGELVNHEELAEKLRKVEEQGVPVLVIPGNHDINHPEASYFEGAERKKADNITAD 227

Query: 117 SLHAWKDYITSDTTCSTGKKLFPYLRIRNN-IALIGCSTAIATPPFSANGYFGQEQAHAT 175
             ++       D      +    Y+   ++   L+   +    P     G   +E     
Sbjct: 228 DFYSIYREFGYDEAMDRDEASLSYMYRADDRYWLMMLDSCQYDPENKVGGRIRKETLAWM 287

Query: 176 SKLLRKANKKGFFRIIMMHHPPVLDTS--SLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
           S  L KA ++    I + HH  + +++       +    +  +++   G  + + GH HL
Sbjct: 288 SGWLEKAREENVLVIPIAHHNLLKESTLYPEDCTLENSSQAAELLESYGLPVYISGHLHL 347

Query: 234 NSL--HWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN--EYWTLEGKRYTLS 289
             +  +      +  P+ GI           P   Y     ++    +Y T      + +
Sbjct: 348 QRIKKNINGGPSQTEPLYGIYEIVSDSM-AIPPCQYGELRWQEDGSFDYRTCRIDVESWA 406

Query: 290 PD 291
            D
Sbjct: 407 RD 408


>gi|111223763|ref|YP_714557.1| putative cAMP phosphodiesterase [Frankia alni ACN14a]
 gi|111151295|emb|CAJ63009.1| Putative cAMP phosphodiesterase [Frankia alni ACN14a]
          Length = 313

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 87/301 (28%), Gaps = 48/301 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHV 68
            L  ISD H+                         K  +  V   ++  +      +  +
Sbjct: 30  TLIQISDTHIVRPGELLYD----------------KVDTHAVLAAVLAQLEASPLRIGVL 73

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNP--HDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            +TGD+ +             +  +       +    GNHD            A   +  
Sbjct: 74  LLTGDLADSGDPLAYRRLRELVEPVAARMGVPVLYGMGNHD------------ARGPFRA 121

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    + + Y    +++ ++   +   T P    G     Q    +  L      G
Sbjct: 122 GLLGVEPTTEPYDYTHWVDDLRVVVLDS---TEPGQHGGLLSTAQLGWLADELATPAPAG 178

Query: 187 FFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
              ++ +HHPPV    +  N +     +R   ++      ++L GH H  S         
Sbjct: 179 T--VLALHHPPVPSPIAAVNTLLLAEPERLAAVLAGSDVKIVLTGHAHHAS----AGVLG 232

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
            +PV    + + +     P             EY  ++   Y     + ++    +D+ Y
Sbjct: 233 GVPVWVAGATAYRAQVVGPADRMTGL---VGGEYTRVDV--YPTGAVATTVPIGPADVLY 287

Query: 305 D 305
           D
Sbjct: 288 D 288


>gi|329122274|ref|ZP_08250862.1| 3',5'-cyclic-nucleotide phosphodiesterase [Haemophilus aegyptius
           ATCC 11116]
 gi|327473835|gb|EGF19252.1| 3',5'-cyclic-nucleotide phosphodiesterase [Haemophilus aegyptius
           ATCC 11116]
          Length = 274

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 86/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-- 63
              +  L  I+D HL    S   L                   ++     ++ +I     
Sbjct: 10  EKPIIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  QFDVILATGDLVQDSSDEGYTRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                        +  +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NVAKHLLLGEHWQALLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFSNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTEVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|226360768|ref|YP_002778546.1| 3',5'-cyclic-nucleotide phosphodiesterase [Rhodococcus opacus B4]
 gi|226239253|dbj|BAH49601.1| 3',5'-cyclic-nucleotide phosphodiesterase [Rhodococcus opacus B4]
          Length = 318

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 79/279 (28%), Gaps = 53/279 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           + H+SD HL                            S+     ++ +I       D + 
Sbjct: 21  VLHLSDTHLVDD-----------------DLLYGAVDSEATLRQIVTEIEASHARPDALV 63

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGN--PHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +  +       +    GNHD                +   
Sbjct: 64  FTGDLTDRGQPGAYEKLREIVEPVAATLGAQVIWAMGNHDDRGH------------FRAE 111

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                   +   ++   + + +I   T   T P   +G   + Q    ++ L      G 
Sbjct: 112 LLGQEPTYEPVDHVHDVDGLRIITLDT---TVPGHHHGEISESQLIWLAQQLAIPAPHGS 168

Query: 188 FRIIMMHHPPVLD--TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ +HHPPV      ++   +    R   ++       IL GH H ++          
Sbjct: 169 --ILALHHPPVPCVLDLAVLVELRDQPRLADVLRGSDVRSILAGHLHYSTTATFAG---- 222

Query: 246 IPVVGIASASQK---------VHSNKPQASYNLFYIEKK 275
           IPV   ++             +        YNL ++  +
Sbjct: 223 IPVSVASATCYTQDLNVPAGALRGRDGAQGYNLVHVYPE 261


>gi|84394655|ref|ZP_00993345.1| cyclic AMP phosphodiesterase [Vibrio splendidus 12B01]
 gi|84374720|gb|EAP91677.1| cyclic AMP phosphodiesterase [Vibrio splendidus 12B01]
          Length = 274

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/305 (13%), Positives = 92/305 (30%), Gaps = 48/305 (15%)

Query: 2   TKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL 61
           T ++      L  ++D HL    +   L                   +++    +++ I+
Sbjct: 6   TSKFDESTIKLVQLTDTHLFAPSNGSLL----------------SINTQDSFRAVVDGIV 49

Query: 62  LHNVD--HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
               D   +  TGDI               +  +  P     +PGNHD   +        
Sbjct: 50  SQGFDYQAILATGDISQDHSAESYQKFESGIEPLEKPC--YWLPGNHDFKPNM------- 100

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
                       S   +   ++ +  N  ++   + +   P    G    +Q     + L
Sbjct: 101 -------GSVLPSPQIQCVEHVLLGGNWQMVMLDSQVVGVPH---GRLSDQQLDLLEQKL 150

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHW 238
            +  ++    ++  H   V       + +   ++F  ++        IL GH H +    
Sbjct: 151 TEFPERNTLVLLHHHPLLVGSAWLDQHNLKDAEQFWDVVQQHTNVKAILCGHVHQDMNRN 210

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD 298
                  + V+   S   +   N      N F ++  +  W  E + +     +  +++ 
Sbjct: 211 HHG----VQVMATPSTCVQFKPNS-----NDFAVDTLSPGWR-EIELHQDGTVTTQVRRL 260

Query: 299 YSDIF 303
            +  F
Sbjct: 261 PNGQF 265


>gi|162457579|ref|YP_001619946.1| hypothetical protein sce9293 [Sorangium cellulosum 'So ce 56']
 gi|161168161|emb|CAN99466.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
          Length = 269

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 56/302 (18%), Positives = 106/302 (35%), Gaps = 45/302 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                              K +   LI  I       V
Sbjct: 1   MRTLVHLSDLHFG-------------------------RVDKAILRPLIERIGGLEPHVV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+     + E   +  +L ++  P    +VPGNHD  +    ++       Y +  
Sbjct: 36  VISGDLTQRARDAEFAEARAFLDAL--PSPRIVVPGNHDVPLYNLFDRFFRPLDRYRSHI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           T   +         +   IA++G +TA +      +G     Q       +     +   
Sbjct: 94  TDDLSP------FHLDAEIAVLGINTARSLT--IKDGRINARQVEGIKARMCDLGPE-IT 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL----NSLHWIKNEKK 244
           +I++ HHP  L  +S +  +   ++    I   G D+IL GH H+    +S         
Sbjct: 145 KIVVTHHPFDLPENSPHAIVGRARQAMAAIAGCGVDVILSGHLHMSHTGHSAERFDAGGH 204

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
              +V   +A+      +  A +N+  ++ +     +  +RY   P+        ++ F 
Sbjct: 205 SSLIVQAGTATSTRGRGEQNA-FNVIRVDGRK----IHIERYFWQPEDGLFGIAITEHFE 259

Query: 305 DT 306
           +T
Sbjct: 260 ET 261


>gi|315641646|ref|ZP_07896710.1| metallophosphoesterase [Enterococcus italicus DSM 15952]
 gi|315482606|gb|EFU73137.1| metallophosphoesterase [Enterococcus italicus DSM 15952]
          Length = 265

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 47/277 (16%), Positives = 90/277 (32%), Gaps = 38/277 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHVSI 70
           + HISDIH   +          ++         K           + ++L  H +D + I
Sbjct: 3   ILHISDIHFRKTYLLKNTDYLEML--------AKMQSPLTHLEECLTEVLANHRIDVLII 54

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+       + +    WL +I     I +  GNHD               ++      
Sbjct: 55  SGDLTEDGEVEDYYFLKQWLLNIVGSIPIIVTLGNHDI------------KSNFREGWFA 102

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               +  +  +    ++++I    +    P   NG    +Q       L  A  +    I
Sbjct: 103 ELPSEDFYNDVMHFPDVSIIAFDNSYFGYP---NGIVDSKQFEWLKNQLINAKGRP---I 156

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           I + H  +L T        G ++  +++       IL+GHTH   +  I+     IP   
Sbjct: 157 IFVTHHHLLPTQITMPEWPGSKQLIQLLQSHNIKCILNGHTHHPFISDIQG----IPYYT 212

Query: 251 IASASQ-------KVHSNKPQASYNLFYIEKKNEYWT 280
           ++  S         +   +    YNL+    +     
Sbjct: 213 VSGMSFIGEDEGDGLVRFEEAYGYNLYRFSDEKITEQ 249


>gi|28867720|ref|NP_790339.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|28850955|gb|AAO54034.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|331015037|gb|EGH95093.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. lachrymans str. M302278PT]
          Length = 277

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRENLLAAFADQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                       ++  +  + LIG  T   T P    G     Q    +  L  + +   
Sbjct: 103 ----LAASGPLDWVVEQYPLRLIGMDT---TIPGEHGGRLDYCQLDWLNAQL--SRRPDV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVLHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|296532717|ref|ZP_06895403.1| metallophosphoesterase [Roseomonas cervicalis ATCC 49957]
 gi|296266955|gb|EFH12894.1| metallophosphoesterase [Roseomonas cervicalis ATCC 49957]
          Length = 282

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 56/289 (19%), Positives = 98/289 (33%), Gaps = 48/289 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H                              + VA  LI+ +     D V I
Sbjct: 5   RIDHISDLHFG-------------------------RVDERVAAALIDTLNAEPADLVVI 39

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+     +RE   +  ++ ++  P    +VPGNHD       E+ L  +  +      
Sbjct: 40  SGDLTMRARSREYRAACAFMSALKAPQ--IVVPGNHDITNYWPWERFLDPFGRWHRFVGG 97

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFG-QEQAHATSKLLRKANKKGFFR 189
            +            +++A+IG +T +   P  A      +           +    G FR
Sbjct: 98  ETEP------FWRDDHLAVIGLNTVVRAAPHLAWEEGRVKRHRLQRLLRRLEELPPGLFR 151

Query: 190 IIMMHHPPVLDTSSLYNR-MFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK----- 243
           I++ HHP +    +             +++   G  LIL GH H   +   +        
Sbjct: 152 IVVAHHPFLAPEDAPDTPLAHRAAPALEVLQRAGVRLILSGHLHRGYVRLHRGTGTAETA 211

Query: 244 -----KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
                  + VV   SA       +P A YN   I  ++    +E +R+ 
Sbjct: 212 SGHTRPELLVVQAGSAISTRLRGEPNA-YNRITI--QDGQARIEPRRWD 257


>gi|149197703|ref|ZP_01874753.1| hypothetical protein LNTAR_20758 [Lentisphaera araneosa HTCC2155]
 gi|149139273|gb|EDM27676.1| hypothetical protein LNTAR_20758 [Lentisphaera araneosa HTCC2155]
          Length = 264

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 57/280 (20%), Positives = 97/280 (34%), Gaps = 25/280 (8%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + H SDIH    P+      KR+ G  N+ F RKK  +    + L   +     D+  
Sbjct: 1   MKIIHFSDIHEGAFPAPSSFFSKRLFGGSNYVFRRKKTVNWSRLDKLTEYVEQEGFDYAI 60

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           I+GD  +    RE       L  +       I  VPGNHD YI  +K            +
Sbjct: 61  ISGDFTSTGSVREFEMVKKRLEKLHAIEGLKILAVPGNHDNYIDCSKSYKALEDFITWLT 120

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                   K FP       +     + A+  P   ++G+  +E      +    ++K   
Sbjct: 121 KGL----VKNFPLRIEEGEVVFYLSNHAVPRPVQLSSGFVNEETHERLVE---WSSKDEQ 173

Query: 188 FRIIMMHHPPVLDTS----SLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
              I + H P+L+        +  +   ++  K++     D+ L GH H   L       
Sbjct: 174 KTKIAIGHYPLLNGEGNSLPEHKLLVDGEKVHKLLQSGAIDINLCGHIHHAFLREETGGS 233

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKK--NEYWTL 281
           K I      S +    +       N+  I+ +   + W +
Sbjct: 234 KEI---CAGSLTMGRKA-------NILEIDGRRIEQTWKI 263


>gi|108804494|ref|YP_644431.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
 gi|108765737|gb|ABG04619.1| metallophosphoesterase [Rubrobacter xylanophilus DSM 9941]
          Length = 274

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 94/276 (34%), Gaps = 50/276 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +  ISDIH                            F  ++    I +I   +   V 
Sbjct: 7   LTICQISDIHCGSPY-----------------------FIPDLLERSILEINDLDPTAVV 43

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ++GD+ N    +E   +  ++R     H + ++PGNHD+   G         + Y     
Sbjct: 44  VSGDLTNAGYRQEYEQAAEYIRRFRCEH-LMVIPGNHDSRNVGYVHFERLFGERY----- 97

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                      +    +  ++G  ++    P   +G  G+E      +    A +K    
Sbjct: 98  ----------SVIDFEDAIMVGVDSS---EPDLNDGRVGREHYGFIHESFAGAEEKLKIF 144

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           ++  H  P+  T    N +F      +++     DL+L GH H+     ++N    + +V
Sbjct: 145 VVHHHLIPIPGTGRERNIVFDAGDVLELLADTEVDLVLSGHKHVPYSWRLEN----MFIV 200

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKR 285
              +AS        +  YN+  +E +     +   R
Sbjct: 201 NAGTASTTRLRGNTRPCYNIIEVENE----RVRVFR 232


>gi|197295117|ref|YP_002153658.1| putative calcineurin-like phosphoesterase family protein
           [Burkholderia cenocepacia J2315]
 gi|195944596|emb|CAR57200.1| putative calcineurin-like phosphoesterase family protein
           [Burkholderia cenocepacia J2315]
          Length = 266

 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 45/254 (17%), Positives = 85/254 (33%), Gaps = 42/254 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--D 66
           M V+A +SDIH+      ++                    S  + +  ++ +       D
Sbjct: 1   MTVIAQLSDIHVRPHGVLYQD----------------AVDSNVMFSAAVDSLNRIRPEPD 44

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V I+GD+ +     E       L  +  P    ++PGNHD   +       HAW     
Sbjct: 45  LVVISGDLTDEGTEDEYRKLRELLVELRRP--FVVLPGNHDDRGNLRAAFPDHAWLP--- 99

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                   +    +      + ++   T++   P   +G    E        L +   + 
Sbjct: 100 -------DEGALSFALDVGELRVVALDTSV---PGLHHGELDAETLAWLDTELAEH--RN 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEK 243
              +I+MHHPP +      +       + F  ++      D IL GH H +    +    
Sbjct: 148 RTVVIVMHHPPFMTGIPYLDIYGLRNAEAFAAVLARHSNVDRILAGHVHRSMQTRL---- 203

Query: 244 KLIPVVGIASASQK 257
             +PV+   S + +
Sbjct: 204 GRVPVLTCPSTTTQ 217


>gi|123443847|ref|YP_001007818.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122090808|emb|CAL13690.1| Icc protein homologue [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 275

 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/294 (12%), Positives = 81/294 (27%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D +  
Sbjct: 16  RILQITDTHLFAGEHETLLGVNTSRSY------------RAVLDAIIAE--QHPFDLIVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHSVAAYQNFASGISRL--PAPCVWLPGNHDFQPAMV--------------DAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            + G      + + +N  ++   + +   P+   G   + Q     + L    ++    +
Sbjct: 106 AAAGIAPSKQVLVGDNWQILLLDSQVFGVPY---GELSEYQLEWMERCLMAHPERYTLIL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 163 LHHHPMPSGCTWLDQHSLRNAHMLAAVLTRYPRVTTLLCGHIHQDLDLDWYGK----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               +++  SD F
Sbjct: 219 ASPSTCVQFKPHCTN-----FTLDTVAPGWRY-LDLLPDGRLETEVRRLASDEF 266


>gi|289209458|ref|YP_003461524.1| calcineurin phosphoesterase [Thioalkalivibrio sp. K90mix]
 gi|288945089|gb|ADC72788.1| Calcineurin phosphoesterase domain protein [Thioalkalivibrio sp.
           K90mix]
          Length = 265

 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 47/296 (15%), Positives = 80/296 (27%), Gaps = 57/296 (19%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI-LLHNVDHVS 69
            L  ISD HL   P                        S      ++  +      D + 
Sbjct: 9   RLIQISDTHLGRVPGP---------------IRAGYPDSDTQLERILGALPREPAADALL 53

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ++GD+               L S      +  + GNHD                  T  T
Sbjct: 54  LSGDLAEDPEPATYARLARLLGS--RREPMLALAGNHDDCQ---------------TLRT 96

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                       R+     LIG  ++    P  A G     +     K L  +       
Sbjct: 97  ALEPETCQVHGERMLGPWKLIGLDSST---PGEAAGRLDASECERLEKSL--SADPDRPT 151

Query: 190 IIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HHPPV   S+  +R+          ++         L GH H +        +  I
Sbjct: 152 VVALHHPPVAIGSAWMDRLGLLDPDALFAVLDRHPQVRACLFGHIHQDFRAR----RGAI 207

Query: 247 PVVGIASASQKVHSNKPQ--------ASYNLFYIEKKNEY----WTLEGKRYTLSP 290
            ++G  S   +      +        A Y +  +     +      + G R  + P
Sbjct: 208 ELLGSPSTCVQFTPGSEEFAVDAALDAGYRILDLHPDGRFDTQVVRVPGTRIAMEP 263


>gi|301169101|emb|CBW28698.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           influenzae 10810]
          Length = 274

 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 87/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN- 64
              +  L  I+D HL    S   L                   ++     ++ +I   N 
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  EFDVILATGDLVQDSSDEGYIRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                        +  +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NVAKHLLLGEHWQALLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFSNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTEVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|330874790|gb|EGH08939.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. morsprunorum str. M302280PT]
          Length = 277

 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 86/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRENLLAAFADQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q    +  L  + +   
Sbjct: 103 ----LSAGGPLDWVVEQYPLRLIGMDT---TIPGEHGGRLDYCQLDWLNAQL--SRRPDV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVLHHPPFITGIGHMDREPFGNAAALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  QA+   F +E   
Sbjct: 214 CI----CPGTSHQIVLDLDQAAPAHFNLEPAG 241


>gi|300724861|ref|YP_003714186.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297631403|emb|CBJ92100.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Xenorhabdus
           nematophila ATCC 19061]
          Length = 279

 Score =  110 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/304 (15%), Positives = 89/304 (29%), Gaps = 50/304 (16%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
                 +  I+D HL  +     L                      V + ++      ++
Sbjct: 11  EGATARILQITDTHLFANKGDSLLGVNTYNSY------------HAVLDTILEQ--NLDI 56

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D +  TGD+V              +  +  P     +PGNHD   +              
Sbjct: 57  DLIVATGDLVQDQTIEAYQHFAEGMARL--PASCVWLPGNHDYQPAMV------------ 102

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             DT  + G      + I  +  LI   + +   P    G     Q     K L + +++
Sbjct: 103 --DTLAAAGISPSKQIFIGQHWQLIMLDSQVQGVPH---GELTDYQLEWMKKCLDEHSER 157

Query: 186 GFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIW-HEGADLILHGHTHLNSLHWIKNE 242
               I+M+HH PV    +  ++          + +        IL GH H      I + 
Sbjct: 158 QA--IVMLHHHPVPSGCTWLDQHSLRNAPELSEFLKGQTQVQAILCGHIHQ----EIDDM 211

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT---LEGKRYTLSPDSLSIQKDY 299
              I V+   S   +   +        F ++ +   W    L       +     + +  
Sbjct: 212 WNGIRVLATPSTCVQFKPHCTN-----FMLDTEAPGWRYLELSVTGKQEARLQTQVHRLK 266

Query: 300 SDIF 303
           S+ F
Sbjct: 267 SNEF 270


>gi|14520324|ref|NP_125799.1| lacZ expression regulatory protein [Pyrococcus abyssi GE5]
 gi|5457539|emb|CAB49030.1| Predicted phosphohydrolase, putative [Pyrococcus abyssi GE5]
          Length = 505

 Score =  110 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 55/296 (18%), Positives = 101/296 (34%), Gaps = 53/296 (17%)

Query: 9   MFV--LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD 66
           M    +AHISD H++   +F   +                       +L+ N+I     D
Sbjct: 1   MMKMLIAHISDTHITNEVAFKSYAY----------------------DLIANEINTRPFD 38

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V  TGD+ N     E   +++ L+ I  P  + + PGNHD         + +   +   
Sbjct: 39  LVIHTGDVTNNGLREEYEHASYLLKKIEKP--LIVAPGNHD---------ARNVGYELFE 87

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                  G      +    +  +I   +   T P  ++G  G  +       L + + K 
Sbjct: 88  KYIGPLIG------VYEFKDGVIIWLDS---TIPDLSDGRVGGYKFKWLKAKLEEYSHKK 138

Query: 187 FFRIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
              +   HH  P+ DT    N +F       ++      L + GH H+ +++ ++     
Sbjct: 139 IKIVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLSHDVTLYMCGHKHVPNVYRVE----D 194

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
           + V     AS +        SYN+  I K      ++     L+ D    +     
Sbjct: 195 LVVDNAGCASCRKTRKGDVNSYNIVKITKDK----VKVVIRRLTGDEEEKEHKPIR 246



 Score = 71.9 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 43/268 (16%), Positives = 76/268 (28%), Gaps = 51/268 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHV 68
             + H+S                        + + + YF K      I  I      D V
Sbjct: 258 LRIVHVS----------------------ESNVSDRVYFRKRTLENAIRAINEKYKPDIV 295

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
              GD+V     R    +  +   +     I     +         ++            
Sbjct: 296 VHCGDVVEKGIERYFEMALEYYEKVKAEKIIVPGHNDISYLGYELFKEYF---------- 345

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                     P +  R +   I   +A         G  GQ+          +      F
Sbjct: 346 --------GEPEIVERGDFVFIPILSAQYETQIGVVGRTGQKMLSRLLDDFEE-----KF 392

Query: 189 RIIMMHHPPVL-DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           RII+MHH  V          +       K+I  +  +L L GH   ++   ++      P
Sbjct: 393 RIIVMHHNLVPVPGVREIGYLEDAGNVLKIITDKKTELTLTGHGGNSNAVKVE----KSP 448

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKK 275
           ++   S S ++H N    S+N+  I + 
Sbjct: 449 IINAGSISWELHRNPFGNSFNVIDIYED 476


>gi|111018660|ref|YP_701632.1| phosphoesterase [Rhodococcus jostii RHA1]
 gi|110818190|gb|ABG93474.1| probable phosphoesterase [Rhodococcus jostii RHA1]
          Length = 327

 Score =  110 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/285 (14%), Positives = 81/285 (28%), Gaps = 53/285 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           + H+SD HL                            S+     +  +I       D + 
Sbjct: 39  VLHLSDTHLVDD-----------------DLLYGAVDSEATLRQIFTEIESSHARPDALV 81

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGN--PHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +  +       +    GNHD                + T 
Sbjct: 82  FTGDLTDRGQPGAYEKLRAIVEPVAASLGAQVIWAMGNHDDRGH------------FRTE 129

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                   +   ++   + + ++   T   T P   +G   + Q    ++ L      G 
Sbjct: 130 LLGQEPSYEPIDHVYDVDGLRIVTLDT---TVPGHHHGEISESQLLWLAQQLAVPAPHGT 186

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQ--KMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ +HHPPV     L   +    + +   ++       IL GH H ++          
Sbjct: 187 --ILALHHPPVPCVLDLAVLVELRDQLRLADVLRGSDVRSILAGHLHYSTTATFAG---- 240

Query: 246 IPVVGIASASQK---------VHSNKPQASYNLFYIEKKNEYWTL 281
           IPV   ++             +        YNL ++  +    ++
Sbjct: 241 IPVSVASATCYTQDLNVPAGALRGRDGAQGYNLVHVYPETIVHSV 285


>gi|255975808|ref|ZP_05426394.1| predicted protein [Enterococcus faecalis T2]
 gi|307278029|ref|ZP_07559113.1| Ser/Thr protein phosphatase family protein [Enterococcus faecalis
           TX0860]
 gi|255968680|gb|EET99302.1| predicted protein [Enterococcus faecalis T2]
 gi|306505426|gb|EFM74612.1| Ser/Thr protein phosphatase family protein [Enterococcus faecalis
           TX0860]
          Length = 272

 Score =  110 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 92/272 (33%), Gaps = 38/272 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-VDHVSI 70
           + H+SDIH   +    +   K ++         K           +  +L    +D V I
Sbjct: 3   ILHLSDIHFRRNYEKTKDGYKGMLT--------KMENPLIRLESSLTSLLKIKKIDLVII 54

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+       +       L++I     + +  GNHD              K++      
Sbjct: 55  SGDLTEDGEPEDYAFLKQKLQTILQGIPMIVTLGNHDI------------KKNFRIGWLN 102

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               ++ +  ++      +I    +    P   +G+  +EQ       L+K + K    I
Sbjct: 103 QIGTERPYNVVQTYPEFHIISLDNSEHDNP---DGHMNKEQKDWLQTTLKKLSDKP---I 156

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           +++ H  +L   S    +   +   +++       +L GHTH   LH I      IP   
Sbjct: 157 LLVMHHHLLREQSSMPTLPEAEETIQLLKSSDILGVLTGHTHHPYLHHING----IPYYT 212

Query: 251 IASASQKVHSNKP-------QASYNLFYIEKK 275
           +A  S                  YNL+ I+K 
Sbjct: 213 VAGMSFVGEDEGQGIVRFEENYGYNLYSIDKG 244


>gi|145632646|ref|ZP_01788380.1| predicted phosphohydrolase [Haemophilus influenzae 3655]
 gi|144986841|gb|EDJ93393.1| predicted phosphohydrolase [Haemophilus influenzae 3655]
          Length = 274

 Score =  110 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 85/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-- 63
              +  L  I+D HL    S   L                   ++     ++ +I     
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  QFDVILATGDLVQDSSDEGYTRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                           +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NAAKHLLLGEHWQAVLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLSPFTNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTQVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|148827601|ref|YP_001292354.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           influenzae PittGG]
 gi|148718843|gb|ABQ99970.1| lacZ expression regulator [Haemophilus influenzae PittGG]
          Length = 274

 Score =  110 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 85/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-- 63
              +  L  I+D HL    S   L                   ++     ++ +I     
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         +R    P  +  +PGNHD     A+  +      
Sbjct: 54  QFDVILATGDLVQDSSDEGYTRFVEMMRPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                           +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NAAKHLLLGKHWQAVLLDSQVYGVPH---GQLSQHQLDLLKETLGKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFSNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTQVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|148825320|ref|YP_001290073.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           influenzae PittEE]
 gi|148715480|gb|ABQ97690.1| lacZ expression regulator [Haemophilus influenzae PittEE]
          Length = 274

 Score =  110 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 87/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN- 64
              +  L  I+D HL    S   L                   ++     ++ +I   N 
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENK 53

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  EFDVILATGDLVQDSSDEGYIRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                        +  +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NVAKHLLLGEHWQALLLDSQVYGVPH---GQLSQHQLDLLKETLGKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFSNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTEVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|300860685|ref|ZP_07106772.1| Ser/Thr phosphatase family protein [Enterococcus faecalis TUSoD
           Ef11]
 gi|312899452|ref|ZP_07758782.1| Ser/Thr protein phosphatase family protein [Enterococcus faecalis
           TX0470]
 gi|300849724|gb|EFK77474.1| Ser/Thr phosphatase family protein [Enterococcus faecalis TUSoD
           Ef11]
 gi|311293322|gb|EFQ71878.1| Ser/Thr protein phosphatase family protein [Enterococcus faecalis
           TX0470]
 gi|315145085|gb|EFT89101.1| Ser/Thr protein phosphatase family protein [Enterococcus faecalis
           TX2141]
 gi|323480767|gb|ADX80206.1| calcineurin-like phosphoesterase family protein [Enterococcus
           faecalis 62]
          Length = 272

 Score =  110 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 92/272 (33%), Gaps = 38/272 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-VDHVSI 70
           + H+SDIH   +    +   K ++         K           +  +L    +D V I
Sbjct: 3   ILHLSDIHFRRNYEKAKDGYKGMLT--------KMENPLIRLESSLTSLLKIKKIDLVII 54

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+       +       L++I     + +  GNHD              K++      
Sbjct: 55  SGDLTEDGEPEDYAFLKQKLQTILQGIPMIVTLGNHDI------------KKNFRIGWLN 102

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               ++ +  ++      +I    +    P   +G+  +EQ       L+K + K    I
Sbjct: 103 QIGTERPYNVVQTYPEFHIISLDNSEHDNP---DGHMNKEQKDWLQTTLKKLSDKP---I 156

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           +++ H  +L   S    +   +   +++       +L GHTH   LH I      IP   
Sbjct: 157 LLVMHHHLLREQSSMPTLPEAEETIQLLKGSDILGVLTGHTHHPYLHHING----IPYYT 212

Query: 251 IASASQKVHSNKP-------QASYNLFYIEKK 275
           +A  S                  YNL+ I+K 
Sbjct: 213 VAGMSFVGEDEGQGIVRFEENYGYNLYSIDKG 244


>gi|218682884|ref|ZP_03530485.1| putative phosphoesterase protein [Rhizobium etli CIAT 894]
          Length = 212

 Score =  110 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 87/170 (51%), Positives = 119/170 (70%), Gaps = 3/170 (1%)

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           DH+++TGD+VN     EI  +  WLR +G+P D S+VPGNHDAY+ GA EKS+ AW DY+
Sbjct: 1   DHLAVTGDLVNLASGIEIRAAAAWLRELGDPADTSVVPGNHDAYVPGAYEKSMRAWYDYV 60

Query: 126 TSDTTCSTGKKL---FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
             D      ++    FPYLRIR  +A++GCSTA+ATPPF+A+G+FG  QA  T  +LR A
Sbjct: 61  RGDLAPPQWQEDRHIFPYLRIRGKVAIVGCSTAVATPPFAASGFFGARQARDTVNMLRAA 120

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
            + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTH
Sbjct: 121 GEAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTH 170


>gi|312958630|ref|ZP_07773150.1| metallophosphoesterase [Pseudomonas fluorescens WH6]
 gi|311287173|gb|EFQ65734.1| metallophosphoesterase [Pseudomonas fluorescens WH6]
          Length = 271

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/297 (14%), Positives = 82/297 (27%), Gaps = 54/297 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   ++E     +  +       D V 
Sbjct: 15  LVQLSDSHLFAEADAVLLG----------------MNTRESLRRAVELVREQQPQIDLVL 58

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                  +  P  +  +PGNHD     A+               
Sbjct: 59  ATGDLSQDGTLASYQRFREMTALLDAP--VRWIPGNHDEPQIMAQ--------------- 101

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             +    L   +    N  +    +A+   P S  GY    Q    ++ L +A  +    
Sbjct: 102 -AAVHSDLLEPVVDVGNWRITLLDSAV---PGSVPGYLQDSQLQLLAQALSEAPARH--H 155

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++  HH PV    +    +          ++        +L GH H      I  E+  +
Sbjct: 156 LVCFHHHPVSIGCAWMEPIGLRNPDALFAVLDRFPQVRAVLWGHVHQ----EIDRERNGV 211

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            ++   S   +            F + ++   +    + +        +++     F
Sbjct: 212 RLLASPSTCIQFAPGSED-----FKVSEQAPGYR-WLRLHADGRLETGVERVQGFAF 262


>gi|83647079|ref|YP_435514.1| phosphohydrolase [Hahella chejuensis KCTC 2396]
 gi|83635122|gb|ABC31089.1| predicted phosphohydrolase [Hahella chejuensis KCTC 2396]
          Length = 275

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 52/294 (17%), Positives = 95/294 (32%), Gaps = 41/294 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +  +SD H                                V   L+  +     + +  +
Sbjct: 3   IIQLSDPHFGTE-------------------------DWTVQEALVRTLNDMRPELLLFS 37

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GDI       +   +  +L  I    ++  VPGNHD  +     +    +K Y     T 
Sbjct: 38  GDITQRATRLQFAAARAFLERIEA-DNVLAVPGNHDIPLFNLWSRLTAPYKKYCEIFGTD 96

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
              +         N   ++G +T         +G    ++A A ++ L  A  K   R++
Sbjct: 97  LEPE------FENNLALIVGVNTTHKY--RHVDGEISPQRADAVARRLASAPDK--LRVV 146

Query: 192 MMHHPP-VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHW----IKNEKKLI 246
           + HHP  V+  S   N + G +   K     G DL+L GH H   +             +
Sbjct: 147 VAHHPCQVVLPSDQKNLLIGREYALKAWIEAGVDLVLGGHIHYPFILPLRESFPEAPSGV 206

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
            V+   +A+     +    S+N   + +      LE   Y  +     +   +S
Sbjct: 207 FVMQAGTATSPRVRSGKPNSFNRILVRRDRRMTLLERWDYDSATGRFRVALRFS 260


>gi|332158280|ref|YP_004423559.1| lacZ expression regulatory protein [Pyrococcus sp. NA2]
 gi|331033743|gb|AEC51555.1| lacZ expression regulatory protein [Pyrococcus sp. NA2]
          Length = 502

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 55/294 (18%), Positives = 100/294 (34%), Gaps = 52/294 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD H++   +F   +                       +L+ N++     D V
Sbjct: 1   ML-IAHISDTHITNEVAFKSYAY----------------------DLIANEVNTKPFDLV 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ N     E   +++ LR I  P  + +VPGNHDA                    
Sbjct: 38  IHTGDVTNNGLREEYEHASYLLRKIEKP--LVVVPGNHDARNV---------------GY 80

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +    +  LI   +   T P  ++G  G  +     + L + + K   
Sbjct: 81  ELFEKYIGPLSGVYEFKDGVLIWIDS---TIPDLSDGRVGGYKFKWLKEKLEEYSHKRIK 137

Query: 189 RIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            +   HH  P+ DT    N +F       ++      L + GH H+ +++ ++     + 
Sbjct: 138 IVAAHHHLVPLPDTGRERNVLFNAGDVLDLLLSHEVTLYMCGHKHVPNVYRVE----DLV 193

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
           V     AS +        SYN+  I +      ++     L+ +    +     
Sbjct: 194 VDNAGCASCRKTRKGDVNSYNIVKITEDG----VKVVIRRLTGEEERKEHKPIR 243



 Score = 71.2 bits (172), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 44/268 (16%), Positives = 76/268 (28%), Gaps = 51/268 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHV 68
             + H+S                        + + + YF K      I  I      D V
Sbjct: 255 LRIVHVS----------------------ESNVSDRVYFRKRTLENAIRAINEKYKPDIV 292

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
              GD+V     R    +  +   +     I     +         ++            
Sbjct: 293 VHCGDVVEKGIERYYEKAFEYYEKVKAEKIIVPGHNDISYLGYELFKEYF---------- 342

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                     P +  R N   I   +A         G  GQ+      +   +      F
Sbjct: 343 --------GEPEIVERGNFVFIPILSAQYETQIGVVGRTGQKMLANLLEDFSE-----KF 389

Query: 189 RIIMMHHPPVL-DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           RI++MHH  V          +       K+I  +  +L L GH    S   ++      P
Sbjct: 390 RIVIMHHNVVPVPGVREIGYLEDAGNVLKIITEKETELTLTGHGGNTSAVKVE----KSP 445

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKK 275
           ++   S S ++H N    S+N+  I + 
Sbjct: 446 IINAGSISWELHRNPFGNSFNIIDIYED 473


>gi|295090678|emb|CBK76785.1| Predicted phosphohydrolases [Clostridium cf. saccharolyticum K10]
          Length = 566

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 43/302 (14%), Positives = 91/302 (30%), Gaps = 24/302 (7%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
               SDIH   SP   +   +     V W   +   +   + +  + +      D + ++
Sbjct: 109 FIVASDIHY-QSPKMTDFVGEAFCQFVRWDDGKVIPYLDTITDAFLEEAAEKQPDALILS 167

Query: 72  GDIVNFTCNREIFTSTH-WLRSIGNPHDISIVPGNHDAYISGAKE--------------K 116
           GD+                 +       + ++PGNHD     A                 
Sbjct: 168 GDLTQNGELVNHEELAEKLRKVEEQGVPVLVIPGNHDINHPEASYFEGAERKKADNITAD 227

Query: 117 SLHAWKDYITSDTTCSTGKKLFPYLRIRNN-IALIGCSTAIATPPFSANGYFGQEQAHAT 175
             ++       D      +    Y+   ++   L+   +    P     G   +E     
Sbjct: 228 DFYSIYREFGYDEAMDRDEASLSYMYRADDRYWLMMLDSCQYDPENKIGGRIRKETLAWM 287

Query: 176 SKLLRKANKKGFFRIIMMHHPPVLDTS--SLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
           S  L KA ++    I + HH  + +++       +    +  +++   G  + + GH HL
Sbjct: 288 SGWLEKAREENVLVIPIAHHNLLKESTLYPEDCTLENSSQAAELLESYGLPVYISGHLHL 347

Query: 234 NSL--HWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN--EYWTLEGKRYTLS 289
             +  +      +  P+ GI           P   Y     ++    +Y T      + +
Sbjct: 348 QRIKKNINGGPSQTEPLYGIYEIVSDSM-AIPPCQYGELRWQEDGSFDYRTCRIDVESWA 406

Query: 290 PD 291
            D
Sbjct: 407 RD 408


>gi|260582337|ref|ZP_05850130.1| lacZ expression regulator [Haemophilus influenzae NT127]
 gi|260094705|gb|EEW78600.1| lacZ expression regulator [Haemophilus influenzae NT127]
          Length = 274

 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 85/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-- 63
              +  L  I+D HL    S   L                   ++     ++ +I     
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  QFDVILATGDLVQDSSDEGYTRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                           +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NAAKHLLLGKHWQAVLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLSPFTNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTQVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|145628762|ref|ZP_01784562.1| predicted phosphohydrolase [Haemophilus influenzae 22.1-21]
 gi|144979232|gb|EDJ88918.1| predicted phosphohydrolase [Haemophilus influenzae 22.1-21]
          Length = 274

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 86/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-- 63
              +  L  I+D HL    S   L                   ++     ++ +I     
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  QFDVILATGDLVQDSSDEGYIRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                        +  +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NVAKHLLLGEHWQALLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLIVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFSNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTEVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|304398354|ref|ZP_07380228.1| metallophosphoesterase [Pantoea sp. aB]
 gi|304354220|gb|EFM18593.1| metallophosphoesterase [Pantoea sp. aB]
          Length = 276

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 48/275 (17%), Positives = 85/275 (30%), Gaps = 42/275 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +A ISD+H+                        K+  +      +I+ +       D V 
Sbjct: 8   IAQISDLHIKAHGRLS----------------YKQVDTHAALLQVIDTLNSLQPRPDAVV 51

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+V+F    E  T    L+ +  P    ++ GNHD                    D 
Sbjct: 52  ITGDLVDFGRPDEYQTLREALQRLQPP--FYLMAGNHDDR----------EALRAAFPDH 99

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                     +      + LI   +++   P+   G   +EQ     + L  +  +    
Sbjct: 100 GYLQSGPTLNWQLSVGGVRLIALDSSVPQQPW---GEVDEEQLEWLDQALGMSADQPT-- 154

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++M+HHPP     +  +R      Q F+ +I      + +L GH H +            
Sbjct: 155 LVMLHHPPFACGIAHMDRQRLRHPQAFEAIIARHPQVERVLCGHLHRSLQTRFAG----T 210

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
                   S +V  +        F +E        
Sbjct: 211 LACVAPGVSHQVALDLHPEGPAHFILEPPGYLLHC 245


>gi|254000140|ref|YP_003052203.1| metallophosphoesterase [Methylovorus sp. SIP3-4]
 gi|253986819|gb|ACT51676.1| metallophosphoesterase [Methylovorus sp. SIP3-4]
          Length = 268

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 49/299 (16%), Positives = 96/299 (32%), Gaps = 40/299 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++AH+SD H                                V   L + +       +
Sbjct: 1   MTLIAHLSDPHFGTE-------------------------QPAVMQALQSLLWQQAPHLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  ++ S+  PH   ++PGNHD  +     + L  ++ +  + 
Sbjct: 36  ILSGDITQRARRSQFKHARAFVDSLNIPHR-LVIPGNHDIPLFNLLARLLTPYRRHRHAF 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +   +    I  +T  A      +G     Q     + L++A+ +   
Sbjct: 95  GQELEP------VYRDDKTLAITVNTTRAY--RHEDGEVSPAQIKRVCEQLQQASPQQLR 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE----KK 244
            +I      V +     N + G Q   +     GADLIL GH HL  +  +  +    + 
Sbjct: 147 LVITHQPVYVTEVRDESNLLHGYQAAVRAWAEAGADLILGGHIHLPFVMALHEKRPDIRH 206

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            I  V   +A           S NL   + +        +R+  +       +  ++  
Sbjct: 207 RIWAVQAGTAVSTRIRRNAGNSINLIRYQARQTP--CMVERWDYTAAQQQFVQVSAEAL 263


>gi|282865934|ref|ZP_06274983.1| metallophosphoesterase [Streptomyces sp. ACTE]
 gi|282559258|gb|EFB64811.1| metallophosphoesterase [Streptomyces sp. ACTE]
          Length = 262

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 46/264 (17%), Positives = 80/264 (30%), Gaps = 33/264 (12%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M VLAH+SD HL  +      + + +  L                           VD V
Sbjct: 1   MTVLAHLSDPHLDGTEESAARAHRAVAHLAGLPG---------------------RVDAV 39

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGDIV+     E   +   L  +   H++ + PGNHD+     +           +  
Sbjct: 40  LITGDIVDRGTAEEYHQAREVLAPLYERHEVLLCPGNHDSRAPYREVLLGGGGGGSGSGG 99

Query: 129 TTCSTGK-KLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                G       +R    + ++ C +++   P    G             L  A  +  
Sbjct: 100 GDDGGGGTAPVNEVRDVGGVRVLMCDSSVPGRP---EGLLEAATLSWLDDALAAAPDRPA 156

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLI 246
           F  +     P+         +       K++        +L GH H  +          +
Sbjct: 157 FVALHHPPVPLGLPYIDRIGLREPDALAKVLARHAQVVAVLCGHAHTAAATSFAG----L 212

Query: 247 PVVGIA---SASQKVHSNKPQASY 267
           P++      S +       P AS+
Sbjct: 213 PLLCAPGIASTALLPWEQGPDASW 236


>gi|124022087|ref|YP_001016394.1| serine/threonine specific protein phosphatase [Prochlorococcus
           marinus str. MIT 9303]
 gi|123962373|gb|ABM77129.1| Serine/threonine specific protein phosphatase [Prochlorococcus
           marinus str. MIT 9303]
          Length = 263

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 48/292 (16%), Positives = 96/292 (32%), Gaps = 47/292 (16%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             L  +SD HL                    H   +           +   + H+ D + 
Sbjct: 1   MRLVQLSDPHLVAF----------------NHRLVRDQNPLLNFQCALQQGMSHSPDLLL 44

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+ +             L+++     ++++PGNHD  +        HA+        
Sbjct: 45  ITGDLCHDESWCGYVLLRDELQNLSPSIKVAVLPGNHDNPLFIKAALGRHAF-------- 96

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                    P     + + LI  S+ ++       G  G+ Q       L    + G   
Sbjct: 97  -------TAPADLNLDGVRLILLSSHVSGR---TAGQLGESQLQWLDSRLSDIEQSGRPL 146

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGAD---LILHGHTHLNSLHWIKNEKKLI 246
           ++ +HHPP+   SS  + +  +     +      D    ++ GH H +       E+K +
Sbjct: 147 VVAVHHPPLPIGSSWLDAIGLVDGEALIKLLTPVDELCAVVCGHIHQHWQGLFP-ERKDV 205

Query: 247 PVVGIASASQKVH-------SNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
            V+G  S               + +    L  +++   ++  +  R++  PD
Sbjct: 206 LVLGCPSTLCSFKAVQPCLLGREDEPGGRLIELDESGNFFE-KLLRWSY-PD 255


>gi|117919180|ref|YP_868372.1| calcineurin phosphoesterase C-terminal domain-containing protein
           [Shewanella sp. ANA-3]
 gi|117611512|gb|ABK46966.1| Calcineurin phosphoesterase C-terminal domain protein [Shewanella
           sp. ANA-3]
          Length = 279

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/276 (12%), Positives = 73/276 (26%), Gaps = 46/276 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  ++D HL   P    L               +                      +  
Sbjct: 17  RIVQVTDPHLFADPEAQLLGVNTSKSFAAVLNTIRAVDYPAHL--------------MLA 62

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD                Y+     
Sbjct: 63  TGDLSQDYSPESYRQFVAAVAPLNLPC--HYLPGNHDDPRIM-----------YLHMQGE 109

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G++      +     ++   + +   P    G   + Q     + +     +    +
Sbjct: 110 RIFGQQRI----LAGKWQILMLDSTVRGKPG---GNMAESQFELIEQAIAAHPDRHT--L 160

Query: 191 IMMHHPPVLDTSSL---YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           ++MHH P+L   +    +    G +  +++  +     +L GH H             + 
Sbjct: 161 LVMHHNPILVNCAWLDQHCMDNGTEFLRRVAQYPQVKGLLWGHVHQQLDTDYDGPHGPLQ 220

Query: 248 VVGIASASQKVHSNKP-------QASYNLFYIEKKN 276
           ++   S   +     P       Q  Y L  ++   
Sbjct: 221 LMATPSTCIQFKPQSPYFALDGLQPGYRLLELKADG 256


>gi|295113016|emb|CBL31653.1| Predicted phosphohydrolases [Enterococcus sp. 7L76]
          Length = 272

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 92/272 (33%), Gaps = 38/272 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-VDHVSI 70
           + H+SDIH   +    +   K ++         K           +  +L    +D V I
Sbjct: 3   ILHLSDIHFRRNYEKAKDGYKVMLT--------KMENPLIRLESSLTSLLKIKKIDLVII 54

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+       +       L++I     + +  GNHD              K++      
Sbjct: 55  SGDLTEDGEPEDYAFLKQKLQTILQGIPMIVTLGNHDI------------KKNFRIGWLN 102

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               ++ +  ++      +I    +    P   +G+  +EQ       L+K + K    I
Sbjct: 103 QIGTERPYNVVQTYPEFHIISLDNSEHDNP---DGHMNKEQKDWLQTTLKKLSDKP---I 156

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           +++ H  +L   S    +   +   +++       +L GHTH   LH I      IP   
Sbjct: 157 LLVMHHHLLREQSSMPTLPEAEETIQLLKGSDILGVLTGHTHHPYLHHING----IPYYT 212

Query: 251 IASASQKVHSNKP-------QASYNLFYIEKK 275
           +A  S                  YNL+ I+K 
Sbjct: 213 VAGMSFVGEDEGQGIVRFEENYGYNLYSIDKG 244


>gi|260429500|ref|ZP_05783477.1| metallophosphoesterase [Citreicella sp. SE45]
 gi|260420123|gb|EEX13376.1| metallophosphoesterase [Citreicella sp. SE45]
          Length = 282

 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 49/303 (16%), Positives = 92/303 (30%), Gaps = 50/303 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD+H   +                           E+ N L+  +     D V
Sbjct: 1   MTRIAHISDLHFGRT-------------------------DVELLNPLLAAVNGARPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD        +   +  +L  +  P     VPGNHD  +     + +  +K Y    
Sbjct: 36  AVTGDFTQRARVSQYREARAFLDRLEAP--WMAVPGNHDVSLDNLWMRFIRPYKRYREHI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                             I  +G +T             G+ +     +  R   +    
Sbjct: 94  CNDLFPT------FRGAGIVAVGLNTVDRYRWQR-----GKVRWFQLRQACRIFGESEGT 142

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           ++++ HHP   D     + M G  +  + +   GA ++L GH H        + K    V
Sbjct: 143 KLVLAHHPFEQDADVKKSLMRGANKAIEQLSDCGAHIVLSGHLHRWRAEPFLSRKNRSQV 202

Query: 249 VGIA-SASQKVHSNKPQASYNLFY-----------IEKKNEYWTLEGKRYTLSPDSLSIQ 296
           + I             +  + L             I +   +     +R+    +    +
Sbjct: 203 LQIHVGTGLSTRLRGQENDFALLDVAQDEVAVTRMIARDGAFAEAGVRRFVYGDEGWKER 262

Query: 297 KDY 299
           +D 
Sbjct: 263 RDT 265


>gi|330898831|gb|EGH30250.1| metallophosphoesterase [Pseudomonas syringae pv. japonica str.
           M301072PT]
          Length = 277

 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRQNLLAAFAEQEYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|110680727|ref|YP_683734.1| Ser/Thr protein phosphatase family protein, putative [Roseobacter
           denitrificans OCh 114]
 gi|109456843|gb|ABG33048.1| Ser/Thr protein phosphatase family protein, putative [Roseobacter
           denitrificans OCh 114]
          Length = 267

 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 43/295 (14%), Positives = 88/295 (29%), Gaps = 51/295 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN---- 64
           M  + HI+D H+    +                    +  + +    L+  I        
Sbjct: 1   MTTILHITDTHIVPEGALVS----------------GRLDTADALERLVARINSIRDQIG 44

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
            VD V ++GD+ +             +  +G P  I ++PGNHD   +            
Sbjct: 45  AVDAVLVSGDLSDDGSAESYKRFKRLVAPLGLP--IHVIPGNHDGRAT------------ 90

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
              +            ++R   ++ LIG  T +        G    E     S  L +A 
Sbjct: 91  LRAAFAEQFAPTGPLNWVRSIGDLHLIGLDTLVEGQ---GGGRLAPESLSFLSDALSQA- 146

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADL-ILHGHTHLNSLHWIK 240
            +G   ++ +HH P L      + +         +++      L +L GH H   +  + 
Sbjct: 147 -EGAPVLLALHHQPFLCGIGFMDAIGLSNKNALSEIVAGYQGPLRLLCGHIHSTMISDVG 205

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
                   +   S       +    +   +  ++          R+     ++ I
Sbjct: 206 GH----IAISCPSPCSSFAFDCRPDAPRGYMHQEDG----CLLHRWDGGFQTIRI 252


>gi|213967739|ref|ZP_03395886.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato T1]
 gi|301382376|ref|ZP_07230794.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato Max13]
 gi|302062353|ref|ZP_07253894.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato K40]
 gi|302130671|ref|ZP_07256661.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato NCPPB 1108]
 gi|213927515|gb|EEB61063.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tomato T1]
          Length = 277

 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGMVDTLGALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRENLLAAFADQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                       ++  +  + LIG  T   T P    G     Q    +  L  + +   
Sbjct: 103 ----LAASGPLDWVVEQYPLRLIGMDT---TIPGEHGGRLDYCQLDWLNAQL--SRRPDV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVLHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLEEAAPAHFNLEPAG 241


>gi|188025650|ref|ZP_02959353.2| hypothetical protein PROSTU_01194 [Providencia stuartii ATCC 25827]
 gi|188022620|gb|EDU60660.1| hypothetical protein PROSTU_01194 [Providencia stuartii ATCC 25827]
          Length = 285

 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 36/300 (12%), Positives = 78/300 (26%), Gaps = 55/300 (18%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  ++D HL    +   L                      V + ++       +D +  
Sbjct: 22  RILQVTDTHLFADTANTLLGINTHKSY------------HAVLDAILEQ--NLPIDLIVA 67

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+V              +  +  P     +PGNHD   +                 + 
Sbjct: 68  TGDLVQDQSPEAYQHFAKGIERL--PAPCVWLPGNHDYQPAMVS--------------SL 111

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      + I +   ++   + +   P    G   ++Q       L    +     +
Sbjct: 112 KLAGISSAKEILIGDEWQILMLDSQLQDVPH---GELSEQQLEWMKSCLD--KRPQRTTL 166

Query: 191 IMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           +M+HH P+    +  ++            +       ++L GH H     +       I 
Sbjct: 167 VMLHHHPLPSGCTWLDQHSLRNSHILADYLKGYPQVKVMLCGHIHQEMDEYWHG----IR 222

Query: 248 VVGIASASQKVHSNKPQ-------ASYNLFYIEKKNEYWT------LEGKRYTLSPDSLS 294
           ++   S   +   +            +    +    +                 SPD  S
Sbjct: 223 LLATPSTCVQFKPHCTNFALDTVAPGWRYLELSINEKGERHISTQVCRLNTKEFSPDFDS 282


>gi|238789176|ref|ZP_04632964.1| hypothetical protein yfred0001_30170 [Yersinia frederiksenii ATCC
           33641]
 gi|238722708|gb|EEQ14360.1| hypothetical protein yfred0001_30170 [Yersinia frederiksenii ATCC
           33641]
          Length = 282

 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/302 (13%), Positives = 85/302 (28%), Gaps = 50/302 (16%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +     +  I+D HL        L                    + V + +I +      
Sbjct: 18  SGAKARILQITDTHLFAGEYETLLGINTSRSY------------RAVLDAIIAE--QRPF 63

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D +  TGD+               +  +  P     +PGNHD   +              
Sbjct: 64  DLIVATGDLAQDHSVAAYQNFAKGISRL--PAPCVWLPGNHDFQPAMV------------ 109

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D    +G     ++ + +N  ++   + +   P+   G     Q     + L   +++
Sbjct: 110 --DALADSGIAPSKHVLVGDNWQILLLDSQVFGVPY---GELSDYQLEWMERCLVTHSER 164

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
               ++  H  P   T    + +        ++        +L GH H +       +  
Sbjct: 165 YTLVLLHHHPMPSGCTWLDQHSLRNAHMLAAVLTRYPRVTTLLCGHIHQDLDLDWYGK-- 222

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS---LSIQKDYSD 301
              ++   S   +   +        F ++     W        L PD      +++  SD
Sbjct: 223 --RLLASPSTCVQFKPHCTN-----FTLDTVAPGWRY----LDLLPDGILETEVRRLASD 271

Query: 302 IF 303
            F
Sbjct: 272 EF 273


>gi|88705317|ref|ZP_01103028.1| icc protein [Congregibacter litoralis KT71]
 gi|88700407|gb|EAQ97515.1| icc protein [Congregibacter litoralis KT71]
          Length = 278

 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/288 (13%), Positives = 80/288 (27%), Gaps = 56/288 (19%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           ++ R  T+   +  ++D HL        L                   +      +I+ +
Sbjct: 11  LSVRSETV--RVVQLTDTHLKAHDGGKLLG----------------LDTDYSLQAVIDLV 52

Query: 61  LLH--NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSL 118
                + D V  TGD+ +            +   +   H    +PGNHD           
Sbjct: 53  NSEYPDPDFVLGTGDLADSGAGDAYNRLIGYFDQVSTEH--FWLPGNHD----------- 99

Query: 119 HAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
                 +        G +  P         ++   + +        G+ G+ +     + 
Sbjct: 100 ------LREVMADVGGARRLPGEIRVGAWQIVMLDSQLPGEVG---GHLGRGELQRLEEC 150

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEG-ADLILHGHTHLNS 235
           L  + + G + +I MHH PV           +     F +++        +L GH H   
Sbjct: 151 LAASAEAGLYTLICMHHQPVPVGCDWLDEQMVSDADSFFEILGRYPQVRGVLWGHVHQAL 210

Query: 236 LHWIKNEKKLIPVVGIASASQKVHS-------NKPQASYNLFYIEKKN 276
               +     + ++   S   +          +     Y    +E   
Sbjct: 211 DQRCE----DLRLLCTPSTCVQFLPKQTDFAVDSRAPGYRWLELEPDG 254


>gi|145630428|ref|ZP_01786209.1| predicted phosphohydrolase [Haemophilus influenzae R3021]
 gi|145636333|ref|ZP_01792002.1| predicted phosphohydrolase [Haemophilus influenzae PittHH]
 gi|144984163|gb|EDJ91600.1| predicted phosphohydrolase [Haemophilus influenzae R3021]
 gi|145270498|gb|EDK10432.1| predicted phosphohydrolase [Haemophilus influenzae PittHH]
          Length = 274

 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 39/301 (12%), Positives = 84/301 (27%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-- 63
              +  L  I+D HL    S   L                   ++     ++ +I     
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 64  NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  QFDVILATGDLVQDSSDEGYTRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                           +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NAAKHLLLGEHWQAVLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
            +    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ARYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLVPFTNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTQVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|159030520|emb|CAO91424.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 378

 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 45/270 (16%), Positives = 87/270 (32%), Gaps = 32/270 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD H++   +    S                  S     ++++ ++  N+D + 
Sbjct: 3   FRFAILSDPHIALPTTILNHSN----------RFHLVEVSIPALKIVLDHLITLNLDFLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGA-KEKSLHAWKDYITSD 128
           I GD+               L ++  P  + +VPGNHD     A + +   A   +    
Sbjct: 53  IAGDLTQDGEPENHRWLADCLATL--PFPVYVVPGNHDVLSLTATENQIGLADFPFYYQQ 110

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              S  ++++    I   + LIG ++          G    EQ H   + L         
Sbjct: 111 FGYSHPEQIYYQKEILPGVQLIGLNSNQFDEQGKQIGSLDAEQLHWLKQTLPALKND--L 168

Query: 189 RIIMMHHPPV-------LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+HH  +                +        ++   G  L++ GH H+  L + + 
Sbjct: 169 VMVMIHHNVIEHLPGQSNHELGKRYMLANAVELLDILEENGVKLLITGHLHVQDLAFSRG 228

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFY 271
               I  +   S     H       Y +  
Sbjct: 229 ----IYEITTGSLVSYPHP------YRVLE 248


>gi|114762136|ref|ZP_01441604.1| possible phospodiesterase [Pelagibaca bermudensis HTCC2601]
 gi|114545160|gb|EAU48163.1| possible phospodiesterase [Roseovarius sp. HTCC2601]
          Length = 275

 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 48/296 (16%), Positives = 90/296 (30%), Gaps = 44/296 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD+H   +                           E+ + L++ +     D V
Sbjct: 1   MTRIVHISDLHFGRT-------------------------DVELLDPLVDAVNATQADLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           ++TGD      N +   +  +L     P     VPGNHD  +     + +  ++ Y    
Sbjct: 36  AVTGDFTQRARNSQYRDARAFLDRFEAP--WLAVPGNHDISLDNLWLRLMRPFRRYRDHI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +   +    +G +T          G     Q     K+   +++    
Sbjct: 94  CNDLFP------VHRGDGFVAVGLNTVDQYRW--QRGRIRWRQMRNACKIFSDSDE--AI 143

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           R+++ HHP   D     + M   ++  + +   GA L+L GH H        + K    V
Sbjct: 144 RVVLAHHPFEQDQDVKKSLMPKAEKAIEQLAECGAHLLLSGHLHRWRAEPFLSRKHGAQV 203

Query: 249 VGIA-SASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           + I             +  + +  ++      T    R              S  F
Sbjct: 204 LQIHVGTGLSTRLRGQENDFAVLDLDADEAKVTRMVAR------GEQFVPAGSRSF 253


>gi|315497135|ref|YP_004085939.1| metallophosphoesterase [Asticcacaulis excentricus CB 48]
 gi|315415147|gb|ADU11788.1| metallophosphoesterase [Asticcacaulis excentricus CB 48]
          Length = 257

 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 55/290 (18%), Positives = 98/290 (33%), Gaps = 44/290 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +AHISD+H                              + V   LI+ ++    D V 
Sbjct: 1   MRIAHISDLHFGA-------------------------HDRRVTETLISTLIELEPDLVV 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            +GDI       E   ++ + + +  P    ++PGNHD      + + +  WK Y     
Sbjct: 36  ASGDITQDATVAEFVEASEFFKLL--PMPAFVIPGNHDLPGLDLR-RFIQPWKRYRDHIA 92

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPP--FSANGYFGQEQAHATSKLLRKANKKGF 187
                +     +       + G ++A    P    A G     Q H  +     A     
Sbjct: 93  RELEPELQADLV------DIKGINSARMILPSLNWAYGSISARQRHDIADFF--AASTTP 144

Query: 188 FRIIMMHHPPVLDTSSLYNRM-FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           +R++ +HHPP+       +   F   +F + +  +  D++L GH H   +          
Sbjct: 145 WRVLTVHHPPLNPPEFPLDVTLFNKGKFLETLGEQKVDIVLSGHQHHAYVETRI-MNGHT 203

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
            +   AS +  V   K    +NL   + K    ++  +   LS D    Q
Sbjct: 204 TLFVCASTAMSVRIRKQPQGFNLLDFKDK----SVRIELRQLSGDRFMTQ 249


>gi|145634605|ref|ZP_01790314.1| lacZ expression regulator [Haemophilus influenzae PittAA]
 gi|145268150|gb|EDK08145.1| lacZ expression regulator [Haemophilus influenzae PittAA]
          Length = 274

 Score =  109 bits (271), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 88/301 (29%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN- 64
              +  L  I+D HL    S   L                   ++     ++ +I   N 
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  EFDVILATGDLVQDSSDEGYIRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                        +  +L +  +   +   + + + P    G   Q Q     + L K  
Sbjct: 110 ------------NVAKHLLLGEHWQALLLDSQVYSVPH---GQLSQHQLDLLKETLGKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFSNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTEVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|309972442|gb|ADO95643.1| cyclic 3,5-adenosine monophosphate phosphodiesterase [Haemophilus
           influenzae R2846]
          Length = 274

 Score =  109 bits (271), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 87/301 (28%), Gaps = 48/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN- 64
              +  L  I+D HL    S   L                   ++     ++ +I   N 
Sbjct: 10  EKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQENN 53

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V  + +         ++    P  +  +PGNHD     A+  +      
Sbjct: 54  EFDVILATGDLVQDSSDEGYIRFVEMMKPFNKP--VFWIPGNHDFQPKMAEFLNQPPM-- 109

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                        +  +L +  +   +   + +   P    G   Q Q     + L K  
Sbjct: 110 ------------NVAKHLLLGEHWQALLLDSQVYGVPH---GQLSQHQLDLLKETLEKNP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        + +       +++        IL+GH H          
Sbjct: 155 ERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLSPFTNVKAILYGHIHQEVNSEWNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   +   +   +        F ++     W  E + ++       +++     
Sbjct: 214 ---YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTQVKRIQQAE 264

Query: 303 F 303
           F
Sbjct: 265 F 265


>gi|226327151|ref|ZP_03802669.1| hypothetical protein PROPEN_01016 [Proteus penneri ATCC 35198]
 gi|225204369|gb|EEG86723.1| hypothetical protein PROPEN_01016 [Proteus penneri ATCC 35198]
          Length = 287

 Score =  109 bits (271), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/295 (15%), Positives = 86/295 (29%), Gaps = 48/295 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL  +     L                      V N +       +VD +  
Sbjct: 24  RILQITDTHLFANVEDTLLGINTYRSY------------HAVLNAIREQ--GLDVDLIVA 69

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+V              + ++  P     +PGNHD   +                D  
Sbjct: 70  TGDLVQDQTFEAYQHFADGIATLTPPC--VWLPGNHDYQPAMI--------------DAL 113

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      + I +N  ++   + I   P    G     Q    ++ L     +    I
Sbjct: 114 NQAGVLSAKQVLIGDNWQMLLLDSQIQGVPH---GELSDCQLDWLTRCLESQKHRDT--I 168

Query: 191 IMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLIP 247
           I++HH P+    +  ++      Q   + +       ++L GH H             I 
Sbjct: 169 ILLHHHPMPSGCTWLDQHSLRNSQELAERLREHSQVKMMLCGHIHQEMDEMWNG----IR 224

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
           ++   S   +   +        F ++  +  W    +   LS +   I+     +
Sbjct: 225 LLATPSTCIQFRPHCTN-----FTLDTVSPGWRY-LEMSLLSDEKGRIETQVYRL 273


>gi|313202104|ref|YP_004040762.1| metallophosphoesterase [Methylovorus sp. MP688]
 gi|312441420|gb|ADQ85526.1| metallophosphoesterase [Methylovorus sp. MP688]
          Length = 268

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 49/299 (16%), Positives = 96/299 (32%), Gaps = 40/299 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++AH+SD H                                V   L + +       +
Sbjct: 1   MTLIAHLSDPHFGTE-------------------------QPAVMQALQSLLWQQAPHLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI       +   +  ++ S+  PH   ++PGNHD  +     + L  ++ +  + 
Sbjct: 36  ILSGDITQRARRSQFKHARAFVDSLNIPHR-LVIPGNHDIPLFNLLARVLAPYRRHRHAF 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +   +    I  +T  A      +G     Q     + L++A+ +   
Sbjct: 95  GQELEP------VYRDDKTLAITVNTTRAY--RHEDGEVSPAQIKRVCEQLQQASPQQLR 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE----KK 244
            +I      V +     N + G Q   +     GADLIL GH HL  +  +  +    + 
Sbjct: 147 LVITHQPVYVTEVRDESNLLHGYQAAVRAWAEAGADLILGGHIHLPFVMALHEKRPDIRH 206

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            I  V   +A           S NL   + +        +R+  +       +  ++  
Sbjct: 207 RIWAVQAGTAVSTRIRRNAGNSINLIRYQARQTP--CMVERWDYTAAQQQFVQVSAEAL 263


>gi|308187731|ref|YP_003931862.1| Protein icc [Pantoea vagans C9-1]
 gi|308058241|gb|ADO10413.1| Protein icc [Pantoea vagans C9-1]
          Length = 276

 Score =  108 bits (270), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 45/275 (16%), Positives = 84/275 (30%), Gaps = 42/275 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +A ISD+H+                        K+  +      +I+ +       D V 
Sbjct: 8   IAQISDLHIKAHGRLS----------------YKQVDTYAALLQVIDTLNALQPRPDVVV 51

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+V+F    E  T    L+ +  P    ++ GNHD                    D 
Sbjct: 52  ITGDLVDFGRAEEYQTLREALQRLQLP--FYLMAGNHDDR----------EALRAAFPDH 99

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                     +     ++ L+   +++   P+   G   + Q     + L  A  +    
Sbjct: 100 AYLQAGPTLNWQLRVGDVRLLALDSSVPQQPW---GELDEPQLQWLDQALSAAADQPT-- 154

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++M+HHPP     +  +R      +  + +I      + +L GH H +            
Sbjct: 155 LVMLHHPPFACGIAHMDRQRLRHPEALEAIIARHPQVERVLCGHLHRSLQTRFAG----T 210

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
                   S +V  +        F +E        
Sbjct: 211 LACVAPGVSHQVALDLHPDGPAHFILEPPGFLLHC 245


>gi|325959395|ref|YP_004290861.1| metallophosphoesterase [Methanobacterium sp. AL-21]
 gi|325330827|gb|ADZ09889.1| metallophosphoesterase [Methanobacterium sp. AL-21]
          Length = 265

 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 54/266 (20%), Positives = 97/266 (36%), Gaps = 44/266 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            L HISD+H                         +  F +++ N L   I   N D + +
Sbjct: 5   KLIHISDLHFG-----------------------EYKFDEKLKNNLKFQIEYENPDLIVV 41

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
            GDI       +   +  +L  + N  +  +VPGNHD+   G                  
Sbjct: 42  AGDITALGYLEDYNLAREFLYELNNIAETYVVPGNHDSCNVGLVH-------------FR 88

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G++ F       +I LIG  ++    P   +G  G +Q    + +L K  +  F  +
Sbjct: 89  KLIGERRFVATDKNEDIVLIGLDSS---EPDIHDGKIGFDQIEWLNDVLNKIPRDRFTAV 145

Query: 191 IMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
              HH  P+  T    N +       K++   G +L+L+GH H+++   I      + ++
Sbjct: 146 TFHHHLLPIPQTGRERNILLDSGDVLKLLVSHGVNLVLNGHKHVSNAWKID----DMVIL 201

Query: 250 GIASASQKVHSNKPQASYNLFYIEKK 275
              +A+          SYN   ++ +
Sbjct: 202 NSGTATTNRLYGDNSPSYNKVLVDDE 227


>gi|15606092|ref|NP_213469.1| hypothetical protein aq_684 [Aquifex aeolicus VF5]
 gi|2983283|gb|AAC06876.1| putative protein [Aquifex aeolicus VF5]
          Length = 249

 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 53/299 (17%), Positives = 107/299 (35%), Gaps = 57/299 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVA-NLLINDILLHNVDHV 68
             +AHISD+H+                        K  + ++   N L+  +     D +
Sbjct: 1   MKIAHISDLHV------------------------KCEWYEDRLGNNLVKYLNAQKPDLL 36

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI--SGAKEKSLHAWKDYIT 126
            ITGD+ ++    E   +  +L  I     + +VPGNHDA        E+       Y  
Sbjct: 37  IITGDLTDYGYYAEYKRAYSFLELIEVEKRV-VVPGNHDARNEGYELFEEFFGTRMPYYE 95

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            +                  + +IG  +++   P    G+ G++      + L+    K 
Sbjct: 96  DEY-----------------MVIIGMDSSL---PDREEGHIGRKGYKFLRETLKDKGDKL 135

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
               +  H  P+  T S    +       K++   G +L+L GH H   +  +       
Sbjct: 136 KIVALHHHVVPIPATGSDLAILTDAGNLMKVVDELGVELVLTGHKHKAWVWKLN----ET 191

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYD 305
             V   +A+ +    K   S+ + Y+E +        +   ++ ++L +++ Y+  F +
Sbjct: 192 YYVTAGTATTRRLKAKDYPSFYMLYLEDEKN-----IRMEKVNTETLKVEEVYTLNFEE 245


>gi|114564490|ref|YP_752004.1| calcineurin phosphoesterase C-terminal domain-containing protein
           [Shewanella frigidimarina NCIMB 400]
 gi|114335783|gb|ABI73165.1| Calcineurin phosphoesterase C-terminal domain protein [Shewanella
           frigidimarina NCIMB 400]
          Length = 279

 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 45/296 (15%), Positives = 83/296 (28%), Gaps = 54/296 (18%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHV 68
            L  ++D HL   P    L                   + +    ++N  +      + +
Sbjct: 17  RLVQVTDPHLFADPEGQLLG----------------VNTAQSLQAVLNTFIATQYPANIL 60

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGDI               +  +  P     +PGNHD     +               
Sbjct: 61  LATGDISQDYSPESYQHFVQKIEMLDLPC--HYLPGNHDDPRLMSLRMQGEKVFGQQR-- 116

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                         I  N  ++   + +   P    GY G++Q       ++    K   
Sbjct: 117 -------------IIIGNWLILMLDSTVRGKPG---GYMGEQQFALIEAAIKATPDKH-- 158

Query: 189 RIIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
            +++MHH P+L   +    + M   + F +          +L GH H    +  +     
Sbjct: 159 VLLVMHHNPILMQCAWLDQHCMMNGEDFLQRTSRYPQVKGVLWGHVHQQVDNIHRGPHGP 218

Query: 246 IPVVGIASASQKVHS-------NKPQASYNLFYIEKKNEYWTLEGKRY---TLSPD 291
           IP++   S   +          +  Q  Y L  +            R      +PD
Sbjct: 219 IPLMATPSTCIQFKPLSSYFALDHRQPGYRLLELAGDGSI-RTNVYRVPGNRFAPD 273


>gi|282899749|ref|ZP_06307712.1| Metallophosphoesterase [Cylindrospermopsis raciborskii CS-505]
 gi|281195364|gb|EFA70298.1| Metallophosphoesterase [Cylindrospermopsis raciborskii CS-505]
          Length = 367

 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 42/277 (15%), Positives = 85/277 (30%), Gaps = 32/277 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A +SD+H++   +             +         S     +++  +   ++D + 
Sbjct: 3   FRFAIVSDLHIALPHTI----------WDHPDRFHLVEVSIPALEIVLEHLTQLDLDFLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAW-KDYITSD 128
           + GD+            ++ L  +  P    +VPGNHD  +  A  +S+      Y    
Sbjct: 53  LPGDLTQHGEPENHAWLSNRLSQL--PFPSYVVPGNHDVPVLLANHQSIGFMEFPYYYHK 110

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                    +   +I   + LIG ++          G    EQ       L K   +   
Sbjct: 111 FGYDHPDHFYYNRQILPGVRLIGLNSNTFDHHGKQIGLLDPEQFQWLESELSKIKDE--L 168

Query: 189 RIIMMHHPPVL-------DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
            ++M+HH  V           +    +   +    ++   G  L+  GH H+  +     
Sbjct: 169 VLVMIHHNVVEHLPNQATHPMANRYMLENARELVDLLVRHGVKLVFTGHLHVQDVAQSNG 228

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY 278
                  +   S     H       Y +   E+ +  
Sbjct: 229 VYD----ITTGSLVSYPHP------YRVLEYERDHLG 255


>gi|319898079|ref|YP_004136276.1| phosphohydrolase [Haemophilus influenzae F3031]
 gi|317433585|emb|CBY81969.1| predicted phosphohydrolase [Haemophilus influenzae F3031]
          Length = 273

 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 39/303 (12%), Positives = 86/303 (28%), Gaps = 49/303 (16%)

Query: 4   RYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           +    +  L  I+D HL    S   L                   ++     ++ +I   
Sbjct: 8   QTEKPVIKLLQITDPHLFKDESAELLG----------------VNTQASFAQVLKEIQQE 51

Query: 64  --NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAW 121
               D +  TGD+V  + +         ++    P  +  +PGNHD     A+       
Sbjct: 52  NNQFDVILATGDLVQDSSDEGYIRFVEMMKPFNKP--VFWIPGNHDFQPKMAEF------ 103

Query: 122 KDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
                          +  +L +  +   +   + +   P    G   Q Q     + L K
Sbjct: 104 ---------LKPPMNVAKHLLLGEHWQALLLDSQVYGVPH---GQLSQHQLDLLKETLGK 151

Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIK 240
             ++    ++  H  P        + +       +++        IL+GH H        
Sbjct: 152 NPERYTLVVLHHHLLPTNSAWLDQHNLRNSHELAEVLAPFSNVKAILYGHIHQEVNSEWN 211

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
                  V+   +   +   +        F ++     W  E + ++       +++   
Sbjct: 212 G----YQVMATPATCIQFKPDC-----QYFSLDTLQPGWR-EIELHSDGSIRTQVKRIQQ 261

Query: 301 DIF 303
             F
Sbjct: 262 AEF 264


>gi|302185787|ref|ZP_07262460.1| metallophosphoesterase [Pseudomonas syringae pv. syringae 642]
          Length = 277

 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQIP--FYLVPGNHDDRHNLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|315160399|gb|EFU04416.1| Ser/Thr protein phosphatase family protein [Enterococcus faecalis
           TX0645]
          Length = 272

 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 92/272 (33%), Gaps = 38/272 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-VDHVSI 70
           + H+SDIH   +    +   K ++         K           +  +L    +D V I
Sbjct: 3   ILHLSDIHFRRNYEKAKDGYKGMLT--------KMENPLIRLESSLTSLLKIKKIDLVII 54

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+       +       L++I     + +  GNHD              K++      
Sbjct: 55  SGDLTEDGEPEDYAFLKQKLQTILQGIPMIVTLGNHDI------------KKNFRIGWLN 102

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
               ++ +  ++      +I    +    P   +G+  +EQ       L+K + K    I
Sbjct: 103 QIGTERPYNVIQTYPEFHIISLDNSEHDNP---DGHMNKEQKDWLQTTLKKLSDKP---I 156

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
           +++ H  +L   S    +   +   +++       +L GHTH   LH I      IP   
Sbjct: 157 LLVMHHHLLREQSSMPTLPEAEETIQLLKGSDILGVLTGHTHHPYLHHING----IPYYT 212

Query: 251 IASASQKVHSNKP-------QASYNLFYIEKK 275
           +A  S                  YNL+ I+K 
Sbjct: 213 VAGMSFVGEDEGQGIVRFEENYGYNLYSIDKG 244


>gi|119896431|ref|YP_931644.1| phosphodiesterase [Azoarcus sp. BH72]
 gi|119668844|emb|CAL92757.1| probable phosphodiesterase [Azoarcus sp. BH72]
          Length = 282

 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 45/295 (15%), Positives = 90/295 (30%), Gaps = 43/295 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD H                                V   L++ +    +D  
Sbjct: 1   MAALLHLSDPHFGTE-------------------------RAPVVEALLHCVARQTIDVA 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNP---HDISIVPGNHDAYISGAKEKSLHAWKDYI 125
            I+GDI       +   +  ++  +        + ++PGNHD  +   + + L  +  + 
Sbjct: 36  VISGDITQRARRHQFDAARAFVERLRAGLNGAPVLVLPGNHDIPLYALQRRLLRPFAGFR 95

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                              +++ L   +T   +     +G    +Q    ++ L  A   
Sbjct: 96  RVFGPQLEA------CHEDDSLQLQLVNTV--SRWRHTDGVVRADQVERVARRLEAARPG 147

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI-----K 240
               I+      V+      + + G +R  +     GADL+L GH HL  +  +      
Sbjct: 148 QLRVIVTHQPAAVVRPQDASDLLRGRERALRRWAAAGADLLLGGHIHLPYVQPLALPGPD 207

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
              + + VV   +A      ++   S+NL              +R+         
Sbjct: 208 GAPRPLWVVQAGTALSHRIRHEAGNSFNLIR--HGAGASACVVERWDYDEAEHRF 260


>gi|66047915|ref|YP_237756.1| metallophosphoesterase [Pseudomonas syringae pv. syringae B728a]
 gi|63258622|gb|AAY39718.1| Metallophosphoesterase [Pseudomonas syringae pv. syringae B728a]
 gi|330970896|gb|EGH70962.1| metallophosphoesterase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 277

 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRHNLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|318604196|emb|CBY25694.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia enterocolitica
           subsp. palearctica Y11]
          Length = 275

 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 38/294 (12%), Positives = 82/294 (27%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D +  
Sbjct: 16  RVLQITDTHLFAGEHETLLGVNTSRSY------------RAVLDAIIAE--QHPFDLIVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHSVAAYQNFAKGISRL--PAPCVWLPGNHDFQPAMV--------------DAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            + G     ++ + +N  ++   + +   P+   G   + Q     + L    ++    +
Sbjct: 106 ANAGIAPSKHVLVGDNWQILLLDSQVFGVPY---GELSEYQLEWMERCLMAHPERYTLIL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 163 LHHHPMPSGCTWLDQHSLRNAHMLAAVLTRYPRVTTLLCGHIHQDLDLNWYGK----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               +++  SD F
Sbjct: 219 ASPSTCVQFKPHCTN-----FTLDTVAPGWRY-LDLLPDGRLETEVRRLASDEF 266


>gi|37521440|ref|NP_924817.1| hypothetical protein glr1871 [Gloeobacter violaceus PCC 7421]
 gi|35212437|dbj|BAC89812.1| glr1871 [Gloeobacter violaceus PCC 7421]
          Length = 318

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/285 (17%), Positives = 82/285 (28%), Gaps = 41/285 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-VDHV 68
                ISD+HL  +                          + +  L +  +     VD V
Sbjct: 25  LNFVQISDVHLRPNAGRSGWW--------------LSERPEHLLQLAVEKVCALGGVDFV 70

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+ +      +        ++  P    +V GNHD        +            
Sbjct: 71  VFTGDLFDQAEAAALDQFVAIAGAL--PCPYHVVVGNHDVVGKPWPGRLTKQTFA----- 123

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              +  +KL+  + ++    LI   T  A  P  A G    EQ       L     +   
Sbjct: 124 ERLALPEKLYYSVPVKPGYRLIVLDTVPAPFPH-AQGCLPAEQMEWLRWQLLVHRDEQ-- 180

Query: 189 RIIMMHHPPVLDTS--SLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
            I+ +HHPPV                +F +++        +L GH H+          + 
Sbjct: 181 VIVALHHPPVAPAYFRDFRLNPLDGSQFAELMAASPNVVAVLSGHLHVPRRWSY----RK 236

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSP 290
            P     S         P  ++  F +E       L   RY   P
Sbjct: 237 RPYFSAPSL------GGPPNAFRHFQLELTARSARL---RYDWIP 272


>gi|323498030|ref|ZP_08103038.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Vibrio
           sinaloensis DSM 21326]
 gi|323316906|gb|EGA69909.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Vibrio
           sinaloensis DSM 21326]
          Length = 272

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/296 (12%), Positives = 79/296 (26%), Gaps = 48/296 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDHV 68
            L  I+D HL                      +     + E    ++  I       D +
Sbjct: 13  KLLQITDTHL----------------FEATDGSLLSVNTGESFKAVVQAIIDQECQYDAI 56

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGDI               +  +  P     +PGNHD   +                 
Sbjct: 57  LATGDISQDHSEASYQCFEQGIVPLLKPC--FWLPGNHDYKPNMTSV------------- 101

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              S   +   ++ +     +I   + +   P    G    +Q     + L +   +   
Sbjct: 102 -IPSQQIQQVDHVLLGEAWQMIMLDSQVVGVPH---GRLSDQQLDLLDEKLAEYADRHTL 157

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  +   V       + +     F +++        +L GH H +           + 
Sbjct: 158 VLLHHNPIFVSSAWLDQHALKDADDFWQVLGKHSNVKAVLCGHVHQDMNVKHNG----VQ 213

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           V+   S   +   N        F ++  +  W  E   +        +++  +  F
Sbjct: 214 VMATPSTCVQFKPNSDD-----FALDTLSPGWR-ELVLHVSGELETKVERLPAGSF 263


>gi|165977387|ref|YP_001652980.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|307262444|ref|ZP_07544089.1| Protein icc [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|165877488|gb|ABY70536.1| 3-prime,5-prime cyclic nucleotide phosphodiesterase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|306867821|gb|EFM99652.1| Protein icc [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
          Length = 275

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/296 (14%), Positives = 89/296 (30%), Gaps = 47/296 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHV 68
            L  I+D HL  S S   L                   + +    +++ I       D V
Sbjct: 15  RLLQITDPHLFTSESETLLG----------------VNTTDSFQAVLDQIRQSEFEYDLV 58

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD++              ++ +  P  I  + GNHD              + ++   
Sbjct: 59  LATGDLIQDHNPEAYHRFAQMVKPLAKP--IFWLEGNHDL-------------QPHMGLY 103

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      ++       +I  ++ IA     A+G+    Q     K L +   +   
Sbjct: 104 LAKYPHISPAKHILAGEKWQIILLNSQIAGA---ASGHLSFGQLSWLDKKLAEYPDRYSL 160

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  +           + +   ++  +++ H      ILHGH H      + +  +   
Sbjct: 161 VVLHHNILSTRSAWLDQHCLNNSEQLAEVLRHYPNVRAILHGHIHQ----EVDDIWQNYR 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           +    S   +   N        F ++   + W  E   +        +++  S+ F
Sbjct: 217 IFATPSTCIQFKPNCDD-----FTLDLLPQGWR-ELNLFDDGHIETQVKRLNSNEF 266


>gi|330965501|gb|EGH65761.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. actinidiae str. M302091]
          Length = 277

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 86/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVVHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRENLLAAFADQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q    +  L  + +   
Sbjct: 103 ----LSASGPLDWVVEQYPLRLIGMDT---TIPGEHGGRLDYCQLDWLNAQL--SRRPDV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVLHHPPFITGIGHMDREPFGNAAALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  QA+   F +E   
Sbjct: 214 CI----CPGTSHQIVLDLDQAAPAHFNLEPAG 241


>gi|332162980|ref|YP_004299557.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325667210|gb|ADZ43854.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862266|emb|CBX72427.1| protein icc [Yersinia enterocolitica W22703]
          Length = 275

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/294 (12%), Positives = 82/294 (27%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D +  
Sbjct: 16  RVLQITDTHLFAGEHETLLGVNTSRSY------------RAVLDAIIAE--QHPFDLIVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHSVAAYQNFAKGISRL--PAPCVWLPGNHDFQPAMV--------------DAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            + G     ++ + +N  ++   + +   P+   G   + Q     + L    ++    +
Sbjct: 106 ANAGIAPSKHVLMGDNWQILLLDSQVFGVPY---GELSEYQLEWMERCLMAHPERYTLIL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 163 LHHHPMPSGCTWLDQHSLRNAHMLAAVLTRYPRVTTLLCGHIHQDLDLNWYGK----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               +++  SD F
Sbjct: 219 ASPSTCVQFKPHCTN-----FTLDTVAPGWRY-LDLLPDGRLETEVRRLASDEF 266


>gi|53729038|ref|ZP_00134324.2| COG1409: Predicted phosphohydrolases [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126209400|ref|YP_001054625.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Actinobacillus pleuropneumoniae L20]
 gi|190151299|ref|YP_001969824.1| protein Icc-like protein [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|303250325|ref|ZP_07336524.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|303251718|ref|ZP_07337889.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307246880|ref|ZP_07528945.1| Protein icc [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307249018|ref|ZP_07531026.1| Protein icc [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|307251215|ref|ZP_07533136.1| Protein icc [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|307253634|ref|ZP_07535501.1| Protein icc [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307258047|ref|ZP_07539799.1| Protein icc [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|307264652|ref|ZP_07546232.1| Protein icc [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|126098192|gb|ABN75020.1| protein Icc-like protein [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|189916430|gb|ACE62682.1| protein Icc-like protein [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|302649148|gb|EFL79333.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|302650795|gb|EFL80952.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306852165|gb|EFM84405.1| Protein icc [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306854476|gb|EFM86671.1| Protein icc [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|306856731|gb|EFM88866.1| Protein icc [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|306858870|gb|EFM90916.1| Protein icc [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306863410|gb|EFM95341.1| Protein icc [Actinobacillus pleuropneumoniae serovar 10 str.
           D13039]
 gi|306869964|gb|EFN01728.1| Protein icc [Actinobacillus pleuropneumoniae serovar 13 str. N273]
          Length = 275

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/296 (14%), Positives = 89/296 (30%), Gaps = 47/296 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHV 68
            L  I+D HL  S S   L                   + +    +++ I       D V
Sbjct: 15  RLLQITDPHLFTSESETLLG----------------VNTTDSFQAILDQIRQSEFEYDLV 58

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD++              ++ +  P  I  + GNHD              + ++   
Sbjct: 59  LATGDLIQDHNPEAYHRFAQMVKPLAKP--IFWLEGNHDL-------------QPHMGLY 103

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      ++       +I  ++ IA     A+G+    Q     K L +   +   
Sbjct: 104 LAKYPHISPAKHILAGEKWQIILLNSQIAGA---ASGHLSFGQLSWLDKKLAEYPDRYSL 160

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  +           + +   ++  +++ H      ILHGH H      + +  +   
Sbjct: 161 VVLHHNILSTRSAWLDQHCLNNSEQLAEVLRHYPNVRAILHGHIHQ----EVDDIWQNYR 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           +    S   +   N        F ++   + W  E   +        +++  S+ F
Sbjct: 217 IFATPSTCIQFKPNCDD-----FTLDLLPQGWR-ELNLFDDGHIETQVKRLNSNEF 266


>gi|307255862|ref|ZP_07537663.1| Protein icc [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307260315|ref|ZP_07542022.1| Protein icc [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306861130|gb|EFM93123.1| Protein icc [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306865566|gb|EFM97447.1| Protein icc [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
          Length = 275

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 42/296 (14%), Positives = 89/296 (30%), Gaps = 47/296 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHV 68
            L  I+D HL  S S   L                   + +    +++ I       D V
Sbjct: 15  RLLQITDPHLFTSESETLLG----------------VNTTDSFQAILDQIRQSEFEYDLV 58

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD++              ++ +  P  I  + GNHD              + ++   
Sbjct: 59  LATGDLIQDHNPEAYHRFAQMVKPLAKP--IFWLEGNHDL-------------QPHMGLY 103

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      ++       +I  ++ IA     A+G+    Q     K L +   +   
Sbjct: 104 LAKYPHISPAKHILAGEKWQIILLNSQIAGA---ASGHLSFGQLSWLDKKLAEYPDRYSL 160

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  +           + +   ++  +++ H      ILHGH H      + +  +   
Sbjct: 161 VVLHHNILSTRSAWLDQHCLNNSEQLAEVLRHYPNVRAILHGHIHQ----EVDDIWQNYR 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           +    S   +   N        F ++   + W  E   +        +++  S+ F
Sbjct: 217 IFATPSTCIQFKPNCDD-----FTLDLLPQGWR-ELNLFDDGHIETQVKRLNSNEF 266


>gi|330954919|gb|EGH55179.1| metallophosphoesterase [Pseudomonas syringae Cit 7]
          Length = 277

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 51/282 (18%), Positives = 87/282 (30%), Gaps = 44/282 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRHNLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNR--MFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDRESFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRY 286
            I        S ++  +  +A+   F +E           R+
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG----CVLHRW 247


>gi|237802410|ref|ZP_04590871.1| metallophosphoesterase [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331025267|gb|EGI05323.1| metallophosphoesterase [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 277

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 86/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +  +   
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDNRENLLAAFADQVYLPF--- 103

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 104 -----SASGPLDWVVEQYPVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTLIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|229489303|ref|ZP_04383167.1| metallophosphoesterase [Rhodococcus erythropolis SK121]
 gi|229323796|gb|EEN89553.1| metallophosphoesterase [Rhodococcus erythropolis SK121]
          Length = 301

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 83/315 (26%), Gaps = 61/315 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           L H+SD HL      ++                    +      +++ I+      D + 
Sbjct: 15  LVHLSDTHLVAQGELYD-----------------AVDASTRLREVLSGIVASGARPDALI 57

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +  +       +    GNHD   +            + + 
Sbjct: 58  FTGDLTDQGHPDAYAELKAIVEPVAAEIDAQVVWAMGNHDDRPT------------FRSL 105

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +     +   + + +I   +++   P    G     Q       L      G 
Sbjct: 106 LLGEDATEHPVDNVYDLDGLRVITLDSSV---PGHHYGEISDRQLDWLRAELAVPAPDGT 162

Query: 188 FRIIMMHHPPVL--DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ +HHPPV      ++   +    R   ++       IL GH H ++          
Sbjct: 163 --ILALHHPPVPCIQDLAVLVELRDQSRLADVLRGSDVRAILAGHLHYSTTATFAG---- 216

Query: 246 IPVVGIASASQK---------VHSNKPQASYNLFYIEKK-------NEYWTLEG-KRYTL 288
           IPV   +S                       NL ++  +            +   +    
Sbjct: 217 IPVSVASSTCYTQDLNVEVGGQRGRDGAQGCNLVHVYDETIVHSVVPLGAHVTVGEPVDA 276

Query: 289 SPDSLSIQKDYSDIF 303
           +  +  +      I 
Sbjct: 277 AEGARRLSAAGIRIL 291


>gi|113971565|ref|YP_735358.1| calcineurin phosphoesterase C-terminal domain-containing protein
           [Shewanella sp. MR-4]
 gi|113886249|gb|ABI40301.1| Calcineurin phosphoesterase C-terminal domain protein [Shewanella
           sp. MR-4]
          Length = 279

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/276 (11%), Positives = 68/276 (24%), Gaps = 46/276 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  ++D HL   P    L               +                      +  
Sbjct: 17  RIVQVTDPHLFADPEAQLLGVNTSKSFAAVLNTIRAVDYPAHL--------------MLA 62

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD                       
Sbjct: 63  TGDLSQDYSPESYRQFVAAVAPLNLPC--HYLPGNHDDPRIMFLHMQGERIFGQQR---- 116

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                       +     ++   + +   P    G   + Q     + +     +    +
Sbjct: 117 -----------ILVGKWQILMLDSTVRGKPG---GNMAESQFELIEQAIAAHPDRHT--L 160

Query: 191 IMMHHPPVLDTSSL---YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           ++MHH P+L   +    +    G +  +++  +     +L GH H             + 
Sbjct: 161 LVMHHNPILVNCAWLDQHCMDNGTEFLRRVAQYPQVKGLLWGHVHQQLDTDYDGPHGALQ 220

Query: 248 VVGIASASQKVHSNKP-------QASYNLFYIEKKN 276
           ++   S   +     P       Q  Y L  ++   
Sbjct: 221 LMATPSTCIQFKPQSPYFALDGLQPGYRLLELKADG 256


>gi|330938554|gb|EGH42133.1| metallophosphoesterase [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 277

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLSALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREGEYAVLKPELERLQMP--FYLVPGNHDDRHNLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPYITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|238750924|ref|ZP_04612421.1| hypothetical protein yrohd0001_16760 [Yersinia rohdei ATCC 43380]
 gi|238710838|gb|EEQ03059.1| hypothetical protein yrohd0001_16760 [Yersinia rohdei ATCC 43380]
          Length = 275

 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/294 (12%), Positives = 79/294 (26%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D +  
Sbjct: 16  RILQITDTHLFAGEHETLLGVNTSRSY------------RAVLDAIIAE--QHPFDLIVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHSVAAYKNFAEGISRLSAPC--VWLPGNHDFQPAMV--------------DAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      + +  N  ++   + +   P+   G   + Q     + L    ++    +
Sbjct: 106 ADAGIAPSKQVLVGENWQILLLDSQVFGVPY---GELSEHQLEWMERCLVAHPERYTLVL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 163 LHHHPMPSGCTWLDQHSLRNAHMLAAVLTRYPHVTTLLCGHIHQDLDLDWYGK----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               +++  S+ F
Sbjct: 219 ASPSTCVQFKPHCTN-----FTLDTVAPGWRY-LDLLPNGRLETEVRRLASNEF 266


>gi|325958231|ref|YP_004289697.1| metallophosphoesterase [Methanobacterium sp. AL-21]
 gi|325329663|gb|ADZ08725.1| metallophosphoesterase [Methanobacterium sp. AL-21]
          Length = 249

 Score =  108 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 83/224 (37%), Gaps = 21/224 (9%)

Query: 54  NLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGA 113
           N L+  +   N D + ++GD+     + E   +  ++  + +  ++ +VPGNHDA   G 
Sbjct: 5   NNLLRQVTDENPDLIIVSGDLTTEGYSHEYDDAAEFVDELNSISEVHVVPGNHDARNVGL 64

Query: 114 KEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAH 173
                               G++ F ++       + G  ++    P   +G  G +Q  
Sbjct: 65  IH-------------FEKQIGERKFIHIDKSGGFVIAGLDSS---EPDINDGQIGYDQLA 108

Query: 174 ATSKLLRKANKKGFFRIIMMHH-PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
                L K  K     +   HH  P+  T    N +       ++    G D +L+GH H
Sbjct: 109 WLKSELEKVPKDMCKIVTFHHHLLPIPQTGRERNILLDSGDLLRLFIDSGVDFVLNGHKH 168

Query: 233 LNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           + ++  I+     +  +   +A+ +        SYN   I+   
Sbjct: 169 VPNVWMIE----KMVTLNSGTATTRKLRGNTYPSYNELLIDDGG 208


>gi|328543617|ref|YP_004303726.1| Ser/Thr protein phosphatase family protein [polymorphum gilvum
           SL003B-26A1]
 gi|326413361|gb|ADZ70424.1| Ser/Thr protein phosphatase family protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 284

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 51/282 (18%), Positives = 96/282 (34%), Gaps = 35/282 (12%)

Query: 5   YTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           +   M +LA I+D+HL               GL  +  +     ++     L+   L   
Sbjct: 3   WDYFMTILAQITDLHLRPR------------GLTCYRVSDTNNLAERAIRALLA--LSPR 48

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            D V +TGDI +    RE   + H L  +  P  + ++PGNHD+        +L A    
Sbjct: 49  PDAVVVTGDITDGADAREYALARHILGRL--PMPVYVLPGNHDS------SDTLRAAFSD 100

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
                   T      Y      + L+   +++A  PF   G  G EQ     ++L +   
Sbjct: 101 YPGIRDAPTASGKLHYTADVGGLRLVALDSSVAGKPF---GLLGAEQLAWLDRVLAE--- 154

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKN 241
                ++ +HHPP+       + +       F  ++      + ++ GH H   +     
Sbjct: 155 DDRPAVVAVHHPPMATGIQHMDSIALHDTDAFAAVLSRHAHVERLICGHVHRPIVAGFAG 214

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
                 +    S + ++  +    +   F  E    +     
Sbjct: 215 ----TVMTLAPSTAHQLVLDFDDKAPVDFNFEPPAYFLHCHL 252


>gi|15602884|ref|NP_245956.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Pasteurella
           multocida subsp. multocida str. Pm70]
 gi|12721350|gb|AAK03103.1| Icc [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 276

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/299 (13%), Positives = 86/299 (28%), Gaps = 46/299 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--D 66
           +F +  I+D HL                    H       + +  + ++++I       D
Sbjct: 13  VFKIIQITDPHLFKDE----------------HGELLGINTFQSFSQVLHEIKASRFDYD 56

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V  TGD+V  +           ++S+     +  +PGNHD                   
Sbjct: 57  LVLATGDLVQDSSREGYLHFCEQVKSLEKT--VFWIPGNHDFQPKM------------FE 102

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                        ++ +  +  ++   + +   P    G   Q Q       L+   ++ 
Sbjct: 103 ILNQDQGNLNPKKHILLGKSWQILMLDSQVFGVPH---GELSQYQIDWLVAKLKDHPERY 159

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
              ++  H  P   T    + +         +        ILHGH H       +     
Sbjct: 160 TLIVLHHHILPTHSTWLDQHNLRNAHELAYALAPFDKVKGILHGHIHQEMDANWQG---- 215

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
             V+   +   +   +      N F ++     W  E + Y+       +++     F+
Sbjct: 216 YRVMATPATCIQFKPDH-----NTFTLDSVQPGWR-ELELYSDGRIETRVKRIQDKTFF 268


>gi|289674360|ref|ZP_06495250.1| metallophosphoesterase [Pseudomonas syringae pv. syringae FF5]
          Length = 277

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRHNLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|114046263|ref|YP_736813.1| calcineurin phosphoesterase C-terminal domain-containing protein
           [Shewanella sp. MR-7]
 gi|113887705|gb|ABI41756.1| Calcineurin phosphoesterase C-terminal domain protein [Shewanella
           sp. MR-7]
          Length = 279

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/276 (11%), Positives = 68/276 (24%), Gaps = 46/276 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  ++D HL   P    L               +                      +  
Sbjct: 17  RIVQVTDPHLFADPEAQLLGVNTSKSFAAVLNTIRAVNYPAHL--------------MLA 62

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD                       
Sbjct: 63  TGDLSQDYSPESYRQFVAAVAPLNLPC--HYLPGNHDDPRIMFLHMQGERIFGQQR---- 116

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                       +     ++   + +   P    G   + Q     + +     +    +
Sbjct: 117 -----------ILAGKWQILMLDSTVRGKPG---GNMAESQFELIEQAIAAHPDRHT--L 160

Query: 191 IMMHHPPVLDTSSL---YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           ++MHH P+L   +    +    G +  +++  +     +L GH H             + 
Sbjct: 161 LVMHHNPILVNCAWLDQHCMDNGTEFLRRVAQYPQVKGLLWGHVHQQLDTDYDGPHGALQ 220

Query: 248 VVGIASASQKVHSNKP-------QASYNLFYIEKKN 276
           ++   S   +     P       Q  Y L  ++   
Sbjct: 221 LMATPSTCIQFKPQSPYFALDGLQPGYRLLELKADG 256


>gi|77456725|ref|YP_346230.1| metallophosphoesterase [Pseudomonas fluorescens Pf0-1]
 gi|77380728|gb|ABA72241.1| putative phosphoesterase [Pseudomonas fluorescens Pf0-1]
          Length = 271

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 44/278 (15%), Positives = 81/278 (29%), Gaps = 55/278 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   ++E    +I+ +L      D + 
Sbjct: 15  LVQLSDSHLFAEADGTLLG----------------MNTRESLQKVIDLVLEQQPRIDLIV 58

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            +GD+                  I  P     +PGNHD     A+               
Sbjct: 59  ASGDLSQDGTLESYQLFRQMTAQIDAPAR--WIPGNHDEPQIMAR--------------- 101

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             +    L   +    N  +    +A+   P S  GY   +Q    ++ L +A  +    
Sbjct: 102 -ATVKSALLESVVDVGNWRVTLLDSAV---PGSVPGYLQDDQLQLLARSLSEAPDRH--H 155

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++  HH PV    +    +     + F +++     A  +L GH H      I  E+  +
Sbjct: 156 LVCFHHHPVSIGCAWMEPIGLRNPEAFFEVLDRFPQARAVLWGHVHQ----EIDRERNGV 211

Query: 247 PVVGIASASQKVHS-------NKPQASYNLFYIEKKNE 277
            ++   S   +           +    Y    +     
Sbjct: 212 RLIASPSTCIQFEPGSEDFKVGEQAPGYRWLRLLPDGR 249


>gi|221213989|ref|ZP_03586962.1| metallophosphoesterase [Burkholderia multivorans CGD1]
 gi|221166166|gb|EED98639.1| metallophosphoesterase [Burkholderia multivorans CGD1]
          Length = 274

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/292 (13%), Positives = 89/292 (30%), Gaps = 50/292 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       +  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCVEKLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +            +D 
Sbjct: 47  VTGDLTDFGHDDEYRHLRDLLAPLDIPY--YLMVGNHDDRAALRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + ++   + +   P ++ G     +    +  L  A  +    
Sbjct: 95  HELQHGEFVQYALDIGAVRVLALDSQV---PRTSGGDLCDARLGWLAAQLDAARDRPT-- 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH-----EGADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +   +  + +         +          + +L GH H            
Sbjct: 150 IVALHHPPFVSGIAHMDALRLAPSAAAKLDALLRGYPNVERVLCGHVHRTMFTRFAG--- 206

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
                 + + + +V  +   A  + F +E            +  +PD+  + 
Sbjct: 207 -TLASAVPAPAHQVAFDLRAAGPSAFRLEPPAFAV------HRYAPDTGMVS 251


>gi|86609388|ref|YP_478150.1| Ser/Thr protein phosphatase family protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557930|gb|ABD02887.1| Ser/Thr protein phosphatase family protein [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 386

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/295 (15%), Positives = 89/295 (30%), Gaps = 31/295 (10%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
             A +SD H++   + ++                    S      ++  ++   +D + +
Sbjct: 4   RFAVVSDPHVTLPSTLWDHPS----------RFHLVEVSIPALEQVLQHLVQLPLDFLLL 53

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH-AWKDYITSDT 129
            GD+               L  +  P    +VPGNHD     A  +S+  A         
Sbjct: 54  PGDLTQHGEPENHAWLAERLARL--PFPAFVVPGNHDVPQPEASGRSIGLADFPRYYRAF 111

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
               G+ L     +R  I LIG ++          G    EQ     K L  A ++    
Sbjct: 112 GYEDGQSLDYSRVLRPGIRLIGLNSNHFDAQGQLVGCLTPEQLTWLEKELAAAEEELVLL 171

Query: 190 IIMMHHPPV-----LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           ++  +         L        +    + ++++   G  L+  GH H+  +      + 
Sbjct: 172 MVHHNVVEHLRGQSLHPWGRRYMLENASQLRRLLQAYGVQLVFTGHLHIQHIAR----RG 227

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKK---NEYWTLEGKRYTLSPDSLSIQ 296
            +  +   S     H       Y L  I           ++  R    PD   +Q
Sbjct: 228 GVYDITTGSLVSFPHP------YRLVEIRSDRETGIQVHIQSYRVGSLPDWPDLQ 276


>gi|163745069|ref|ZP_02152429.1| possible phospodiesterase [Oceanibulbus indolifex HEL-45]
 gi|161381887|gb|EDQ06296.1| possible phospodiesterase [Oceanibulbus indolifex HEL-45]
          Length = 268

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 52/299 (17%), Positives = 94/299 (31%), Gaps = 44/299 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H                               ++   L++ +  ++ D V
Sbjct: 1   MSRLIHLSDLHFGK-------------------------DRPDLLAPLLSAVNGYDPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+      +E   +  ++  I  P  +  VPGNHD  +     + L  W+ Y    
Sbjct: 36  IISGDLTQRAREKEYRAARAFIDRINAP--VLSVPGNHDIPLHRPFTRFLTPWRYYRHWI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               T       +    +   +G +T       +        +    +        +   
Sbjct: 94  DRDLTP------VHEGPDFIAVGINTVDRFKWQTGK---LGLRRLRRACRALSRGGENTL 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE----KK 244
           RI + HHP    T +    + G +R  + +   GADLIL GH H+       +       
Sbjct: 145 RIAVCHHPLDHPTETQKRPIPGAKRALRRLLDCGADLILSGHLHIWHAGTFAHPAPEHDG 204

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            + +   A  S           +NL  I        +   R +      +  K  +  F
Sbjct: 205 HLAIQLHAGTSLSSRQRGEPNDFNLIDISP----LHVNLSRISFDDAKGAFTKAEARQF 259


>gi|330979913|gb|EGH78213.1| metallophosphoesterase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 277

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDRHNLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I+MHHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIVMHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSLA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|159897715|ref|YP_001543962.1| metallophosphoesterase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159890754|gb|ABX03834.1| metallophosphoesterase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 288

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/300 (15%), Positives = 94/300 (31%), Gaps = 46/300 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + H+SD+H                            F+ E A  ++            +
Sbjct: 4   TILHLSDLHAGPP------------------------FNPEKAQQILEAAWQIKPTLTVL 39

Query: 71  TGDIVNFTC-NREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +GD V       +  T   ++  +  P     V GNHD  +  A  + L     Y    +
Sbjct: 40  SGDFVQRADIRSQWLTIRDFVAQL--PQPTIAVMGNHDVPLYNALYRMLRPNYYYKKYIS 97

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                      +   ++   +G +T          G    +Q     + L +       +
Sbjct: 98  PILEP------VWGNDDFVAVGVNTTR--SFTVDGGKLTDQQLLELERSLARYPDS-LCK 148

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI----KNEKKL 245
           I++MHH PV+      + +       +       +L+L GHTH + +        + ++ 
Sbjct: 149 IVVMHHHPVMPPGETRDVIQNAAAALRTFDRSNVELVLCGHTHASYIGNTLEFDPDLRQG 208

Query: 246 IPVVGIASASQKVHSN--KPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +V   +A+ +      + + ++N+  IE    +      +Y    D+          F
Sbjct: 209 TVIVQAGTATSRRGRRWYRGKNAFNVLEIE----HMRSVITQYLYLEDAGRFLPVSQHQF 264


>gi|322831361|ref|YP_004211388.1| Calcineurin phosphoesterase domain protein [Rahnella sp. Y9602]
 gi|321166562|gb|ADW72261.1| Calcineurin phosphoesterase domain protein [Rahnella sp. Y9602]
          Length = 276

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/297 (13%), Positives = 81/297 (27%), Gaps = 48/297 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +        VD ++ 
Sbjct: 16  RILQITDTHLFAGEDETLLGVNTFNSY------------RAVLDAI--KAQQREVDIIAA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                +  
Sbjct: 62  TGDLAQDQSVEAYHQFARGISELTAPC--VWLPGNHDFQPAMV--------------NAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G     ++ +  +  +I   T +   P    G   + Q     + L     +  F +
Sbjct: 106 QDAGISPSKHVLLGEHWQIILLDTQVFGVPH---GELSEYQLEWMERCLNAYPDR--FTL 160

Query: 191 IMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           +M+HH P+    +  ++            + +    + +L GH H               
Sbjct: 161 LMLHHHPLPSGCTWLDQHSLRNAHMLANTLVNYPKVNTLLCGHIHQELDLDWYGR----R 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           +    S   +   +        F I+     W      Y        + +  ++ F+
Sbjct: 217 LYATPSTCVQFKPHCTN-----FTIDTVAPGWRY-LDLYPDGRVETEVFRLETNEFH 267


>gi|300717918|ref|YP_003742721.1| Metallophosphoesterase [Erwinia billingiae Eb661]
 gi|299063754|emb|CAX60874.1| Metallophosphoesterase [Erwinia billingiae Eb661]
          Length = 277

 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 50/290 (17%), Positives = 88/290 (30%), Gaps = 47/290 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        +K  +      +I  +       D V 
Sbjct: 8   LAQISDLHIKAHGKLS----------------YRKVDTLGALRQVIARLNALLPRPDAVV 51

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+V+F    E  T    L  +  P+   ++ GNHD      K              T
Sbjct: 52  ITGDLVDFGHEEEYLTLKEALSHLELPY--WLMAGNHDDRQMMRKI---------FADQT 100

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   +      + L+   + +   P    G   +E+    S  L++   +    
Sbjct: 101 HLFQHHEFIEWEGECGPLRLLALDSTVPQQP---QGELCEERLGWLSDRLKEQPLRPT-- 155

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           I+M+HHPP +      +R      Q    +I      + +L GH H +            
Sbjct: 156 IVMLHHPPFISGIDHMDRQRLRNPQPLAAVIKGHPQVERVLCGHLHRSMQVRFAG----T 211

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
                   S +V  +        F +E            +  +P+   + 
Sbjct: 212 LACSAPGVSHQVAFDLQTDGPANFCLEPAGY------LLHRWTPEQGVVT 255


>gi|238760034|ref|ZP_04621185.1| hypothetical protein yaldo0001_2740 [Yersinia aldovae ATCC 35236]
 gi|238701721|gb|EEP94287.1| hypothetical protein yaldo0001_2740 [Yersinia aldovae ATCC 35236]
          Length = 284

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 38/299 (12%), Positives = 79/299 (26%), Gaps = 44/299 (14%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +     +  I+D HL        L                    + V   +I +   H  
Sbjct: 20  SGAKVRILQITDTHLFAGEHETLLGVNTSRSY------------RAVLEAIIAE--QHPF 65

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D +  TGD+               +  +  P     +PGNHD   +              
Sbjct: 66  DLIVATGDLAQDHSVAAYQNFAKGIARLSAPC--VWLPGNHDFQPAMV------------ 111

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D     G      + +  N  ++   + +   P+   G     Q     + L    ++
Sbjct: 112 --DALADAGIAPSKQVLVGENWQILLLDSQVFGVPY---GELSDYQLEWMERCLVAHPER 166

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
               ++  H  P   T    + +        ++        +L GH H +       +  
Sbjct: 167 YTLILLHHHPMPSGCTWLDQHSLRNAHVLAAVLTRYPRVTTLLCGHIHQDLDLDWYGK-- 224

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              ++   S   +   +        F ++     W       +       +++  SD F
Sbjct: 225 --RLLASPSTCVQFKPHCTN-----FTLDTVAPGWRY-LDLLSDGTLETDVRRLASDEF 275


>gi|268590588|ref|ZP_06124809.1| 3',5'-cyclic-nucleotide phosphodiesterase [Providencia rettgeri DSM
           1131]
 gi|291313976|gb|EFE54429.1| 3',5'-cyclic-nucleotide phosphodiesterase [Providencia rettgeri DSM
           1131]
          Length = 279

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/314 (12%), Positives = 87/314 (27%), Gaps = 52/314 (16%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           +T + + ++  +  ++D HL  +     L                    + V + +  + 
Sbjct: 7   VTAKNSKVV-RILQVTDTHLFANTENTLLGVNTYRSY------------QAVLDAISEE- 52

Query: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
               +D +  TGD+V     +        +  I  P     +PGNHD   +  K      
Sbjct: 53  -NLPIDLIVATGDLVQDQSPQAYQHFADGIARI--PAPCVWLPGNHDYPPAMVKT----- 104

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
                        G      + I +   ++   + +   P    G   ++Q       L 
Sbjct: 105 ---------LRIAGISSAKQVLIGDEWQILMLDSQLQDVPH---GELSEQQLEWMKASLD 152

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLH 237
              ++    +IM+HH P+    +  ++            +        +L GH H     
Sbjct: 153 AEPERTT--LIMLHHHPLASGCTWLDQHSLRNSHILADYLKSYSNVKAMLCGHIHQEMDE 210

Query: 238 WIKNEKKLIPVVGIASASQKVHSNKPQ-------ASYNLFYIEKKNEYWTLEGKRYTLSP 290
                   I ++   S   +   +            +    +    +             
Sbjct: 211 NWHG----IRLLATPSTCVQFKPHCTNFALDTVAPGWRYLELSINEQGQR-HITTRVHRL 265

Query: 291 DSLSIQKD-YSDIF 303
           D+     D  SD +
Sbjct: 266 DTREFSPDLDSDGY 279


>gi|302384772|ref|YP_003820594.1| metallophosphoesterase [Clostridium saccharolyticum WM1]
 gi|302195400|gb|ADL02971.1| metallophosphoesterase [Clostridium saccharolyticum WM1]
          Length = 475

 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 42/315 (13%), Positives = 85/315 (26%), Gaps = 31/315 (9%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +   +DIH            K     ++    +   +  E+ +  + ++   + D V +
Sbjct: 74  KILVATDIHY--LARDLTDFQKGFQYSIDHGDGKVMQYIWEITDAFVEEVKAEHPDLVIL 131

Query: 71  TGDIVNFTCNREIFTSTH-WLRSIGNPHDISIVPGNHDAYISGAKE-------------- 115
           +GD+                         + ++PGNHD     A +              
Sbjct: 132 SGDLTYNGEKESHKNFAEKLGEIEDAGIPVIVIPGNHDINNPLAAQFVGDTFLGAENITS 191

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNI-ALIGCSTAIATPPFSANGYFGQEQAHA 174
                       +   S       Y+   N+    +   T    P     G    +    
Sbjct: 192 DEFEEIYQDFGYNEAVSRDPSSLSYVYQVNDYTRALMLDTCQYEPKNLVGGMIKDDTYDW 251

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEGADLILHGHTH 232
               + +A   G   I + HH  + ++        +   ++    +      L L GH H
Sbjct: 252 IEDQMEEAWNLGMNVIPVGHHNLLEESEVYLQDCTIEHGEQLIDQLESWEVPLFLSGHLH 311

Query: 233 LNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN----EYWTLEGKRYTL 288
           +   +        I  +  +S S       P   Y + Y            +L+ K +  
Sbjct: 312 V-QHYMRSGSDSGIYEIVTSSLST------PPCQYGVLYYGNDGNFRYHTKSLDMKGWAK 364

Query: 289 SPDSLSIQKDYSDIF 303
           +  S        D F
Sbjct: 365 NTGSTDKNLLSFDEF 379


>gi|111222424|ref|YP_713218.1| hypothetical protein FRAAL3006 [Frankia alni ACN14a]
 gi|111149956|emb|CAJ61650.1| conserved hypothetical protein [Frankia alni ACN14a]
          Length = 286

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/298 (15%), Positives = 89/298 (29%), Gaps = 44/298 (14%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           L  +SD H+               GL            +     +  +     V  + +T
Sbjct: 16  LIQLSDTHIVREGELLHGRVDSHAGL------------RTALEQI--EASTLKVGALLLT 61

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNP--HDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           GD+ +             +  +       +    GNHD            A   +     
Sbjct: 62  GDLADSGDLVAYQRLRDLVEPVAERLGAPVLYAVGNHD------------ARGPFRAGLL 109

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                ++ + Y+   +++ +I   T   T P    G+ G  Q    +  L      G   
Sbjct: 110 GAEPTEEAYDYVHWVDDLRIIVLDT---TEPGEHGGFLGTAQLRWLADELATPAPGGT-- 164

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           ++ +HHPPV    ++ N+           ++      ++L GH H +S   I      +P
Sbjct: 165 VLALHHPPVPSPIAMVNKYLLAEPANLADVLAGTDVRIVLTGHAHHSSAGVI----GGVP 220

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYD 305
           V    + +    +  P        +             Y  S  + +I    +++ YD
Sbjct: 221 VWVAGATAYSARTLGPAD-----RLTGMVGGEYTRVDVYPDSAVATAIPLTPTEVIYD 273


>gi|226307552|ref|YP_002767512.1| 3',5'-cyclic-nucleotide phosphodiesterase [Rhodococcus erythropolis
           PR4]
 gi|226186669|dbj|BAH34773.1| putative 3',5'-cyclic-nucleotide phosphodiesterase [Rhodococcus
           erythropolis PR4]
          Length = 301

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/315 (12%), Positives = 81/315 (25%), Gaps = 61/315 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           L H+SD HL      ++                    +      +++ I+      D + 
Sbjct: 15  LVHLSDTHLVAQGELYD-----------------AVDASTRLREVLSGIVASGARPDALI 57

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPH--DISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +  +       +    GNHD   +            + + 
Sbjct: 58  FTGDLTDQGHPDAYAELKAIVEPVAAEIDAQVIWAMGNHDDRST------------FRSL 105

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                        +   + + +I   +++   P    G     Q       L      G 
Sbjct: 106 LLGEDATDHPVDNVYDLDGLRVITLDSSV---PGHHYGEISDRQLDWLRSELAVPAPDGT 162

Query: 188 FRIIMMHHPPVL--DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ +HHPPV      ++   +    R   ++       IL GH H ++          
Sbjct: 163 --ILALHHPPVPCIQDLAVLVELRDQSRLADVLRGSDVRAILAGHLHYSTTATFAG---- 216

Query: 246 IPVVGIASASQK---------VHSNKPQASYNLFYIEKK-------NEYWTLEG-KRYTL 288
           IPV   +S                       NL ++  +            +   +    
Sbjct: 217 IPVSVASSTCYTQDLNVEVGGQRGRDGAQGCNLVHVYDETIVHSVVPLGAHVTVGEPVDA 276

Query: 289 SPDSLSIQKDYSDIF 303
              +  +      I 
Sbjct: 277 DEGARRLSAAGIRIL 291


>gi|167947206|ref|ZP_02534280.1| Calcineurin phosphoesterase C-terminal domain protein [Endoriftia
           persephone 'Hot96_1+Hot96_2']
          Length = 279

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 45/278 (16%), Positives = 84/278 (30%), Gaps = 52/278 (18%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHV 68
            L  +SD H+                  +         +++  + +I          D +
Sbjct: 21  TLLQLSDSHI----------------YADQDRCLVGINTQDSLDQVIALARQQLSTPDLL 64

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+V+             L + G    +  +PGNHD      +  +           
Sbjct: 65  LATGDLVHDASAAGYQRIAERLSAFG--CPVYCLPGNHDVPKVMQEHLNRPPLYCLP--- 119

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                          R N ++I   + I   P    G+    Q    S+ L +  K    
Sbjct: 120 ------------SLQRGNWSIIFLDSTIPGKPG---GHLDDAQLELLSETLNRHPKHHT- 163

Query: 189 RIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKL 245
            +I MHH PV   S+  + M     +    ++        +L GH H         + + 
Sbjct: 164 -LITMHHHPVPVGSAWMDTMALVNPEPLFHLLEQHSQVRAVLFGHIHQ----EFDTKHRG 218

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
           I ++G  S   +  + + +     F I+ K   +    
Sbjct: 219 IRLIGTPSTCIQFIAGQDK-----FGIDSKPPGYRAMV 251


>gi|332663664|ref|YP_004446452.1| metallophosphoesterase [Haliscomenobacter hydrossis DSM 1100]
 gi|332332478|gb|AEE49579.1| metallophosphoesterase [Haliscomenobacter hydrossis DSM 1100]
          Length = 628

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 49/263 (18%), Positives = 81/263 (30%), Gaps = 56/263 (21%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHV 68
           F  AHISD H+    +  E                            + DI    ++  V
Sbjct: 24  FKFAHISDTHIGSGATAAED-----------------------LERTVRDINAQDDIAFV 60

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             +GD+  F  + E+  + + L  +  P  + IVPGNHD   S +   S  A        
Sbjct: 61  IHSGDVTEFGSDAELRQAKNILSQLNKP--LYIVPGNHDTKWSESGCNSFRAIF------ 112

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      +         IGC++        A G   +E       ++   + +   
Sbjct: 113 -------GGDRFAFDYGGYRFIGCNSGPNM--RMAPGLVPREDLVWLDSIVSATSPQ--L 161

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
            II ++H P+    +         +   ++      + L GH H N           IP 
Sbjct: 162 PIIFVNHYPLDAGLA------NWDQVIDILKKRNTQVALCGHGHRNKYMDAAG----IPN 211

Query: 249 VGIASASQKVHSNKPQASYNLFY 271
           V        + +  P   YNL  
Sbjct: 212 VM---GRSNLRAKDPVGGYNLVS 231


>gi|171322548|ref|ZP_02911336.1| metallophosphoesterase [Burkholderia ambifaria MEX-5]
 gi|171092118|gb|EDT37531.1| metallophosphoesterase [Burkholderia ambifaria MEX-5]
          Length = 274

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/278 (14%), Positives = 84/278 (30%), Gaps = 44/278 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       I  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCIAKLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD      +            +D 
Sbjct: 47  VTGDLTDFGHDDEYRHLRELLEPLEIPY--YLMVGNHDDRAGLRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + ++   + +   P +++G     +    +  L  A  +    
Sbjct: 95  PEWQDGEFVQYALDVGAVRVLALDSQV---PGASHGDLCDARLAWLAAQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQR----FQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +      + +            ++      + +L GH H            
Sbjct: 150 IVALHHPPFVSGIGHMDALRLAPDAATKLDALLRGYPNVERVLCGHVHRTMFTRF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
              V  + + + +V  +      + F +E       + 
Sbjct: 206 GTLVSAVPAPAHQVAFDLRADGPSAFRLEPPAFAVHVH 243


>gi|312622965|ref|YP_004024578.1| metallophosphoesterase [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203432|gb|ADQ46759.1| metallophosphoesterase [Caldicellulosiruptor kronotskyensis 2002]
          Length = 372

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 53/292 (18%), Positives = 96/292 (32%), Gaps = 44/292 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHV 68
           F  A ISD H+S   S    + +           +    S  +    + +I    ++  V
Sbjct: 48  FKFAVISDPHISVFESSMSPTNE----------VKMFKDSVSLLESTVKEINKILDIKFV 97

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISG----AKEKSLHAWKDY 124
            + GD+        +      L  +  P+   +V GNHD  +          S+      
Sbjct: 98  CVLGDLTKDAEPWNVDKVKEILDRLQVPY--YVVLGNHDVSVVDSHLKNMGPSVTRSTMI 155

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
            T      +G   +  L     + LIG  + +        GY   +Q     K L+  N 
Sbjct: 156 WTFQGHGFSGPNRWWSLDPLPGVHLIGLDSTMIGDWG---GYIDNQQLKFLEKDLQ--NN 210

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRF--------QKMIWHEG-ADLILHGHTHLNS 235
           K    I+M+HH  +  T +         +F        ++++       ++L GH H+++
Sbjct: 211 KSKLTIVMLHHQLLPYTKAEETGENNFNKFVLYNSKQVREVLEKFPQVAVVLSGHRHIST 270

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
            + ++   K I     AS             Y +F I    + W L      
Sbjct: 271 RYKME---KGIAYFTCASTVTYPMR------YTIFEI----KGWKLTYTTKD 309


>gi|163847798|ref|YP_001635842.1| metallophosphoesterase [Chloroflexus aurantiacus J-10-fl]
 gi|222525666|ref|YP_002570137.1| metallophosphoesterase [Chloroflexus sp. Y-400-fl]
 gi|163669087|gb|ABY35453.1| metallophosphoesterase [Chloroflexus aurantiacus J-10-fl]
 gi|222449545|gb|ACM53811.1| metallophosphoesterase [Chloroflexus sp. Y-400-fl]
          Length = 295

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 55/286 (19%), Positives = 92/286 (32%), Gaps = 44/286 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F + HISDIH                            F+   A  LI D    N D + 
Sbjct: 3   FRILHISDIHTGPP------------------------FNPAAAERLIADAHALNPDLLV 38

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD V        + +   LR    P    +V GNHD  +    E+    +  Y    T
Sbjct: 39  ISGDFVQRADFSRQWQAACELRR-RLPQPQLVVAGNHDVPLFLLHERLFRPFDRYRRYIT 97

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                      +     IA+IG  TA         G   ++Q       L        ++
Sbjct: 98  PDLNP------VFTAPGIAVIGACTAHG--WTIDGGRLNRDQMQTLRSQLAGLAAD-TYK 148

Query: 190 IIMMHHPPVLDTS--SLYNRMFGIQRFQKMIWHEGADLILHGHTHL----NSLHWIKNEK 243
           +++ HHP     +       +       +++     DL+L GH HL    N+  ++   +
Sbjct: 149 VVVWHHPVGFPPAYQRKRPLVANAGEAMQLLAEFAVDLLLCGHLHLSFVGNTRDFLPELR 208

Query: 244 KLIPVVGIASASQKV--HSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
               +V   + + +          + NL  IE       ++  R+ 
Sbjct: 209 HGTYIVQSGTTTSRRGYGDEHGANTCNLITIEADG--ARVQHLRFD 252


>gi|163732187|ref|ZP_02139633.1| Ser/Thr protein phosphatase family protein, putative [Roseobacter
           litoralis Och 149]
 gi|161394485|gb|EDQ18808.1| Ser/Thr protein phosphatase family protein, putative [Roseobacter
           litoralis Och 149]
          Length = 263

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/276 (14%), Positives = 80/276 (28%), Gaps = 47/276 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN---- 64
           M  +  I+D H+    +                    +  + +    L+  I        
Sbjct: 1   MTTILQITDTHIVPEGALVS----------------GRLDTADALERLVARINSIRDQIG 44

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
            VD V ++GD+ +             +  +  P  I ++PGNHD   +            
Sbjct: 45  AVDAVLVSGDLSDDGTAESYTRFKKLMAPLDLP--IHVIPGNHDGRAT------------ 90

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
              +            + R    + LIG  T +        G    E     S  L +A 
Sbjct: 91  LRAAFADQFAPTGSLNWTRSIGGLHLIGLDTLVEGQ---GGGTLAPESLSFLSGALSQA- 146

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADL-ILHGHTHLNSLHWIK 240
            +G   ++ +HH P L      + +         +++      L +L GH H   +  + 
Sbjct: 147 -RGAPVLLALHHQPFLCGIGFMDAIGLSNKNALSEIVAGYPGPLRLLCGHIHSMMISDVG 205

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
                   +   S       +    +   + +++  
Sbjct: 206 GHI----AISCPSPCSSFAYDCRPDAPTGYMLQEDG 237


>gi|116669127|ref|YP_830060.1| metallophosphoesterase [Arthrobacter sp. FB24]
 gi|116609236|gb|ABK01960.1| metallophosphoesterase [Arthrobacter sp. FB24]
          Length = 313

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 44/278 (15%), Positives = 79/278 (28%), Gaps = 52/278 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           L H+SD HL   P                        S+     L  ++       + V 
Sbjct: 15  LLHLSDPHLLGGPDHL----------------YGAVDSEARLKQLFEEVKASGARPEAVI 58

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGN--PHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +          +    GNHD               ++ + 
Sbjct: 59  FTGDLADRGETEAYAKLRAIVEPACKSMNAQVIWAMGNHDDR------------HNFRSG 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                            N + +I   T++   P   +G   + Q    +  L      G 
Sbjct: 107 LLDQPGNDSPVDQSYFINGLRVITLDTSV---PGFHHGELSESQLEWLAAELATPAPDGT 163

Query: 188 FRIIMMHHPPVLD--TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ +HHPPV      ++   + G      ++ +     IL GH H ++          
Sbjct: 164 --ILALHHPPVPSILDLAVLVELRGQPALAAVLRNSDVRTILAGHLHYSTTASFAG---- 217

Query: 246 IPVVGIASASQKVHSNKPQAS---------YNLFYIEK 274
           IPV   ++       N P            +NL ++ +
Sbjct: 218 IPVSVASATCYTQDLNVPVGGTRPIDGGQAFNLVHVYE 255


>gi|152983787|ref|YP_001351017.1| hypothetical protein PSPA7_5698 [Pseudomonas aeruginosa PA7]
 gi|150958945|gb|ABR80970.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 272

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/299 (13%), Positives = 82/299 (27%), Gaps = 55/299 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                          ++  +       D + 
Sbjct: 16  LVQLSDSHLFAEDGARLLGMDTAYS----------------LEKVVERVAREQPSIDLIL 59

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                  +  P       GNHD      +               
Sbjct: 60  ATGDVSQDGSLDSYARFRRLSAPLAAPLRWFA--GNHDEREPMQQ--------------- 102

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             + G  L   +    N  ++   ++I        GY  ++Q     + +  A ++  F 
Sbjct: 103 -ATAGSDLLEQVVDVGNWRVVLLDSSIPGAV---PGYLEEDQLELLRRAIDSAGER--FL 156

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++  HH PV   S   + +     Q    ++        +L GH H         ++  +
Sbjct: 157 LVSFHHHPVPIGSDWMDPIGLRNPQALFDLLAPYPQVRCLLWGHIHQ----EFDRQRGPL 212

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYD 305
            ++   S   +            F ++++   +    + +        I +   DI ++
Sbjct: 213 RLLASPSTCVQFAPGSSD-----FTLDRQAPGYR-WLRLHADGRLETGISRVD-DIAFE 264


>gi|257061627|ref|YP_003139515.1| metallophosphoesterase [Cyanothece sp. PCC 8802]
 gi|256591793|gb|ACV02680.1| metallophosphoesterase [Cyanothece sp. PCC 8802]
          Length = 366

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/287 (16%), Positives = 93/287 (32%), Gaps = 29/287 (10%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A ISD H+   P   +L   R               S      +++ +   ++D + 
Sbjct: 3   FRFAIISDPHV-AVPQTIDLHSTRFS---------VVEISLLALEKVLSHLEQLDIDFLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSL-HAWKDYITSD 128
           + GD+               L ++  P  + +VPGNHD       +++L           
Sbjct: 53  LPGDLTQDGELDNHRWLQQRLAAL--PFPVYVVPGNHDIPSLQPNQQTLGFHQFPDYYYH 110

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
            +     +L+    +   + LIG ++          G   + Q     +LL +   +  F
Sbjct: 111 QSYRNLNQLYYTCEVLPGVQLIGLNSTQFNQQGKQIGCLDENQLAWLEQLLPQLKDQFIF 170

Query: 189 RIIMMH---HPP--VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            ++  +   H P            +        ++   G  LI  GH H+  + +     
Sbjct: 171 VMVHHNVIEHLPGQANHELGKRYMLDNANLLLNLLKESGCQLIFTGHLHVQDIAY----S 226

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIE-KKNEYWTLEGKRYTLS 289
             I  +   S     H       Y +  +E K+++   L    + ++
Sbjct: 227 NNIYEITTGSLVSYPHP------YRIIEVEHKQHKNIRLNVTSHRVN 267


>gi|67922463|ref|ZP_00515973.1| Metallophosphoesterase [Crocosphaera watsonii WH 8501]
 gi|67855722|gb|EAM50971.1| Metallophosphoesterase [Crocosphaera watsonii WH 8501]
          Length = 363

 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/296 (14%), Positives = 95/296 (32%), Gaps = 30/296 (10%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  + ISD H++   +  + +                  S      +++ +   N+D + 
Sbjct: 3   FRFSIISDPHVAVPHTLPDHT----------KRFHLVEVSILALEKVLSHLEQLNLDFLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           + GD+               LRS+  P  + +VPGNHD       +  +   +       
Sbjct: 53  LPGDLTQDGEVDNHDWLGKRLRSL--PFPVFVVPGNHDVPSVNPTKAKIGLHQFPSYYGH 110

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
              + ++L+    I   + +IG ++          G   ++Q      LL +   +    
Sbjct: 111 CGYSSQQLYYTQEILPGVRIIGLNSNEFNEEGKQLGCLDEQQLTWLENLLPQVKDQLLLV 170

Query: 190 IIMMH---HPPV--LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           +I  +   H P            +       KM+      LI  GH H+  + + +    
Sbjct: 171 MIHHNVIEHLPDQSHHELGKRYMLDNAPLLLKMLNSANCKLIFTGHLHVQDVAYHQG--- 227

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEK---KNEYWTLEGKRYTLSPDSLSIQK 297
            +  +   S     H       Y +  +++    +    +   R    P   ++++
Sbjct: 228 -MYEITTGSLVSYPHP------YRVIEVKRPFDGSLSLNITSHRVKSVPGWDNLEE 276


>gi|330956970|gb|EGH57230.1| metallophosphoesterase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 277

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 84/272 (30%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLAALRRAVAHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD         +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLQMP--FYLVPGNHDDREHLLAAFADQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASAPLDWVVEKYPVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|312128159|ref|YP_003993033.1| metallophosphoesterase [Caldicellulosiruptor hydrothermalis 108]
 gi|311778178|gb|ADQ07664.1| metallophosphoesterase [Caldicellulosiruptor hydrothermalis 108]
          Length = 382

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 52/279 (18%), Positives = 95/279 (34%), Gaps = 40/279 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL-HNVDHV 68
           F  A ISD H+S   S    + +           +    S  +    + +I    ++  V
Sbjct: 48  FKFAVISDPHISVFKSSKSPTNE----------VKMFKDSVSLLESTVKEINKIQDIKFV 97

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISG----AKEKSLHAWKDY 124
            + GD+        +      L  +  P+   +V GNHD  +          S+      
Sbjct: 98  CVLGDLTKDAEPWNVDKVKEILDRLQVPY--YVVLGNHDVSVVDSHLKNMGPSVTRSTMI 155

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
            T      +G   +  L     + LIG  + +        GY   +Q     K L+  N 
Sbjct: 156 WTFQGHGFSGPNRWWSLDPLPGVHLIGLDSTMIGDWG---GYIDNKQLKFLEKDLQ--NN 210

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRF--------QKMIWHEG-ADLILHGHTHLNS 235
           K  F I+M+HH  +  T +         +F        ++++       ++L GH H+++
Sbjct: 211 KSKFTIVMLHHQLLPYTKAEETGENNFNKFVLYNSKQVREVLEKFPQVAVVLSGHRHIST 270

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEK 274
            + ++   K I     AS             Y +F I+ 
Sbjct: 271 RYKME---KSIAYFTCASTVTYPMR------YTIFEIKD 300


>gi|11500006|ref|NP_071252.1| lacZ expression regulatory protein (icc) [Archaeoglobus fulgidus
           DSM 4304]
 gi|2650659|gb|AAB91233.1| lacZ expression regulatory protein (icc) [Archaeoglobus fulgidus
           DSM 4304]
          Length = 372

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 58/303 (19%), Positives = 101/303 (33%), Gaps = 62/303 (20%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISD+H                          +   +E     +  I     D + 
Sbjct: 1   MRIVHISDLHFG------------------------EELIREKVEKAVRQINEIEPDLLV 36

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+  +  + E+  +      +    D   VPGNHDA   G +   L+          
Sbjct: 37  ITGDLSCWGIHSEMRDAYE--TLLDLKPDYIAVPGNHDARNIGYEFFQLYF--------- 85

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                          + ++LI   +   T P   +GY G+EQ       +    +K  F 
Sbjct: 86  ------GETKKYWKNDVVSLIAADS---TQPDLDDGYIGKEQRDWIVSKI----RKDRFN 132

Query: 190 IIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           I+ +HH   P+  T    N +       +++   G   +L GH H+     +        
Sbjct: 133 ILALHHHIAPIPKTGRERNVLIDAGEMVELLIANGISAVLAGHRHMPYSLRL----MRTH 188

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKN--------EYWTLEGKRYTLSPDSLSIQKDY 299
           V+   +         P  +YN+  I+           +Y  +E  RYT++P++      Y
Sbjct: 189 VIHAGTLGSFKVLGMPDHNYNVIEIKDNTLTLKLRFVDYGEVEIGRYTINPETPESISVY 248

Query: 300 SDI 302
             I
Sbjct: 249 QRI 251


>gi|260100110|pdb|3IB7|A Chain A, Crystal Structure Of Full Length Rv0805
 gi|260100111|pdb|3IB8|A Chain A, Crystal Structure Of Full Length Rv0805 In Complex With
           5'- Amp
          Length = 330

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/281 (14%), Positives = 77/281 (27%), Gaps = 52/281 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           +VL HISD HL                +           + +    L+  +       D 
Sbjct: 26  YVLLHISDTHL----------------IGGDRRLYGAVDADDRLGELLEQLNQSGLRPDA 69

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYI 125
           +  TGD+ +             +          +  V GNHD               +  
Sbjct: 70  IVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDR------------AELR 117

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 +        + + + + +I   T++   P   +G     Q    ++ L      
Sbjct: 118 KFLLDEAPSMAPLDRVCMIDGLRIIVLDTSV---PGHHHGEIRASQLGWLAEELATPAPD 174

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           G   I+ +HHPP+     +   +         +++       IL GH H ++        
Sbjct: 175 GT--ILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVG-- 230

Query: 244 KLIPVVGIASASQK---------VHSNKPQASYNLFYIEKK 275
             IPV   ++                       NL ++   
Sbjct: 231 --IPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPD 269


>gi|37527807|ref|NP_931152.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36787243|emb|CAE16324.1| Icc protein [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 279

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/305 (12%), Positives = 87/305 (28%), Gaps = 50/305 (16%)

Query: 5   YTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
                  +  I+D HL  S     L                    + V + ++      +
Sbjct: 10  VEGTTAKILQITDTHLFASKEDTLLGINTYRSY------------QAVLDAILKQ--NAD 55

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
           +D +  TGD+V              +  +  P     +PGNHD   +             
Sbjct: 56  IDLIVATGDLVQDQSLEAYRHFADGIARL--PAPCVWLPGNHDYQPAMV----------- 102

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
              D   + G      + +  +  L+   + +   P    G   + Q       L +  +
Sbjct: 103 ---DALAAAGVSPSKQILVGKHWQLLMLDSQVQGVPH---GELSEYQLEWMKNCLDRHPE 156

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKN 241
           +  + +I++HH P+    +  ++          + +        +L GH H         
Sbjct: 157 R--YAVILLHHHPLPSGCTWLDQHSLRNSHILAQYLQSYSRVKAMLCGHIHQEMDLDWNG 214

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD---SLSIQKD 298
               I ++   S   +   +        F ++     W         + +   +  + + 
Sbjct: 215 ----IRMMATPSTCLQFKPHCTN-----FMLDTVAPGWRYLELSVADNGEFGLTTQVYRL 265

Query: 299 YSDIF 303
            S+ F
Sbjct: 266 ASNEF 270


>gi|262364710|gb|ACY61267.1| Icc-like protein [Yersinia pestis D182038]
          Length = 268

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 38/294 (12%), Positives = 76/294 (25%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D V  
Sbjct: 16  RILQITDTHLFAGEHETLLGVNTFHSY------------RAVLDAIIAE--QHPFDLVVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHSVAAYQNFAKGISRL--PVPCVWLPGNHDFQPAM--------------FDAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      +    +  ++   + +   P+   G     Q     + L    ++    +
Sbjct: 106 AEAGIAPSKQVLAGEHWQILLLDSQVFGVPY---GELSDYQLEWMERCLIAYPERYTLIL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 163 LHHHPMPSGCTWLDQHSLRNAHMLAAILTRYPRVTTLLCGHIHQDLDLDWYGK----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               + +  SD F
Sbjct: 219 ASPSTCVQFKPHCTN-----FTLDAVAPGWRY-LDLLPDGGLETEVHRLDSDEF 266


>gi|288932603|ref|YP_003436663.1| metallophosphoesterase [Ferroglobus placidus DSM 10642]
 gi|288894851|gb|ADC66388.1| metallophosphoesterase [Ferroglobus placidus DSM 10642]
          Length = 373

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 51/268 (19%), Positives = 93/268 (34%), Gaps = 54/268 (20%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISD+H                          +   +      I  I     D V 
Sbjct: 1   MKIVHISDLHFG------------------------EELVRSKVEKAIKQINEIEPDLVV 36

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+  +  + E+  +   L  + +  D  +VPGNHDA  +G +   L+  +       
Sbjct: 37  VTGDLSCWGIHSELREAYEALEKLKS--DYFVVPGNHDARNNGIEFFELYFGERKK---- 90

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                      +   + + +IG  +   T P   +GY G EQ     +      +K    
Sbjct: 91  -----------IYKDSEVVIIGVDS---TQPDIDDGYIGFEQRRWIEENF----RKDRIN 132

Query: 190 IIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           ++ +HH   P+ DT    N +       +M+ + G  L+L GH H+     +        
Sbjct: 133 VLALHHHIVPIPDTGRERNVLIDAGEVVEMLINLGFALVLAGHRHMPYSIRL----MRTH 188

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKK 275
           ++   S         P  +YN+  + + 
Sbjct: 189 IIHAGSLGSFKILGMPDHNYNVIELSED 216


>gi|255262657|ref|ZP_05341999.1| metallophosphoesterase [Thalassiobium sp. R2A62]
 gi|255104992|gb|EET47666.1| metallophosphoesterase [Thalassiobium sp. R2A62]
          Length = 269

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 48/276 (17%), Positives = 83/276 (30%), Gaps = 45/276 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--- 65
           M  +  ISD H+                         +  + E     +  I        
Sbjct: 1   MTRIIQISDPHIVPHGQLA----------------YGQVDTAEALTNCVETINASLPQIG 44

Query: 66  --DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D V + GD+ +F    E       +  +  P+    VPGNHD         S   W  
Sbjct: 45  PIDMVIVAGDLTDFGTEEEYQRFRKLMEPLNLPYR--AVPGNHDDVAVMRTSFSDQPWMP 102

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                      +    ++   +++ +IG  +++      A+G+         S  L    
Sbjct: 103 V----------EGPINWIEDFDDLVVIGLDSSVEGK---AHGHLSDATLSFLSTSLD--V 147

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQ--RFQKMIWHEGADLIL-HGHTHLNSLHWIK 240
           + G   I+ +HHPPVL      +     +  + Q ++     +L L  GH H N +    
Sbjct: 148 QDGKPTIVTIHHPPVLTGIEKMDIQNLRESTQLQAILSGYKGELRLTCGHIHRNIVAPFG 207

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
                I        S  V  +    + N    E   
Sbjct: 208 GVICQI----SPGVSHAVTMDLRTGAPNCLTKEPGG 239


>gi|22127387|ref|NP_670810.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pestis KIM 10]
 gi|21960474|gb|AAM87061.1|AE013954_5 regulator of lacZ [Yersinia pestis KIM 10]
          Length = 285

 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 38/294 (12%), Positives = 76/294 (25%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D V  
Sbjct: 26  RILQITDTHLFAGEHETLLGVNTFHSY------------RAVLDAIIAE--QHPFDLVVA 71

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 72  TGDLAQDHSVAAYQNFAKGISRL--PVPCVWLPGNHDFQPAM--------------FDAL 115

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      +    +  ++   + +   P+   G     Q     + L    ++    +
Sbjct: 116 AEAGIAPSKQVLAGEHWQILLLDSQVFGVPY---GELSDYQLEWMERCLIAYPERYTLIL 172

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 173 LHHHPMPSGCTWLDQHSLRNAHMLAAILTRYPRVTTLLCGHIHQDLDLDWYGK----RLL 228

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               + +  SD F
Sbjct: 229 ASPSTCVQFKPHCTN-----FTLDAVAPGWRY-LDLLPDGGLETEVHRLDSDEF 276


>gi|218515220|ref|ZP_03512060.1| putative phosphoesterase protein [Rhizobium etli 8C-3]
          Length = 132

 Score =  106 bits (264), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 87/127 (68%)

Query: 177 KLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSL 236
            +LR A + G FR++M+HHPP+   ++ Y RM GI+RF  +I   GA+L+LHGHTHLN+L
Sbjct: 4   NMLRAAGEAGLFRVVMIHHPPIRGATTFYKRMIGIRRFAAVISTGGAELVLHGHTHLNTL 63

Query: 237 HWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
           HW++ + + +PVVGIASASQ   S KP A+YNLF I+     W L G+R++L+    ++ 
Sbjct: 64  HWLRGQVQPVPVVGIASASQGPGSIKPAAAYNLFSIDGSPGAWELSGERFSLNRAGDAVI 123

Query: 297 KDYSDIF 303
            +  DIF
Sbjct: 124 PESVDIF 130


>gi|238782857|ref|ZP_04626886.1| hypothetical protein yberc0001_34870 [Yersinia bercovieri ATCC
           43970]
 gi|238716280|gb|EEQ08263.1| hypothetical protein yberc0001_34870 [Yersinia bercovieri ATCC
           43970]
          Length = 282

 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/299 (12%), Positives = 78/299 (26%), Gaps = 44/299 (14%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +     +  I+D HL        L                    + V + +I +   H  
Sbjct: 18  SGAKVRILQITDTHLFAGEHETLLGVNTSHSY------------RAVLDAIIAE--QHPF 63

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D +  TGD+               +  +  P     +PGNHD   +              
Sbjct: 64  DLIVATGDLAQDHSVAAYQNFAKGIARL--PAPCLWLPGNHDFQPAMV------------ 109

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D     G      + + +N  ++   + +   P+   G     Q     + L     +
Sbjct: 110 --DALADAGIAPSKQVLVGDNWQILLLDSQVFGVPY---GELSDYQLEWMERCLEAYPAR 164

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
               ++  H  P   T    + +         +        +L GH H +       +  
Sbjct: 165 YTLILLHHHPMPSGCTWLDQHSLRNAHMLAATLTRYPRVTTLLCGHIHQDLDLDWYGK-- 222

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              ++   S   +   +        F ++     W               +++  SD F
Sbjct: 223 --RLLASPSTCVQFKPHCTN-----FTLDTVAPGWRY-LDLLPNGVLETEVRRLASDEF 273


>gi|126732955|ref|ZP_01748716.1| possible phospodiesterase [Sagittula stellata E-37]
 gi|126706572|gb|EBA05648.1| possible phospodiesterase [Sagittula stellata E-37]
          Length = 279

 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 47/285 (16%), Positives = 94/285 (32%), Gaps = 45/285 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANL-LINDILLHNVDH 67
           M  + H+SD+H                              +      L+  +     D 
Sbjct: 1   MRRVLHLSDLHYGKD--------------------------RANLEAPLLETVDRLAPDL 34

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V+I+GD        +   +  +L  +  P     VPGNHD  +     + L  WK Y ++
Sbjct: 35  VAISGDFTQRARVSQFDRAQAFLDKLTVP--WIAVPGNHDTPLDEFWIRLLTPWKRYRSA 92

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
            +           +   + + L+G +T          G   +++     +    A  +  
Sbjct: 93  VSGDLEP------VYQDDAMTLVGVNTVNRFSW--QRGRLSEKRIKRACQQFSDAPDR-- 142

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            RI+M+HHP           M G  R  K     GA ++L GH H   +   +     + 
Sbjct: 143 ARIVMLHHPLQHGPEVDKRLMRGAGRALKAFAESGAQVVLSGHLHNTVIAPFR-AWPQLL 201

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
            V   ++       +   ++NL  ++ +    ++  + +     +
Sbjct: 202 FVQAGTSLSSRMRGEV-NTFNLLEVDAR----SVTVESWGAEDLT 241


>gi|304393767|ref|ZP_07375693.1| metallophosphoesterase [Ahrensia sp. R2A130]
 gi|303294110|gb|EFL88484.1| metallophosphoesterase [Ahrensia sp. R2A130]
          Length = 269

 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 46/276 (16%), Positives = 84/276 (30%), Gaps = 45/276 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--- 65
           M  +  ISD H+                         +  +       +  I        
Sbjct: 1   MTKIIQISDPHIVPHGQLA----------------YGQVDTASALAECVETINRRLPDIG 44

Query: 66  --DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D   +TGD+ +F    E       +  +  P+    VPGNHD         S   W  
Sbjct: 45  PIDMAIVTGDLTDFGTEEEYQRFRELMSPLAIPYR--AVPGNHDDVSLMRACFSDEDWMP 102

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                           ++    N+ LIG  +++   P  A+G+   +        L  A 
Sbjct: 103 ----------ADGPINWISDFENLTLIGLDSSV---PDMAHGHLVDDTLAFLKSAL--AA 147

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADL-ILHGHTHLNSLHWIK 240
           + G   I+ +HHPP++      +       ++ Q ++     +L ++ GH H N +    
Sbjct: 148 RTGNPVIVALHHPPIMTGIEKMDIQNLRESRKLQSILSDHEHELRLICGHVHRNIVAHFG 207

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
                +        S  V  +  + + N    E   
Sbjct: 208 GAICQV----APGISHAVTMDLREGAANCLSKEPGG 239


>gi|317152355|ref|YP_004120403.1| metallophosphoesterase [Desulfovibrio aespoeensis Aspo-2]
 gi|316942606|gb|ADU61657.1| metallophosphoesterase [Desulfovibrio aespoeensis Aspo-2]
          Length = 282

 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 55/266 (20%), Positives = 91/266 (34%), Gaps = 32/266 (12%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AHISD+H+                      N          N +         D V
Sbjct: 1   ML-IAHISDLHIRPHGEKL---------YDFVDTNALISRHVATLNSIAKTTDS--PDAV 48

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGDIVN    +E   +   L  +  P  + I+PGNHD   +  +  +          +
Sbjct: 49  LITGDIVNCGQKQEYAMARRILGQLTMP--LYIIPGNHDNNANLLEALTDICPP----LE 102

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               TG+    Y      +  I   ++I        G  G+EQ     K L+     G  
Sbjct: 103 NVGKTGEHTIRYTIEEFPVRFIMLDSSIGGELH---GEIGREQMAWLEKELQ--KGTGRE 157

Query: 189 RIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
             + MHH P+   ++  +  +    +   +M+        ++ GHTH +    +      
Sbjct: 158 TAVCMHHHPLPSGNAHMDAIKCHDGEALIEMLSRYPNVTRLICGHTHRSIFQNV----GR 213

Query: 246 IPVVGIASASQK--VHSNKPQASYNL 269
           I +  +  A+ +   HS     SY L
Sbjct: 214 ILICTVPGAAHQVPFHSTDLDGSYTL 239


>gi|163840273|ref|YP_001624678.1| putative 3',5'-cyclic-nucleotide phosphodiesterase [Renibacterium
           salmoninarum ATCC 33209]
 gi|162953749|gb|ABY23264.1| putative 3',5'-cyclic-nucleotide phosphodiesterase [Renibacterium
           salmoninarum ATCC 33209]
          Length = 309

 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/257 (16%), Positives = 88/257 (34%), Gaps = 29/257 (11%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           M+   +     + H+SD H+        +   R                + +   L   +
Sbjct: 1   MSTSNSYETLSILHLSDTHVLAKGLHSNVVDTR----------------QNLLEALRALV 44

Query: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGN--PHDISIVPGNHDAYISGAKEKSL 118
            +  +D V ++GD+ +             + +  +          GNHD      +    
Sbjct: 45  PVEELDLVVVSGDVSDDGTAESYRMVQELVENFASHRGARAIYTMGNHDGRPGFWEVLGN 104

Query: 119 HAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
                   S      G+       +     +I   T++   P   +GY  + Q    ++ 
Sbjct: 105 GHPD----SPAEQDGGQLPVYGSSVLGGFRIISLDTSV---PGRTHGYLDRGQLDWLTEE 157

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSL 236
           L  A++ G   ++++HHPPV   + L++ +     +   +++      LIL GH H   +
Sbjct: 158 LGSASEAGT--VLVLHHPPVEPVTPLHDGIELQNPEDLLEVLHGSDVRLILSGHYHHGLV 215

Query: 237 HWIKNEKKLIPVVGIAS 253
             +    +LIPV+    
Sbjct: 216 DSVLLGDQLIPVLVAPG 232


>gi|78065810|ref|YP_368579.1| metallophosphoesterase [Burkholderia sp. 383]
 gi|77966555|gb|ABB07935.1| Metallophosphoesterase [Burkholderia sp. 383]
          Length = 274

 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 42/291 (14%), Positives = 90/291 (30%), Gaps = 51/291 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  LA ISD+H+                        ++  +       I  +       D
Sbjct: 1   ML-LAQISDLHIKRPGQLA----------------YRRVDTAAALTRCIEKLNALVPRPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ +F  + E       L ++  P+   ++ GNHD      +            
Sbjct: 44  AVLVTGDLTDFGHDEEYGNLRGLLAALEIPY--YLMIGNHDDRAGLRRA----------F 91

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
           +D       +   Y      + ++   + +   P ++ G     +    +  L  A  + 
Sbjct: 92  ADRAELQDGEFVQYALDVGAVRVLALDSQV---PGASYGDLCDARLAWLAAQLDAARDR- 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              I+ +HHPP +      +++        +   ++      + +L GH H         
Sbjct: 148 -PVIVALHHPPFVAGIGHMDKLRLAPAASAKLDALLRGYPNVERVLCGHVHRTMFTRF-- 204

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
                    + S + +V  +    + + F +E            +   PD+
Sbjct: 205 --GGTLAAAVPSPAHQVAFDLRTDAPSAFRLEPPAFAV------HRYVPDA 247


>gi|45442744|ref|NP_994283.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pestis biovar Microtus str. 91001]
 gi|150260302|ref|ZP_01917030.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pestis CA88-4125]
 gi|165925073|ref|ZP_02220905.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|166008829|ref|ZP_02229727.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166212063|ref|ZP_02238098.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167399027|ref|ZP_02304551.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167418820|ref|ZP_02310573.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167425089|ref|ZP_02316842.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167470307|ref|ZP_02335011.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pestis FV-1]
 gi|218927859|ref|YP_002345734.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pestis CO92]
 gi|229837348|ref|ZP_04457511.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia pestis
           Pestoides A]
 gi|229840560|ref|ZP_04460719.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842892|ref|ZP_04463044.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229900887|ref|ZP_04516011.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia pestis
           Nepal516]
 gi|270487741|ref|ZP_06204815.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia pestis KIM D27]
 gi|294502733|ref|YP_003566795.1| Icc-like protein [Yersinia pestis Z176003]
 gi|45437610|gb|AAS63160.1| Icc protein homologue [Yersinia pestis biovar Microtus str. 91001]
 gi|115346470|emb|CAL19343.1| Icc protein homologue [Yersinia pestis CO92]
 gi|149289710|gb|EDM39787.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pestis CA88-4125]
 gi|165923273|gb|EDR40424.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165992168|gb|EDR44469.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166206809|gb|EDR51289.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166962814|gb|EDR58835.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167051531|gb|EDR62939.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167055852|gb|EDR65633.1| Ser/Thr protein phosphatase family protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229682226|gb|EEO78318.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia pestis
           Nepal516]
 gi|229690159|gb|EEO82216.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696926|gb|EEO86973.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229705471|gb|EEO91481.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia pestis
           Pestoides A]
 gi|262360765|gb|ACY57486.1| Icc-like protein [Yersinia pestis D106004]
 gi|270336245|gb|EFA47022.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia pestis KIM D27]
 gi|294353192|gb|ADE63533.1| Icc-like protein [Yersinia pestis Z176003]
          Length = 275

 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 38/294 (12%), Positives = 76/294 (25%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D V  
Sbjct: 16  RILQITDTHLFAGEHETLLGVNTFHSY------------RAVLDAIIAE--QHPFDLVVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHSVAAYQNFAKGISRL--PVPCVWLPGNHDFQPAM--------------FDAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      +    +  ++   + +   P+   G     Q     + L    ++    +
Sbjct: 106 AEAGIAPSKQVLAGEHWQILLLDSQVFGVPY---GELSDYQLEWMERCLIAYPERYTLIL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 163 LHHHPMPSGCTWLDQHSLRNAHMLAAILTRYPRVTTLLCGHIHQDLDLDWYGK----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               + +  SD F
Sbjct: 219 ASPSTCVQFKPHCTN-----FTLDAVAPGWRY-LDLLPDGGLETEVHRLDSDEF 266


>gi|15600162|ref|NP_253656.1| Cyclic AMP (cAMP) Phosphodiesterase, CpdA [Pseudomonas aeruginosa
           PAO1]
 gi|218894064|ref|YP_002442933.1| putative phosphohydrolases [Pseudomonas aeruginosa LESB58]
 gi|254238317|ref|ZP_04931640.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254244143|ref|ZP_04937465.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|9951252|gb|AAG08354.1|AE004910_1 Cyclic AMP (cAMP) Phosphodiesterase, CpdA [Pseudomonas aeruginosa
           PAO1]
 gi|126170248|gb|EAZ55759.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126197521|gb|EAZ61584.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218774292|emb|CAW30109.1| putative phosphohydrolases [Pseudomonas aeruginosa LESB58]
          Length = 272

 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 83/303 (27%), Gaps = 57/303 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   +      ++  +       D + 
Sbjct: 16  LVQLSDSHLFAEDGARLLG----------------MDTAHSLEKVVERVAREQPRIDLIL 59

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                  +  P       GNHD      +               
Sbjct: 60  ATGDVSQDGSLDSYTRFRRLSAPLDAPLRWFA--GNHDEREPMQR--------------- 102

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             + G  L   +    N  ++   ++I        GY  ++Q     + +  A ++  F 
Sbjct: 103 -ATEGSDLLEQVVDVGNWRVVLLDSSIPGAV---PGYLEEDQLELLRRAIDSAGER--FL 156

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++  HH PV   S   + +     Q    ++        +L GH H         ++  +
Sbjct: 157 LVSFHHHPVPIGSDWMDPIGLRNPQALFDLLAPYPQVRCLLWGHIHQ----EFDRQRGPL 212

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF--- 303
            ++   S   +            F +++    +    + +        I +    +F   
Sbjct: 213 RLLASPSTCVQFAPGSSD-----FTLDRLAPGYR-WLRLHDDGRLETGISRVDDVVFEVD 266

Query: 304 YDT 306
           YDT
Sbjct: 267 YDT 269


>gi|329847417|ref|ZP_08262445.1| calcineurin-like phosphoesterase family protein [Asticcacaulis
           biprosthecum C19]
 gi|328842480|gb|EGF92049.1| calcineurin-like phosphoesterase family protein [Asticcacaulis
           biprosthecum C19]
          Length = 257

 Score =  106 bits (263), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 49/287 (17%), Positives = 85/287 (29%), Gaps = 40/287 (13%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +AHISD+H                                   +LI        D V 
Sbjct: 1   MKIAHISDLHFGSLSRPVS-------------------------EVLIRHFQADKPDLVV 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ++GDI       E   +  +   +  P  +  +PGNHD       E+    W  Y     
Sbjct: 36  VSGDITQDATCSEFEEARAFFDLL--PMPVFCIPGNHDLPGMD-MERFYDPWGRYKRFIA 92

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                +     + ++     I  +  +      ANG   Q Q     +    A     +R
Sbjct: 93  EDLEPELKTDLVHLKG----INTARRVLAHWNWANGSVSQRQCRDIQRSYADATAP--WR 146

Query: 190 IIMMHHPPVLDTSSL-YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           + +MHHP +          +F   R  K +     D++L GH H   +            
Sbjct: 147 VFVMHHPVMNAREMPLQVSLFNRNRLLKCLDDVRVDIVLAGHQHHAYVENRLTGGHTTIF 206

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
           V  ++ +      +    +N+     K     +   R  L  ++  I
Sbjct: 207 VNASTTTSLRIR-RQPNGFNMLNFTDK----AVRIDRMELKDEAFHI 248


>gi|76808661|ref|YP_332943.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1710b]
 gi|76578114|gb|ABA47589.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1710b]
          Length = 325

 Score =  106 bits (263), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 39/246 (15%), Positives = 75/246 (30%), Gaps = 40/246 (16%)

Query: 3   KRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL 62
           +     M +LAHISD+H+    +                   ++  +       +  +  
Sbjct: 45  QSQRGTMMLLAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNA 88

Query: 63  H--NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
                D V +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +      
Sbjct: 89  LEPRPDAVLVTGDLTDFGDDDEYAHLKALLAPLAMPY--YLLVGNHDDRAAMRRAFPAR- 145

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
                          +   Y      + +I   + I   P ++ G     +    +  L 
Sbjct: 146 ---------VELQSGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLD 193

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNS 235
            A  +    I+ +HHPP        + M        R   ++      + +L GH H   
Sbjct: 194 AARDR--PVIVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTM 251

Query: 236 LHWIKN 241
                 
Sbjct: 252 FARFGG 257


>gi|215429655|ref|ZP_03427574.1| hypothetical protein MtubE_02925 [Mycobacterium tuberculosis
           EAS054]
 gi|289752854|ref|ZP_06512232.1| icc protein [Mycobacterium tuberculosis EAS054]
 gi|289693441|gb|EFD60870.1| icc protein [Mycobacterium tuberculosis EAS054]
          Length = 318

 Score =  106 bits (263), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/281 (14%), Positives = 77/281 (27%), Gaps = 52/281 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           +VL HISD HL                +           + +    L+  +       D 
Sbjct: 14  YVLLHISDTHL----------------IGGDRRLYGAVDADDRLGELLEQLNQSGLRPDA 57

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYI 125
           +  TGD+ +             +          +  V GNHD               +  
Sbjct: 58  IVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDR------------AELR 105

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 +        + + + + +I   T++   P   +G     Q    ++ L      
Sbjct: 106 KFLLDEAPSMAPLDRVCMIDGLRIIVLDTSV---PGHHHGEIRASQLGWLAEELATPAPD 162

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           G   I+ +HHPP+     +   +         +++       IL GH H ++        
Sbjct: 163 GT--ILALHHPPIPSVLDMAVTVELRNQAALGRVLRGTDVRAILAGHLHYSTNATFVG-- 218

Query: 244 KLIPVVGIASASQK---------VHSNKPQASYNLFYIEKK 275
             IPV   ++                       NL ++   
Sbjct: 219 --IPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPD 257


>gi|271498903|ref|YP_003331928.1| Calcineurin phosphoesterase domain-containing protein [Dickeya
           dadantii Ech586]
 gi|270342458|gb|ACZ75223.1| Calcineurin phosphoesterase domain protein [Dickeya dadantii
           Ech586]
          Length = 275

 Score =  105 bits (262), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 41/296 (13%), Positives = 85/296 (28%), Gaps = 48/296 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V N +       NVD ++ 
Sbjct: 16  RILQITDTHLFADEQGTLLGVNTNRSY------------QAVLNAI--AAQQMNVDLITA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +R +G P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHTQDAYTHFATGIRRLGAPC--VWLPGNHDFQPAMV--------------DVL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             +G     ++ +  +  +I   + +   P    G   + Q     + L+   ++  + +
Sbjct: 106 ARSGIAPSKHVLLGEHWQVILLDSQVFGVPH---GELSEYQLEWLERSLQSQPER--YTL 160

Query: 191 IMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           +M+HH P+    +  ++           ++        +L GH H               
Sbjct: 161 LMLHHHPLSSGCTWLDQHSLRNAHSLDALLSRFPRVRTVLCGHIHQEMDLDWNGR----R 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           ++   S   +   +        F I+     W    +          + +   + F
Sbjct: 217 LLATPSTCVQFKPHCTN-----FTIDNVAPGWRY-LELLPDGGVETRVCRLEGNEF 266


>gi|291288511|ref|YP_003505327.1| metallophosphoesterase [Denitrovibrio acetiphilus DSM 12809]
 gi|290885671|gb|ADD69371.1| metallophosphoesterase [Denitrovibrio acetiphilus DSM 12809]
          Length = 432

 Score =  105 bits (262), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 48/304 (15%), Positives = 91/304 (29%), Gaps = 33/304 (10%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
             A +SD H+         +             +    S E+   ++ND+   +++ V +
Sbjct: 39  RFAVLSDPHI---YDPSLGTTGTAFETYLSSDRKMLAESVEILEAVVNDLTKADLNFVLV 95

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNP-HDISIVPGNHDAYISGAK--------------- 114
            GD+               + ++ +    + +VPGNHD     A                
Sbjct: 96  PGDLTKDGEYICHEKFISIMSALQDKGVKVYVVPGNHDINNPHAVSFDGNSTSHVPSVTS 155

Query: 115 EKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFS---ANGYFGQEQ 171
           E     + D+            L     +  N+ L    +       +    +G    E 
Sbjct: 156 EDFEKLYDDFGYGKAKYRDSNSLSYVAELTGNVWLFAIDSCKYDNNDTYPETSGAISDET 215

Query: 172 AHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRM-----FGIQRFQKMIWHEGADLI 226
               S+ L +A +KG   I M+HH  +   S+                 K +   G  +I
Sbjct: 216 FEWLSEKLAEAERKGKLCIGMLHHNVIPHFSAQTTFFSEYVVDDYDVMGKKLADAGLGII 275

Query: 227 LHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRY 286
             GH H   +   + +   +  V   S             Y +  ++ +N   T+E    
Sbjct: 276 FTGHFHAQDIIRAEYDTSTLYEVETGSTVTAPCP------YRIIDLDIRNAALTIESHTV 329

Query: 287 TLSP 290
              P
Sbjct: 330 ESIP 333


>gi|300361725|ref|ZP_07057902.1| phosphohydrolase [Lactobacillus gasseri JV-V03]
 gi|300354344|gb|EFJ70215.1| phosphohydrolase [Lactobacillus gasseri JV-V03]
          Length = 410

 Score =  105 bits (262), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 43/291 (14%), Positives = 88/291 (30%), Gaps = 35/291 (12%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           ISD HL           +    +      +  Y+ +   +  +          + +TGD+
Sbjct: 13  ISDTHLIAD--SLHDDGQAFSQMQKTSQGKDLYYQETALSAFVRMAEEKKPAAIIVTGDV 70

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
                           + +     I ++PGNHD Y      +     K Y     +    
Sbjct: 71  TFNGERVSAERFAEIFKPL-TKTKILVLPGNHDIY--DGWAREFDGKKQYYAGQISPRMW 127

Query: 135 KKLF----------------PYLRIRNNIALIGCSTAIATPPFSA-----NGYFGQEQAH 173
           + +F                  +++  +  LI   +       S+      G+ G+EQ  
Sbjct: 128 RNIFRTSYETAVSVDNSSLAYSVQLNPDYLLILADSNDYGKEESSTAPATAGFLGKEQRK 187

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGHT 231
              + L+ A++     I  MHH       +      +   +  +K++      L+  GH 
Sbjct: 188 WIKEQLQYASQNNLRVIFCMHHNLYAHNPAVNKGYVVDDYRELRKLLAQYNVKLVFSGHI 247

Query: 232 HLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           H      I + +   P   + +A    +       Y +  +  K   +T  
Sbjct: 248 H---AQNIMSPQNSCPATEVVTACFCSND----QGYGVVKVSPKEISYTCH 291


>gi|330985853|gb|EGH83956.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. lachrymans str. M301315]
          Length = 277

 Score =  105 bits (262), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLSALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHNLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGRLDYGQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|293394322|ref|ZP_06638622.1| 3',5'-cyclic-nucleotide phosphodiesterase [Serratia odorifera DSM
           4582]
 gi|291423300|gb|EFE96529.1| 3',5'-cyclic-nucleotide phosphodiesterase [Serratia odorifera DSM
           4582]
          Length = 275

 Score =  105 bits (262), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 38/295 (12%), Positives = 79/295 (26%), Gaps = 47/295 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +     +  I+D HL    +   L                      V + +      +  
Sbjct: 11  SGAKVRILQITDTHLFAGENETLLGINTYRSY------------HAVLDAICAQQREY-- 56

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D +  TGD+               +  +  P     +PGNHD   +              
Sbjct: 57  DLIVATGDLAQDHSLEAYRHFADGIAQL--PAPCVWLPGNHDFQPAMV------------ 102

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D   + G      + + +   +I   + +   P    G   + Q     + L+   ++
Sbjct: 103 --DALAAAGISPSKQVLLGDGWQVILLDSQVFGVPH---GELSEYQLEWLERCLQAYPER 157

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
               ++  H  P   T    + +        ++      + +L GH H +          
Sbjct: 158 ATLLLLHHHPLPSGCTWLDQHSLRNPHMLDVVLQRYPKVNTLLCGHIHQDLDLAWHGR-- 215

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
              V+   S   +   +        F I+  +  W        L PD     + +
Sbjct: 216 --RVLASPSTCVQFKPHCTN-----FTIDDVSPGWRY----LDLLPDGRVETQVF 259


>gi|116053117|ref|YP_793437.1| hypothetical protein PA14_65690 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296391810|ref|ZP_06881285.1| hypothetical protein PaerPAb_26818 [Pseudomonas aeruginosa PAb1]
 gi|115588338|gb|ABJ14353.1| putative phosphohydrolases [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 272

 Score =  105 bits (262), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 82/303 (27%), Gaps = 57/303 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   +      ++  +       D + 
Sbjct: 16  LVQLSDSHLFAEDGARLLG----------------MDTAHSLEKVVERVAREQPRIDLIL 59

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                  +  P       GNHD      +               
Sbjct: 60  ATGDVSQDGSLDSYTRFRRLSAPLAAPLRWFA--GNHDEREPMQR--------------- 102

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             + G  L   +    N  ++   ++I        GY   +Q     + +  A ++  F 
Sbjct: 103 -ATEGSDLLEQVVDVGNWRVVLLDSSIPGAV---PGYLEDDQLDLLRRAIDSAGER--FL 156

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++  HH PV   S   + +     Q    ++        +L GH H         ++  +
Sbjct: 157 LVSFHHHPVPIGSDWMDPIGLRNPQALFDLLAPYPQVRCLLWGHIHQ----EFDRQRGPL 212

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF--- 303
            ++   S   +            F +++    +    + +        I +    +F   
Sbjct: 213 RLLASPSTCVQFAPGSSD-----FTLDRLAPGYR-WLRLHDDGRLETGISRVDDVVFEVD 266

Query: 304 YDT 306
           YDT
Sbjct: 267 YDT 269


>gi|229551705|ref|ZP_04440430.1| metallophosphoesterase [Lactobacillus rhamnosus LMS2-1]
 gi|229314937|gb|EEN80910.1| metallophosphoesterase [Lactobacillus rhamnosus LMS2-1]
          Length = 442

 Score =  105 bits (262), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 92/316 (29%), Gaps = 32/316 (10%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  +SD H        E S    I        +   +     + L+ + L      + I
Sbjct: 38  RIWVLSDTHFIAPSLHDERSAYTQIKRSAA--GKDMDYQPVAIHALVQNALKSRPTALII 95

Query: 71  TGDIVNFTCNREIFTSTHWLRSI-GNPHDISIVPGNHDAYISGAKEKS------------ 117
           TGD+          +  H L+ +  +   + I+PGNHD Y   A+               
Sbjct: 96  TGDVTFNGEKTSAESLMHRLQPLVDHGIKVLIIPGNHDIYDGWARAYKGRQQRLTEQISP 155

Query: 118 --LHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIAT-----PPFSANGYFGQE 170
                             G  L   + + +   L+   + I T      P +  G    +
Sbjct: 156 SDWRQIFHSSYEQAAAQDGNSLSYRVNLNHQYQLLLLDSNIYTIEPSNRPPNTGGKLSPQ 215

Query: 171 QAHATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILH 228
                 + L    +     II MHH       +      +      +K++      L+  
Sbjct: 216 TMTWVRRQLALGARAHRKSIIFMHHNLYTHNEAVNQGYVLDNSDALKKLLTRYHVPLVFS 275

Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           GH H   +      +     +   + S         ASY +     +   +  +     L
Sbjct: 276 GHIHAQDISRDPAGQCPTIEIVSGAFSIS------PASYGVVTFGPQQITYQKQIT--DL 327

Query: 289 SPDSLSIQKDYSDIFY 304
           +P   + Q+   D+ +
Sbjct: 328 TPYLTAKQRKNPDLLH 343


>gi|15828187|ref|NP_302450.1| hypothetical protein ML2210 [Mycobacterium leprae TN]
 gi|221230664|ref|YP_002504080.1| hypothetical protein MLBr_02210 [Mycobacterium leprae Br4923]
 gi|699231|gb|AAA62995.1| icc [Mycobacterium leprae]
 gi|2076636|emb|CAB08432.1| Icc [Mycobacterium leprae]
 gi|13093741|emb|CAC31165.1| conserved hypothetical protein [Mycobacterium leprae]
 gi|219933771|emb|CAR72307.1| conserved hypothetical protein [Mycobacterium leprae Br4923]
          Length = 317

 Score =  105 bits (262), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 45/281 (16%), Positives = 79/281 (28%), Gaps = 53/281 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL--LHNVDH 67
           +VL HISD HL    S                       +      L+  +       D 
Sbjct: 14  YVLLHISDTHLISDGSL-----------------YGAVDADSRLGELLEQLKHSQLRPDA 56

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYI 125
           +  TGD+ +             + S     D  +  V GNHD  +               
Sbjct: 57  IIFTGDLADRGEPEAYRKLRCLVESFATELDAELFWVMGNHDNRV------------ALR 104

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
           T     +        +R  + + +I   T++   P    G     Q    +  L  +   
Sbjct: 105 TLLLDEAPSMAPLDGVRRVDGLRVITLDTSV---PGRHYGEISASQLDWLADELTTSAPD 161

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           G   I+ +HHPP+     +   +         +++       IL GH H ++        
Sbjct: 162 GT--ILALHHPPIPSVLDMAVTVELRDQASLGRVLKGSDIRAILAGHLHYSTNATFVG-- 217

Query: 244 KLIPVVGIASASQK---------VHSNKPQASYNLFYIEKK 275
             IPV   ++                       NL ++ + 
Sbjct: 218 --IPVSVASATCYTQDLTVVAGGARGRDGAQGCNLVHVYQD 256


>gi|87124543|ref|ZP_01080392.1| possible ICC (3',5'-cyclic-nucleotide phosphodiesterase) protein
           [Synechococcus sp. RS9917]
 gi|86168115|gb|EAQ69373.1| possible ICC (3',5'-cyclic-nucleotide phosphodiesterase) protein
           [Synechococcus sp. RS9917]
          Length = 252

 Score =  105 bits (262), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 34/259 (13%), Positives = 74/259 (28%), Gaps = 38/259 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +  +SD HL   P                    ++  +  +    +        D + 
Sbjct: 1   MRILQLSDPHLLADP----------------QGLVRERPALSLWQRALAQARQTRPDLLL 44

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+               L  + +   +++V GNHD                 + +  
Sbjct: 45  VTGDLCQDESWGGYGQLRETLTDLPDETAVALVAGNHDQPT-------------LLRAAL 91

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                      +R +    L+  S+ +A       G  G  Q     + L          
Sbjct: 92  GRQAMVGPAEIVRGQG--RLLLLSSHLAGQCG---GGLGTPQLRWLEQRLNDPRHTSTAT 146

Query: 190 IIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGA-DLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HHPP+           +   +    ++    A   +L GH H +    +      +
Sbjct: 147 LVALHHPPLPIGDPGLDRIGLRDGEALISLLQRAPALKAVLFGHIHQHWQGRLPGRAD-V 205

Query: 247 PVVGIASASQKVHSNKPQA 265
            ++   S  +   + +P  
Sbjct: 206 VLLACPSTLKSFQAVQPCP 224


>gi|94496929|ref|ZP_01303503.1| hypothetical protein SKA58_12772 [Sphingomonas sp. SKA58]
 gi|94423605|gb|EAT08632.1| hypothetical protein SKA58_12772 [Sphingomonas sp. SKA58]
          Length = 296

 Score =  105 bits (262), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 46/277 (16%), Positives = 82/277 (29%), Gaps = 42/277 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AH+SDIH                                + +     +     D V
Sbjct: 1   MARIAHLSDIHFGA-------------------------NDPRIVDAATAWLEERRPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSI-GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            I+GD        +   +  WL  +        ++PGNHD  +     + L   + Y   
Sbjct: 36  VISGDFTQRARVGQFRQAAAWLGKLRAAGLKTLVIPGNHDVPLYDVLRRFLTPLRRYRRY 95

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
            +               + +A+ G +TA +      +G    +Q             +  
Sbjct: 96  ISHDLCP------FYEDDEVAIFGINTARSLT--IKDGRINHDQMDMLRHRFA-HVPRDK 146

Query: 188 FRIIMMHHP----PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK--- 240
            RI++ HHP    P+     L   +       +     G  + L GH H           
Sbjct: 147 TRILVTHHPLFSMPIGKGGELSEAVGRHDDAVQAACEAGVHVALAGHFHRTYAESADKMV 206

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNE 277
                  V+   +A+     N    S+N  ++ + NE
Sbjct: 207 AHSGGALVIQAGTATSTRLRNDEPQSFNWLHVRRNNE 243


>gi|251800020|ref|YP_003014751.1| metallophosphoesterase [Paenibacillus sp. JDR-2]
 gi|247547646|gb|ACT04665.1| metallophosphoesterase [Paenibacillus sp. JDR-2]
          Length = 273

 Score =  105 bits (262), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 38/280 (13%), Positives = 81/280 (28%), Gaps = 42/280 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL--LHNVDH 67
               H++D H++                        K+   +    +   I     +   
Sbjct: 4   LKFVHLTDTHMNAPG---------------VDNPFAKFNLADKVKRVFEHIKTASVSPAF 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGN--PHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           V ITGD+ +    ++       +          + +V GNHD                + 
Sbjct: 49  VVITGDLTHEGNVQDYEYIRTIVDEGSALLGVPVHVVLGNHDHR------------APFR 96

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                    ++ + Y      + LIG ++ +       +G    EQ       L    + 
Sbjct: 97  EGFLKEEPSEQAYYYSHTIQGVRLIGLNSQVKGQ---HHGEIDAEQLAWLEDTLSTPAEN 153

Query: 186 GFFRIIMMHHPPVLDTSSLYNRM-FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
           G   I+ +HHP +       + +     +   ++       ++ GH H N++   K    
Sbjct: 154 GT--IVALHHPMLNINGMPADHVLANRDQLGNVLEGTDVIGVVAGHVHTNNVGTYKG-IC 210

Query: 245 LIPVVGIASASQKVHSNK----PQASYNLFYIEKKNEYWT 280
            +   G A   +    N         YN+  + ++     
Sbjct: 211 HVAATGTAFGGEAAEDNHFKMVDFCGYNIVSVYEEGVTVQ 250


>gi|16127786|ref|NP_422350.1| hypothetical protein CC_3556 [Caulobacter crescentus CB15]
 gi|221236607|ref|YP_002519044.1| phosphohydrolase [Caulobacter crescentus NA1000]
 gi|13425294|gb|AAK25518.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220965780|gb|ACL97136.1| predicted phosphohydrolase, Icc family [Caulobacter crescentus
           NA1000]
          Length = 262

 Score =  105 bits (262), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 56/288 (19%), Positives = 87/288 (30%), Gaps = 36/288 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             L  +SDIH     +    +    I                              D V 
Sbjct: 1   MRLIQLSDIHFGGENAEAVAAAGAWIRAAA-------------------------PDLVV 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           + GD+       E   +  WL ++  P  + + PGNHD    G  E      + +     
Sbjct: 36  VAGDLTLDGRACEFDAAAAWLETL--PRPMIVTPGNHDTPFVGPGELWERFTRPWRRFCD 93

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKGF 187
                            + L   +TA A       + G  GQ+Q       L +A   G 
Sbjct: 94  RFGAEDGA---RWRGPGVTLTTLNTARAAQLRLNWSKGAVGQDQIRRVVGEL-EAAPAGD 149

Query: 188 FRIIMMHHPPVLDTSSLYN-RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            RI++ HHP +         R+ G     K     GAD+IL GH HL  +  +       
Sbjct: 150 LRIVVCHHPLMEILGGPMTARVHGGVGAAKQFVKAGADVILSGHIHLPFVTPLPFGDGRT 209

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLS 294
             +G  + SQ+     P   +N+  I       T     +       +
Sbjct: 210 QAIGSGTLSQRERGAAP--GFNVIEIAPGCVRVTAMAYAHGDFEAWRT 255


>gi|258539100|ref|YP_003173599.1| hypothetical protein LC705_00909 [Lactobacillus rhamnosus Lc 705]
 gi|257150776|emb|CAR89748.1| Putative protein without homology [Lactobacillus rhamnosus Lc 705]
          Length = 442

 Score =  105 bits (262), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 92/316 (29%), Gaps = 32/316 (10%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  +SD H        E S    I        +   +     + L+ + L      + I
Sbjct: 38  RIWVLSDTHFIAPSLHDERSAYTQIKRSAA--GKDMDYQPVAIHALVQNALKSRPTALII 95

Query: 71  TGDIVNFTCNREIFTSTHWLRSI-GNPHDISIVPGNHDAYISGAKEKS------------ 117
           TGD+          +  H L+ +  +   + I+PGNHD Y   A+               
Sbjct: 96  TGDVTFNGEKTSAESLMHRLQPLVDHGIKVLIIPGNHDIYDGWARAYKGRQQRLTEQISP 155

Query: 118 --LHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIAT-----PPFSANGYFGQE 170
                             G  L   + + +   L+   + I T      P +  G    +
Sbjct: 156 SDWRQIFHSSYEQAAAQDGNSLSYRVNLNHQYQLLLLDSNIYTIEPSNRPPNTGGKLSPQ 215

Query: 171 QAHATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILH 228
                 + L    +     II MHH       +      +      +K++      L+  
Sbjct: 216 TMTWVRRQLALGARAHRKSIIFMHHNLYTHNEAVNQGYVLDNSDALKKLLTRYHVPLVFS 275

Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           GH H   +      +     +   + S         ASY +     +   +  +     L
Sbjct: 276 GHIHAQDISRDPAGQCPTIEIVSGAFSIS------PASYGVVTFGPQQITYQKQIT--DL 327

Query: 289 SPDSLSIQKDYSDIFY 304
           +P   + Q+   D+ +
Sbjct: 328 TPYLTAKQRKNPDLLH 343


>gi|218248561|ref|YP_002373932.1| metallophosphoesterase [Cyanothece sp. PCC 8801]
 gi|218169039|gb|ACK67776.1| metallophosphoesterase [Cyanothece sp. PCC 8801]
          Length = 366

 Score =  105 bits (262), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 46/287 (16%), Positives = 92/287 (32%), Gaps = 29/287 (10%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  A ISD H+   P   +L   R               S      + + +   ++D + 
Sbjct: 3   FRFAIISDPHV-AVPQTIDLHSTRFS---------VVEISLLALEQVFSHLEQLDIDFLL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSL-HAWKDYITSD 128
           + GD+               L ++  P  + +VPGNHD       +++L           
Sbjct: 53  LPGDLTQDGELDNHRWLQQRLAAL--PFPVYVVPGNHDIPSLQPNQQTLGFHQFPDYYYH 110

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
            +     +L+    +   + LIG ++          G   + Q     +LL +   +  F
Sbjct: 111 QSYRNLNQLYYTCEVLPGVQLIGLNSTQFNQQGKQIGCLDENQLAWLEQLLPQLKDQFIF 170

Query: 189 RIIMMH---HPP--VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
            ++  +   H P            +        ++   G  LI  GH H+  + +     
Sbjct: 171 VMVHHNVIEHLPGQANHELGKRYMLDNANLLLNLLKESGCQLIFTGHLHVQDIAY----S 226

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIE-KKNEYWTLEGKRYTLS 289
             I  +   S     H       Y +  +E K+++   L    + ++
Sbjct: 227 NNIYEITTGSLVSYPHP------YRIIEVEHKQHKNIRLNVTSHRVN 267


>gi|153949136|ref|YP_001399569.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pseudotuberculosis IP 31758]
 gi|152960631|gb|ABS48092.1| Ser/Thr protein phosphatase family protein [Yersinia
           pseudotuberculosis IP 31758]
          Length = 275

 Score =  105 bits (262), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 37/294 (12%), Positives = 75/294 (25%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D V  
Sbjct: 16  RILQITDTHLFAGEHETLLGVNTFHSY------------RAVLDAIIAE--QHPFDLVVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                   
Sbjct: 62  TGDLAQDHSVAAYQNFAKGISRL--PVPCVWLPGNHDFQPAMV--------------GAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      +    +  ++   + +   P+   G     Q     + L    ++    +
Sbjct: 106 AEAGIAPSKQVLAGEHWQILLLDSQVFGVPY---GELSDYQLEWMERCLIAYPERYTLIL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 163 LHHHPMPSGCTWLDQHSLRNAHMLAAILTRYPRVTTLLCGHIHQDLDLDWYGK----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               + +  SD F
Sbjct: 219 ASPSTCVQFKPHCTN-----FTLDAVAPGWRY-LDLLPDGGLETEVHRLDSDEF 266


>gi|71734668|ref|YP_276826.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|71555221|gb|AAZ34432.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. phaseolicola 1448A]
          Length = 277

 Score =  105 bits (261), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHNLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGRLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|145597758|ref|YP_001161834.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pestis Pestoides F]
 gi|162421040|ref|YP_001604898.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pestis Angola]
 gi|145209454|gb|ABP38861.1| Icc-like protein [Yersinia pestis Pestoides F]
 gi|162353855|gb|ABX87803.1| Ser/Thr protein phosphatase family protein [Yersinia pestis Angola]
          Length = 299

 Score =  105 bits (261), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 38/294 (12%), Positives = 76/294 (25%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D V  
Sbjct: 40  RILQITDTHLFAGEHETLLGVNTFHSY------------RAVLDAIIAE--QHPFDLVVA 85

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 86  TGDLAQDHSVAAYQNFAKGISRL--PVPCVWLPGNHDFQPAM--------------FDAL 129

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      +    +  ++   + +   P+   G     Q     + L    ++    +
Sbjct: 130 AEAGIAPSKQVLAGEHWQILLLDSQVFGVPY---GELSDYQLEWMERCLIAYPERYTLIL 186

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 187 LHHHPMPSGCTWLDQHSLRNAHMLAAILTRYPRVTTLLCGHIHQDLDLDWYGK----RLL 242

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               + +  SD F
Sbjct: 243 ASPSTCVQFKPHCTN-----FTLDAVAPGWRY-LDLLPDGGLETEVHRLDSDEF 290


>gi|261208899|ref|ZP_05923336.1| predicted protein [Enterococcus faecium TC 6]
 gi|289567253|ref|ZP_06447636.1| predicted protein [Enterococcus faecium D344SRF]
 gi|294614543|ref|ZP_06694451.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           E1636]
 gi|314939842|ref|ZP_07847054.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           TX0133a04]
 gi|314942439|ref|ZP_07849281.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           TX0133C]
 gi|314953099|ref|ZP_07856057.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           TX0133A]
 gi|314993608|ref|ZP_07858961.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           TX0133B]
 gi|314997576|ref|ZP_07862510.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           TX0133a01]
 gi|260077401|gb|EEW65121.1| predicted protein [Enterococcus faecium TC 6]
 gi|289160951|gb|EFD08868.1| predicted protein [Enterococcus faecium D344SRF]
 gi|291592594|gb|EFF24195.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           E1636]
 gi|313588379|gb|EFR67224.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           TX0133a01]
 gi|313591924|gb|EFR70769.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           TX0133B]
 gi|313594832|gb|EFR73677.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           TX0133A]
 gi|313598795|gb|EFR77640.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           TX0133C]
 gi|313640896|gb|EFS05476.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           TX0133a04]
          Length = 267

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 51/272 (18%), Positives = 89/272 (32%), Gaps = 38/272 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV-DHVSI 70
           + HISDIH        E   K ++  +                  I+ +L     D V I
Sbjct: 3   ILHISDIHFRREYEACEEGYKGMLATMQ--------NPLIPLEQCIHHLLQQTPLDLVII 54

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+       +      WL +      I +  GNHD              + +      
Sbjct: 55  SGDLTEDGEIDDYRYLKTWLENALGETTILVTLGNHDI------------KEHFWVGWCD 102

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            +     +  +       +I    +       A+G    +Q     K L +   +    I
Sbjct: 103 EAASSAPYNQIVKYPEFTVISFDNSSYG---YADGIVDDQQFQWLKKALEQEKDQP---I 156

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVG 250
            ++ H  +L   S   +  G +RF K+I       IL+GHTH      I      IP   
Sbjct: 157 FLVTHHHLLSHQSSIPKWPGTERFLKLIAPYDIRCILNGHTHHTFTDEING----IPYFT 212

Query: 251 IASASQ-------KVHSNKPQASYNLFYIEKK 275
           ++S S             + +  YNL+++++ 
Sbjct: 213 VSSMSFVGEDEGDGFVRFEERHGYNLYHLDQG 244


>gi|148359515|ref|YP_001250722.1| 3',5'-cyclic nucleotide phosphodiesterase [Legionella pneumophila
           str. Corby]
 gi|148281288|gb|ABQ55376.1| 3',5'-cyclic nucleotide phosphodiesterase [Legionella pneumophila
           str. Corby]
          Length = 270

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 78/279 (27%), Gaps = 40/279 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISD+H                                V N  + +  L   D + 
Sbjct: 1   MKIIHISDLHFGK-------------------------HQPAVLNAFLQETALDKPDIIL 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+     + +      ++  +  P     VPGNHD        + +  ++ Y     
Sbjct: 36  ISGDLTQRGLSYQYRELCSFINQL--PAQTLTVPGNHDIPFYNVPARFIFPFRHYKRYIN 93

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
              T           + + ++G ++         +G   +E  +   +            
Sbjct: 94  PDVT------TTFENDCVRILGVNSVNPLQ--LKDGELSRETLNRIKRYF---KPDDEKL 142

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            ++  H        L+  +   Q     +      L+  GH H   L  I        + 
Sbjct: 143 NLLFFHHNFDYMEGLHKPLANAQTLLSFLKQSTIHLVCTGHLHYAHLSLIAKNNGYSCLA 202

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKN--EYWTLEGKRY 286
             A +     S     SY +    +K     W +  + +
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIEANQKKCRITWRVFDQEH 241


>gi|307129108|ref|YP_003881124.1| Icc protein [Dickeya dadantii 3937]
 gi|306526637|gb|ADM96567.1| Icc protein [Dickeya dadantii 3937]
          Length = 275

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 37/296 (12%), Positives = 80/296 (27%), Gaps = 51/296 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +       + D ++ 
Sbjct: 16  RILQITDTHLFAGERETLLGVDTYRSY------------QAVLDAI--AAQQCDFDLITA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +R    P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHTQEAYTRFADGIRRFNAPC--VWLPGNHDFQPAMV--------------DVL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             +G     ++ +  +  +I   + +   P    G   + Q     + L+   ++  + +
Sbjct: 106 ARSGIAPSKHVLLGEHWQVILLDSQVFGVPH---GELSEYQLEWLERSLQSQPER--YTL 160

Query: 191 IMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           +M+HH P+    +  ++           ++        +L GH H               
Sbjct: 161 LMLHHHPLPSGCTWLDQHSLRNAHSLDALLARFPRVRTVLCGHIHQEMDLDWNGR----R 216

Query: 248 VVGIASASQKVHSN-------KPQASYNLFYIEKKN--EYWTLEGKRYTLSPDSLS 294
           ++   S   +   +            +    +      E      +     PD  S
Sbjct: 217 LLATPSTCVQFKPHCTSFTIDNVAPGWRYLELLPDGVLETQVCRLEGNEFLPDMDS 272


>gi|317049093|ref|YP_004116741.1| metallophosphoesterase [Pantoea sp. At-9b]
 gi|316950710|gb|ADU70185.1| metallophosphoesterase [Pantoea sp. At-9b]
          Length = 276

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 44/242 (18%), Positives = 84/242 (34%), Gaps = 38/242 (15%)

Query: 5   YTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH- 63
            +  M ++A ISD+H+                        KK  ++     +I  +    
Sbjct: 1   MSEAMTLIAQISDLHIKAQGRLS----------------YKKVDTQAALLRVIETLNRLQ 44

Query: 64  -NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWK 122
              D V ITGD+V+F    E  T    L  +  P+   ++PGNHD   +           
Sbjct: 45  PRPDVVVITGDLVDFGLAEEYQTLRQALAELQLPY--LLMPGNHDDRQALRDA------- 95

Query: 123 DYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182
                +       +   + +    + L+   +++   P+   GY  + Q     + L++A
Sbjct: 96  ---FPEHRYLQQGETLHWQQHVKGVNLLALDSSVPQQPW---GYVDEAQLQWLDEKLKQA 149

Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWI 239
                  ++M+HHPP +      +R      +    +I      + +L GH H +     
Sbjct: 150 P--HTPALVMLHHPPFMTGIGHMDRQPLRNPEALAAVISQYPQVERVLSGHLHRSIQARF 207

Query: 240 KN 241
             
Sbjct: 208 AG 209


>gi|293391372|ref|ZP_06635706.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290951906|gb|EFE02025.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 274

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 42/298 (14%), Positives = 87/298 (29%), Gaps = 48/298 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           +F +  I+D HL                  +         ++E  + ++++I     + D
Sbjct: 13  VFRVIQITDPHL----------------FKDATGELLGVNTQESFSQVLSEIRQQLYDYD 56

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V  TGD+V  +           ++ +     +  +PGNHD               D   
Sbjct: 57  LVLATGDLVQDSSEEGYLRFCESVKPLKKT--VFWIPGNHDFQPKMFDILKRDNICDKKH 114

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                         + +  N  ++   + IA  P    G  GQ Q       L++  ++ 
Sbjct: 115 --------------ILLGENWQILLLDSQIAGVPH---GQLGQYQLDWLMAKLKEHPQRY 157

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKL 245
              ++  H           + +         +        IL+GH H      +  E   
Sbjct: 158 SLVVLHHHILSTHSAWLDQHNLRNAHELAYTLAPFNNVKGILYGHIHQ----QVDGEWNG 213

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             ++   S   +   +      N F ++     W  E + Y        +++     F
Sbjct: 214 YKIMATPSTGIQFKPDS-----NTFALDTAQPGWR-EIELYADGRIETRVKRIQHKTF 265


>gi|300309937|ref|YP_003774029.1| cAMP phosphodiesterase [Herbaspirillum seropedicae SmR1]
 gi|300072722|gb|ADJ62121.1| cAMP phosphodiesterase protein [Herbaspirillum seropedicae SmR1]
          Length = 273

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 43/249 (17%), Positives = 79/249 (31%), Gaps = 41/249 (16%)

Query: 14  HISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL--LHNVDHVSIT 71
            ISD+H+                      + +   + E     +  +       D + IT
Sbjct: 5   QISDLHIKTDGK----------------KSYRVVDTAESLRRCVAQVNGLKQRPDALVIT 48

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+V+F    E       L  +  P+   ++PGNHD           +A +         
Sbjct: 49  GDLVDFGKPSEYACLRELLAPLAMPY--YLLPGNHDER---------NALRAAFPDHAYL 97

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
             G +   Y+   + + +I   T I   P  + G    +      ++L +  ++    +I
Sbjct: 98  QQGGERIEYVIEDHPVRIIALDTVI---PRQSGGALSPQSLQWLDEVLAQQAQRPT--VI 152

Query: 192 MMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPV 248
            MHHPP        + M     Q  + ++      + IL GH H +              
Sbjct: 153 AMHHPPFTTGIGHMDDMGLADPQALEAVVRKHPQVERILCGHLHRSIQRRF----GGTLA 208

Query: 249 VGIASASQK 257
                 S +
Sbjct: 209 TTCPGVSHQ 217


>gi|312198502|ref|YP_004018563.1| metallophosphoesterase [Frankia sp. EuI1c]
 gi|311229838|gb|ADP82693.1| metallophosphoesterase [Frankia sp. EuI1c]
          Length = 301

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 43/301 (14%), Positives = 85/301 (28%), Gaps = 48/301 (15%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD--HV 68
            +  +SD H+      +                     +        + I    +D   +
Sbjct: 13  TVIQLSDTHIVPEGELYH----------------GTLDTLANVAAAFDQIEQSGIDVAAL 56

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIG--NPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            ++GD+ +            ++          +  + GNHD+               +  
Sbjct: 57  VLSGDLADAGDLASYRRLRAYVEQRAGALGLPVLYMMGNHDSR------------GPFRE 104

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    + + Y+    ++ +I   +   T P    G    EQ    +  L      G
Sbjct: 105 GLLGAEPTTEPYDYVFWSGDLRIIALDS---TEPGEVLGVLSDEQLAWLAAELATPAPAG 161

Query: 187 FFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
              I+ +HHPPV     + N M     +R  ++I      ++L GH H  S+  +     
Sbjct: 162 T--ILALHHPPVPSPIGMLNTMVLEAPERLGQVIAGTDVRIVLAGHAHHGSVGIL----G 215

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
            +PV    + +    +  P   Y                  Y     +  I     D  Y
Sbjct: 216 GVPVWVAGATAYAARALGPAGGYAGVT-----GGVFTRIDVYAGQAVATVIPTTVGDSIY 270

Query: 305 D 305
           +
Sbjct: 271 E 271


>gi|15607945|ref|NP_215320.1| hypothetical protein Rv0805 [Mycobacterium tuberculosis H37Rv]
 gi|15840216|ref|NP_335253.1| hypothetical protein MT0825 [Mycobacterium tuberculosis CDC1551]
 gi|31791993|ref|NP_854486.1| hypothetical protein Mb0828 [Mycobacterium bovis AF2122/97]
 gi|121636729|ref|YP_976952.1| hypothetical protein BCG_0857 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148660583|ref|YP_001282106.1| hypothetical protein MRA_0815 [Mycobacterium tuberculosis H37Ra]
 gi|148822011|ref|YP_001286765.1| hypothetical protein TBFG_10820 [Mycobacterium tuberculosis F11]
 gi|167967715|ref|ZP_02549992.1| hypothetical protein MtubH3_06633 [Mycobacterium tuberculosis
           H37Ra]
 gi|215402595|ref|ZP_03414776.1| hypothetical protein Mtub0_02653 [Mycobacterium tuberculosis
           02_1987]
 gi|215410374|ref|ZP_03419182.1| hypothetical protein Mtub9_03395 [Mycobacterium tuberculosis
           94_M4241A]
 gi|215426064|ref|ZP_03423983.1| hypothetical protein MtubT9_06613 [Mycobacterium tuberculosis T92]
 gi|215444941|ref|ZP_03431693.1| hypothetical protein MtubT_03027 [Mycobacterium tuberculosis T85]
 gi|218752467|ref|ZP_03531263.1| hypothetical protein MtubG1_03030 [Mycobacterium tuberculosis GM
           1503]
 gi|219556663|ref|ZP_03535739.1| hypothetical protein MtubT1_04885 [Mycobacterium tuberculosis T17]
 gi|224989200|ref|YP_002643887.1| hypothetical protein JTY_0827 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253797752|ref|YP_003030753.1| hypothetical protein TBMG_00819 [Mycobacterium tuberculosis KZN
           1435]
 gi|254231118|ref|ZP_04924445.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|254363744|ref|ZP_04979790.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254549776|ref|ZP_05140223.1| hypothetical protein Mtube_04821 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260185697|ref|ZP_05763171.1| hypothetical protein MtubCP_06655 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260199819|ref|ZP_05767310.1| hypothetical protein MtubT4_06725 [Mycobacterium tuberculosis T46]
 gi|260203994|ref|ZP_05771485.1| hypothetical protein MtubK8_06760 [Mycobacterium tuberculosis K85]
 gi|289442208|ref|ZP_06431952.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289446369|ref|ZP_06436113.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289553062|ref|ZP_06442272.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289568758|ref|ZP_06448985.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289573423|ref|ZP_06453650.1| conserved hypothetical protein [Mycobacterium tuberculosis K85]
 gi|289744529|ref|ZP_06503907.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289749320|ref|ZP_06508698.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289756892|ref|ZP_06516270.1| icc protein [Mycobacterium tuberculosis T85]
 gi|289760934|ref|ZP_06520312.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|294996285|ref|ZP_06801976.1| hypothetical protein Mtub2_17711 [Mycobacterium tuberculosis 210]
 gi|297633316|ref|ZP_06951096.1| hypothetical protein MtubK4_04296 [Mycobacterium tuberculosis KZN
           4207]
 gi|297730300|ref|ZP_06959418.1| hypothetical protein MtubKR_04371 [Mycobacterium tuberculosis KZN
           R506]
 gi|298524295|ref|ZP_07011704.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|306774926|ref|ZP_07413263.1| hypothetical protein TMAG_03956 [Mycobacterium tuberculosis
           SUMu001]
 gi|306781342|ref|ZP_07419679.1| hypothetical protein TMBG_03278 [Mycobacterium tuberculosis
           SUMu002]
 gi|306783467|ref|ZP_07421789.1| hypothetical protein TMCG_04005 [Mycobacterium tuberculosis
           SUMu003]
 gi|306790339|ref|ZP_07428661.1| hypothetical protein TMDG_03372 [Mycobacterium tuberculosis
           SUMu004]
 gi|306794833|ref|ZP_07433135.1| hypothetical protein TMEG_02404 [Mycobacterium tuberculosis
           SUMu005]
 gi|306796572|ref|ZP_07434874.1| hypothetical protein TMFG_03968 [Mycobacterium tuberculosis
           SUMu006]
 gi|306802431|ref|ZP_07439099.1| hypothetical protein TMHG_03837 [Mycobacterium tuberculosis
           SUMu008]
 gi|306806639|ref|ZP_07443307.1| hypothetical protein TMGG_04008 [Mycobacterium tuberculosis
           SUMu007]
 gi|306966837|ref|ZP_07479498.1| hypothetical protein TMIG_04004 [Mycobacterium tuberculosis
           SUMu009]
 gi|306971030|ref|ZP_07483691.1| hypothetical protein TMJG_04024 [Mycobacterium tuberculosis
           SUMu010]
 gi|307078761|ref|ZP_07487931.1| hypothetical protein TMKG_03513 [Mycobacterium tuberculosis
           SUMu011]
 gi|307083322|ref|ZP_07492435.1| hypothetical protein TMLG_04045 [Mycobacterium tuberculosis
           SUMu012]
 gi|313657625|ref|ZP_07814505.1| hypothetical protein MtubKV_04351 [Mycobacterium tuberculosis KZN
           V2475]
 gi|2117277|emb|CAB09106.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv]
 gi|13880372|gb|AAK45067.1| icc protein [Mycobacterium tuberculosis CDC1551]
 gi|31617580|emb|CAD93690.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97]
 gi|121492376|emb|CAL70843.1| Conserved hypothetical protein [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|124600177|gb|EAY59187.1| conserved hypothetical protein [Mycobacterium tuberculosis C]
 gi|134149258|gb|EBA41303.1| conserved hypothetical protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148504735|gb|ABQ72544.1| conserved hypothetical protein [Mycobacterium tuberculosis H37Ra]
 gi|148720538|gb|ABR05163.1| conserved hypothetical protein [Mycobacterium tuberculosis F11]
 gi|224772313|dbj|BAH25119.1| hypothetical protein JTY_0827 [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|253319255|gb|ACT23858.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           1435]
 gi|289415127|gb|EFD12367.1| conserved hypothetical protein [Mycobacterium tuberculosis T46]
 gi|289419327|gb|EFD16528.1| conserved hypothetical protein [Mycobacterium tuberculosis CPHL_A]
 gi|289437694|gb|EFD20187.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605]
 gi|289537854|gb|EFD42432.1| conserved hypothetical protein [Mycobacterium tuberculosis K85]
 gi|289542512|gb|EFD46160.1| conserved hypothetical protein [Mycobacterium tuberculosis T17]
 gi|289685057|gb|EFD52545.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987]
 gi|289689907|gb|EFD57336.1| conserved hypothetical protein [Mycobacterium tuberculosis T92]
 gi|289708440|gb|EFD72456.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|289712456|gb|EFD76468.1| icc protein [Mycobacterium tuberculosis T85]
 gi|298494089|gb|EFI29383.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|308216519|gb|EFO75918.1| hypothetical protein TMAG_03956 [Mycobacterium tuberculosis
           SUMu001]
 gi|308325870|gb|EFP14721.1| hypothetical protein TMBG_03278 [Mycobacterium tuberculosis
           SUMu002]
 gi|308331730|gb|EFP20581.1| hypothetical protein TMCG_04005 [Mycobacterium tuberculosis
           SUMu003]
 gi|308333232|gb|EFP22083.1| hypothetical protein TMDG_03372 [Mycobacterium tuberculosis
           SUMu004]
 gi|308336886|gb|EFP25737.1| hypothetical protein TMEG_02404 [Mycobacterium tuberculosis
           SUMu005]
 gi|308343000|gb|EFP31851.1| hypothetical protein TMFG_03968 [Mycobacterium tuberculosis
           SUMu006]
 gi|308346886|gb|EFP35737.1| hypothetical protein TMGG_04008 [Mycobacterium tuberculosis
           SUMu007]
 gi|308350827|gb|EFP39678.1| hypothetical protein TMHG_03837 [Mycobacterium tuberculosis
           SUMu008]
 gi|308355462|gb|EFP44313.1| hypothetical protein TMIG_04004 [Mycobacterium tuberculosis
           SUMu009]
 gi|308359416|gb|EFP48267.1| hypothetical protein TMJG_04024 [Mycobacterium tuberculosis
           SUMu010]
 gi|308363320|gb|EFP52171.1| hypothetical protein TMKG_03513 [Mycobacterium tuberculosis
           SUMu011]
 gi|308366978|gb|EFP55829.1| hypothetical protein TMLG_04045 [Mycobacterium tuberculosis
           SUMu012]
 gi|323720765|gb|EGB29836.1| hypothetical protein TMMG_03861 [Mycobacterium tuberculosis
           CDC1551A]
 gi|326904975|gb|EGE51908.1| hypothetical protein TBPG_02899 [Mycobacterium tuberculosis W-148]
 gi|328457531|gb|AEB02954.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN
           4207]
          Length = 318

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 40/281 (14%), Positives = 77/281 (27%), Gaps = 52/281 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           +VL HISD HL                +           + +    L+  +       D 
Sbjct: 14  YVLLHISDTHL----------------IGGDRRLYGAVDADDRLGELLEQLNQSGLRPDA 57

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYI 125
           +  TGD+ +             +          +  V GNHD               +  
Sbjct: 58  IVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDR------------AELR 105

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 +        + + + + +I   T++   P   +G     Q    ++ L      
Sbjct: 106 KFLLDEAPSMAPLDRVCMIDGLRIIVLDTSV---PGHHHGEIRASQLGWLAEELATPAPD 162

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           G   I+ +HHPP+     +   +         +++       IL GH H ++        
Sbjct: 163 GT--ILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVG-- 218

Query: 244 KLIPVVGIASASQK---------VHSNKPQASYNLFYIEKK 275
             IPV   ++                       NL ++   
Sbjct: 219 --IPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPD 257


>gi|85709833|ref|ZP_01040898.1| hypothetical protein NAP1_13148 [Erythrobacter sp. NAP1]
 gi|85688543|gb|EAQ28547.1| hypothetical protein NAP1_13148 [Erythrobacter sp. NAP1]
          Length = 248

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 49/282 (17%), Positives = 93/282 (32%), Gaps = 38/282 (13%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             L H+SD+H                             ++E    +   I     D + 
Sbjct: 3   TRLFHVSDVHFG-------------------------VENREALEHVAKAIRDERPDALV 37

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+     + E   +  W   +G P  + + PGNHD       E+    ++ +   D+
Sbjct: 38  CTGDVTQRAKHSEYAAAAEWFAGLGVP--VVLEPGNHDMPYYNLLERFSDPYRRFRRLDS 95

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKGF 187
              +           +++ L+   + +   P    ++G   +     T   LRK +    
Sbjct: 96  EVGSR-------FENDDVVLVSLKSTVRAQPRFPWSDGIVTKRSLERTLAELRKLSGDPR 148

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
             I+  HHP +       N   G  R    +   GAD I+ GH H       +     + 
Sbjct: 149 HVIVTAHHPLLGPKEDAGNPTIGGDRAFAALASAGADAIMTGHVHRPFDETREMAGASMR 208

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLS 289
           ++G  + S     +    SY +    ++ E   +E +    +
Sbjct: 209 MIGAGTLS-TRLRHGAPPSYRVLNC-RRGEEMQVELRELAAT 248


>gi|330891283|gb|EGH23944.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. mori str. 301020]
          Length = 277

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHNLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGRLDYGQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|323356800|ref|YP_004223196.1| phosphohydrolase [Microbacterium testaceum StLB037]
 gi|323273171|dbj|BAJ73316.1| predicted phosphohydrolase [Microbacterium testaceum StLB037]
          Length = 299

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 42/285 (14%), Positives = 80/285 (28%), Gaps = 52/285 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVS 69
           + H+SD HL        L   R++G         +Y +       ++         D + 
Sbjct: 16  ILHLSDTHL--------LGGDRLLGE--------RYDTAANLRRTLDAAESTGIRPDAIV 59

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNP--HDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +          +  V GNHD                    
Sbjct: 60  FTGDLTDLGEPEAYRALREAVEPWAERLGAPVVWVAGNHDERP------------ALHAE 107

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                   +    +   + + +I   +   T P   +G     Q       L      G 
Sbjct: 108 LLDVEASLEPVTGVWDLDGLRIIALDS---TVPGWHHGDLDAAQLQWLRDELATPAPLGT 164

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ +HHPP+      ++ +           I       IL GH H ++          
Sbjct: 165 --ILALHHPPLPTHIPFFDILELRDQPGLAAAIAGSDVRAILAGHLHYSTSGTFAG---- 218

Query: 246 IPVVGIASASQKVHSNKPQ---------ASYNLFYIEKKNEYWTL 281
           +PV   A++   +   +P           S++L ++        +
Sbjct: 219 VPVSVAAASCYTMDLARPADEVNGMDAGQSFHLVHVWDDTITHAV 263


>gi|191637787|ref|YP_001986953.1| Putative 3 ,5-cyclic-nucleotide phosphodiesterase [Lactobacillus
           casei BL23]
 gi|190712089|emb|CAQ66095.1| Putative 3 ,5-cyclic-nucleotide phosphodiesterase [Lactobacillus
           casei BL23]
 gi|327381853|gb|AEA53329.1| Alkaline phosphatase [Lactobacillus casei LC2W]
 gi|327385015|gb|AEA56489.1| Alkaline phosphatase [Lactobacillus casei BD-II]
          Length = 442

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 47/314 (14%), Positives = 89/314 (28%), Gaps = 36/314 (11%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           +SD H        E +    I        +   +     N L+ + L      + ITGD+
Sbjct: 42  LSDTHFIAPSLHDEKTAYTQIKRSAA--GKDMDYQPVAINALVQNALKARPTALVITGDV 99

Query: 75  VNFTCNREIF-TSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCST 133
                              + N   + I+PGNHD Y      ++    +  +T   + S 
Sbjct: 100 TFNGEKASAESIMRRLQPLVANGTKVLIIPGNHDIY--DGWARAYKGKRQLLTEQISPSD 157

Query: 134 GKKLFPYLRI----------------RNNIALIGCSTAIAT-----PPFSANGYFGQEQA 172
            + +F                       N  L+   + I T      P +  G    +  
Sbjct: 158 WRNIFHTSYEQAVAQDPNSLSYRVNLNRNYQLLMLDSNIYTIEPSNRPPNTGGKLTPQTM 217

Query: 173 HATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGH 230
               + L    K     I+ MHH       +      +    + + ++      L+  GH
Sbjct: 218 KWVRQQLAAGQKAHRKSIVFMHHNLYAHNEAVNQGFVLDNSDQLKTLLKAYHVPLLFSGH 277

Query: 231 THLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSP 290
            H   +    + +     V   + S         ASY +         +         +P
Sbjct: 278 IHAQDISRDPDGQCPTIEVVSGAFSIS------PASYGVVTFTPNRITYQKHAT--DPTP 329

Query: 291 DSLSIQKDYSDIFY 304
              + Q+   D+ +
Sbjct: 330 YLTAKQRKNPDLLH 343


>gi|161525248|ref|YP_001580260.1| metallophosphoesterase [Burkholderia multivorans ATCC 17616]
 gi|189350014|ref|YP_001945642.1| Icc protein [Burkholderia multivorans ATCC 17616]
 gi|160342677|gb|ABX15763.1| metallophosphoesterase [Burkholderia multivorans ATCC 17616]
 gi|189334036|dbj|BAG43106.1| Icc protein [Burkholderia multivorans ATCC 17616]
          Length = 274

 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 39/292 (13%), Positives = 90/292 (30%), Gaps = 50/292 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       +  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCVAKLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +            +D 
Sbjct: 47  VTGDLTDFGHDDEYRHLRDLLAPLEIPY--YLMVGNHDDRAALRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + ++   + +   P ++ G     +    +  L  A  +    
Sbjct: 95  DELQHGEFVQYALDIGAVRVLALDSQV---PRTSGGDLCDARLGWLAAQLDAARDRPT-- 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +   +  + +        +   ++      + +L GH H            
Sbjct: 150 IVALHHPPFVSGIAHMDALRLAPSAAAKLDALLRGYPNVERVLCGHVHRTMFTRF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
                 + + + +V  +      + F +E            +  +PD+  + 
Sbjct: 206 GTLASAVPAPAHQVAFDLRADGPSAFRLEPPAFAV------HRYAPDTGMVS 251


>gi|170703829|ref|ZP_02894527.1| metallophosphoesterase [Burkholderia ambifaria IOP40-10]
 gi|170131260|gb|EDS99889.1| metallophosphoesterase [Burkholderia ambifaria IOP40-10]
          Length = 274

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/278 (13%), Positives = 82/278 (29%), Gaps = 44/278 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       +  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCVAKLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD      +            +D 
Sbjct: 47  VTGDLTDFGHDDEYRHLRDLLAPLEIPY--YLMVGNHDDRAGLRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + ++   + +   P +++G     +    +  L  A  +    
Sbjct: 95  PELQDGEFVQYALDVGAVRVLALDSQV---PGASHGDLCDARLAWLATQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH-----EGADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +      + +         +          + +L GH H            
Sbjct: 150 IVALHHPPFVSGIGHMDALRLAPDAAAKLDALLRGYPNVERVLCGHVHRTMFTRF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
                 + + + +V  +      + F +E       + 
Sbjct: 206 GTLASAVPAPAHQVAFDLRADGPSAFRLEPPAFAVHVH 243


>gi|157372498|ref|YP_001480487.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Serratia
           proteamaculans 568]
 gi|157324262|gb|ABV43359.1| Calcineurin phosphoesterase domain protein [Serratia proteamaculans
           568]
          Length = 275

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/290 (12%), Positives = 80/290 (27%), Gaps = 47/290 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL    +   L                      V + ++      + D V  
Sbjct: 16  RILQITDTHLFAGENETLLGINTYRSY------------HAVLDAILAQ--QRDFDLVVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHSLAAYRHFAEGIARL--PAPCVWLPGNHDFQPAMV--------------DAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      + + ++  ++   + +   P+   G     Q     + L+   ++    +
Sbjct: 106 ADAGIAPSKQVLVGDHWQVLLLDSQVFGVPY---GELSDYQLEWMERCLQAYPERYTLML 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++      + +L GH H       +       ++
Sbjct: 163 LHHHPLPSGCTWLDQHSLRNPHMLGAVLLRYPKVNTLLCGHIHQELDLEWQGR----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
              S   +   +        F I++ +  W        L PD     + +
Sbjct: 219 ASPSTCVQFKPHCTN-----FTIDEVSPGWRY----IDLLPDGRVETQVF 259


>gi|307294590|ref|ZP_07574432.1| metallophosphoesterase [Sphingobium chlorophenolicum L-1]
 gi|306879064|gb|EFN10282.1| metallophosphoesterase [Sphingobium chlorophenolicum L-1]
          Length = 308

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 49/297 (16%), Positives = 95/297 (31%), Gaps = 47/297 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AH+SD+H                               ++A      +     D V
Sbjct: 1   MARIAHLSDMHFGA-------------------------HDPKIAAAAEAWLQQRQPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSI-GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            I+GD        +   ++ W+  +      + +VPGNHD  +     +     + Y  +
Sbjct: 36  VISGDFTQRARRDQFRQASAWVNRLRAAGMKLLVVPGNHDVPLYDLARRFGAPLRRYKRA 95

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
            +               + +A++G +TA +       G    +Q         +    G 
Sbjct: 96  ISNDLCP------FFENDEVAILGLNTARSLT--IKGGRLNHDQMRMLRDRFARVAP-GK 146

Query: 188 FRIIMMHHP----PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIK--- 240
            RI++ HHP    P+     L   +   +   +     G  + L GH H       +   
Sbjct: 147 TRILVTHHPLFAMPIGKGGELSEAVGRHEDAVRAAASAGIHVALAGHFHRTYAEAAEKMV 206

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
                  V+   +A+     N    S+N  ++ + +E   +E +      D  S Q+
Sbjct: 207 AHAGGALVIQAGTATSTRLRNAEPQSFNWLHVHRHDE---IELQVVVW--DGASFQR 258


>gi|221201453|ref|ZP_03574492.1| metallophosphoesterase [Burkholderia multivorans CGD2M]
 gi|221207992|ref|ZP_03580998.1| metallophosphoesterase [Burkholderia multivorans CGD2]
 gi|221172177|gb|EEE04618.1| metallophosphoesterase [Burkholderia multivorans CGD2]
 gi|221178721|gb|EEE11129.1| metallophosphoesterase [Burkholderia multivorans CGD2M]
          Length = 274

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/292 (13%), Positives = 90/292 (30%), Gaps = 50/292 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       +  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCVEKLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       +  +  P+   ++ GNHD   +  +            +D 
Sbjct: 47  VTGDLTDFGHDDEYRHLRDLVAPLEIPY--YLMVGNHDDRAALRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + ++   + +   P ++ G     +    +  L  A  +    
Sbjct: 95  HELQHGEFVQYALDIGAVRVLALDSQV---PRTSGGDLCDARLGWLAAQLDAARDRPT-- 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +   +  + +        +   ++      + +L GH H            
Sbjct: 150 IVALHHPPFVSGIAHMDALRLAPSAAAKLDALLRGYPNVERVLCGHVHRTMFTRF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
                 + + + +V  +      + F +E            +  +PD+  + 
Sbjct: 206 GTLASAVPAPAHQVAFDLRADGPSAFRLEPPAFAV------HRYAPDTGMVS 251


>gi|199599104|ref|ZP_03212509.1| Predicted phosphohydrolase [Lactobacillus rhamnosus HN001]
 gi|199589997|gb|EDY98098.1| Predicted phosphohydrolase [Lactobacillus rhamnosus HN001]
          Length = 442

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 92/316 (29%), Gaps = 32/316 (10%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  +SD H        E S    I        +   +     + L+ + L      + I
Sbjct: 38  RIWVLSDTHFIAPSLHDERSAYTQIKRSAA--GKDMDYQPVAIHALVQNALKSRPTALII 95

Query: 71  TGDIVNFTCNREIFTSTHWLRSI-GNPHDISIVPGNHDAYISGAKEKS------------ 117
           TGD+          +  H L+ +  +   + I+PGNHD Y   A+               
Sbjct: 96  TGDVTFNGEKTSAESLMHRLQPLVEHGIKVLIIPGNHDIYDGWARAYKGRQQRLTEQISP 155

Query: 118 --LHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIAT-----PPFSANGYFGQE 170
                             G  L   + + +   L+   + I T      P +  G    +
Sbjct: 156 SDWRQIFHSSYEQAAAQDGNSLSYRVNLNHQYQLLLLDSNIYTIEPSNRPPNTGGKLSPQ 215

Query: 171 QAHATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILH 228
                 + L    +     II MHH       +      +      +K++      L+  
Sbjct: 216 TMTWVRRQLALGARAHRKSIIFMHHNLYTHNEAVNQGYVLDNSDALKKLLTRYHVPLVFS 275

Query: 229 GHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           GH H   +      +     +   + S         ASY +     +   +  +     L
Sbjct: 276 GHIHAQDISRDPAGQCPTIEIVSGAFSIS------PASYGVVTFGPQQITYQKQIT--NL 327

Query: 289 SPDSLSIQKDYSDIFY 304
           +P   + Q+   D+ +
Sbjct: 328 TPYLTAKQRKNPDLLH 343


>gi|229588052|ref|YP_002870171.1| putative phosphoesterase [Pseudomonas fluorescens SBW25]
 gi|229359918|emb|CAY46772.1| putative phosphoesterase [Pseudomonas fluorescens SBW25]
          Length = 265

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/293 (13%), Positives = 79/293 (26%), Gaps = 54/293 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   +++    +I          D V 
Sbjct: 9   LVQLSDSHLFAEGDGTLLG----------------MNTRDSLQRVIELARAQQPRIDLVL 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                  IG P     +PGNHD     A                
Sbjct: 53  ATGDLSQDGTLESYQQFRDMTAPIGAPTR--WIPGNHDEPQIMA---------------- 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             +        +    +  +    +A+   P S  GY    Q    ++ L +A       
Sbjct: 95  HAAVHSDFLEPVVDIGHWRITLLDSAV---PGSVPGYLQDSQLQLLAQALSEAP--NLHH 149

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++  HH PV    +    +     +    ++        +L GH H      I  E+  +
Sbjct: 150 LVCFHHHPVSIGCAWMEPIGLRNPEALFAVLDRFPHVRAVLWGHVHQ----EIDRERDGV 205

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
            ++   S   +            F + ++   +    + +        +++  
Sbjct: 206 RLLASPSTCIQFAPGSED-----FKVSEQAPGYR-WLRLHADGRLETGVERVQ 252


>gi|107104068|ref|ZP_01367986.1| hypothetical protein PaerPA_01005141 [Pseudomonas aeruginosa PACS2]
          Length = 272

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 82/303 (27%), Gaps = 57/303 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   +      ++  +       D + 
Sbjct: 16  LVQLSDSHLFAEDGARLLG----------------MDTAHSLEKVVERVAREQPRIDLIL 59

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                  +  P       GNHD      +               
Sbjct: 60  ATGDVSQDGSLDSYTRFRRLSAPLDAPLRWFA--GNHDEREPMQR--------------- 102

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             + G  L   +    N  ++   ++I        GY   +Q     + +  A ++  F 
Sbjct: 103 -ATEGSDLLEQVVDVGNWRVVLLDSSIPGAV---PGYLEDDQLDLLRRAIDSAGER--FL 156

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++  HH PV   S   + +     Q    ++        +L GH H         ++  +
Sbjct: 157 LVSFHHHPVPIGSDWMDPIGLRNPQALFDLLAPYPQVRCLLWGHIHQ----EFDRQRGPL 212

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF--- 303
            ++   S   +            F +++    +    + +        I +    +F   
Sbjct: 213 RLLASPSTCVQFAPGSSD-----FTLDRLAPGYR-WLRLHDDGRLETGISRVDDVVFEVD 266

Query: 304 YDT 306
           YDT
Sbjct: 267 YDT 269


>gi|83594819|ref|YP_428571.1| metallophosphoesterase [Rhodospirillum rubrum ATCC 11170]
 gi|83577733|gb|ABC24284.1| Metallophosphoesterase [Rhodospirillum rubrum ATCC 11170]
          Length = 283

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/260 (14%), Positives = 66/260 (25%), Gaps = 29/260 (11%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +A  SD+H+                            +       +  +       D + 
Sbjct: 3   IAQTSDLHIRPPG----------------MLVGGVVDTAAALEACVAHLQALAHRPDLLL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+       E       L  +  P  +   PGNHD     A    L     +     
Sbjct: 47  ITGDLTQQGRPEEYAHLRRLLAPLDLPLLV--CPGNHDDRA--ALRAGLDGLCPWPEPPG 102

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                            + LIG  +  +     + G     Q       L +A       
Sbjct: 103 AGIPDGATLDLTFDLGPLRLIGLDSLRSG---HSGGALSASQEAWLDSALSEAAFLDKPV 159

Query: 190 IIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEGADLI--LHGHTHLNSLHWIKNEKKL 245
           ++ +HHPP           R+   +    ++      ++  L GH H +           
Sbjct: 160 VLFLHHPPFPMGIDHLDAARLDQSETLGLLLDRHPGRVVRLLCGHAHRHVTTVWHGVAVT 219

Query: 246 IPVVGIASASQKVHSNKPQA 265
           +      + +       P A
Sbjct: 220 VCPAPAFAFALDFAHKAPAA 239


>gi|24375389|ref|NP_719432.1| lacZ expression regulator [Shewanella oneidensis MR-1]
 gi|24350219|gb|AAN56876.1|AE015822_8 lacZ expression regulator [Shewanella oneidensis MR-1]
          Length = 278

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/276 (12%), Positives = 73/276 (26%), Gaps = 46/276 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  ++D HL   P    L       L       +                      +  
Sbjct: 16  RIVQVTDPHLFADPEAQLLGVNTSKSLAAVLNTIRAVNYPAHL--------------LLA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD                       
Sbjct: 62  TGDLSQDYSPESYRQFVSAVAPLNLPC--HYLPGNHDDPRIMFLHMQGERVFGQQR---- 115

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                       +     ++   + +   P    G+ G+ Q     + +    +     +
Sbjct: 116 -----------ILVGKWQILMLDSTVRGKPG---GHMGEGQFELIEQAIAAHPEHHT--L 159

Query: 191 IMMHHPPVLDTSSL---YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           ++MHH P+L   +    +    G +  +++  +     +L GH H     +     + + 
Sbjct: 160 LVMHHNPILVNCAWLDQHCMDNGAEFLRRVAQYPQVKALLWGHVHQQLDTYYDGPHRALQ 219

Query: 248 VVGIASASQKVHSNKP-------QASYNLFYIEKKN 276
           ++   S   +     P       Q  Y L  ++   
Sbjct: 220 LMATPSTCIQFKPQSPYFALDGLQPGYRLLELKADG 255


>gi|83859340|ref|ZP_00952861.1| hypothetical protein OA2633_13085 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852787|gb|EAP90640.1| hypothetical protein OA2633_13085 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 260

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/275 (17%), Positives = 79/275 (28%), Gaps = 37/275 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  LA ISD+H                                    L+  +     D V
Sbjct: 1   MTRLAQISDLHFGAESPGLP-------------------------EALLETLNALAPDAV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             +GD   +   RE   +  +  +I  P  +   PGNHD        +    W  +    
Sbjct: 36  IASGDFTQYGRRREFDAARDFFSAINAP--VIAAPGNHDTPYLNLAARVAAPWARFEKRL 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
               T     P   + + +   G           + G      A   ++ L         
Sbjct: 94  GKGVTPSWRSPTAAVESYLTARGL----QAQLDWSLGRANPRHAARIAQSLNDFRG---L 146

Query: 189 RIIMMHHPPV-LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL-I 246
           +++  HHP +         +  G +    +    G DL++ GH H       +       
Sbjct: 147 KVVAAHHPLMAPGGLKGRAKTRGGREAADIFVQAGLDLVVTGHLHQVFALPQRRPDGGSC 206

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
             VG  +A       +P  S+NLF    +    T+
Sbjct: 207 WFVGAGTALSHRTRGEPP-SFNLFDHTLEGLSLTV 240


>gi|295090670|emb|CBK76777.1| Predicted phosphohydrolases [Clostridium cf. saccharolyticum K10]
          Length = 496

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/304 (15%), Positives = 84/304 (27%), Gaps = 42/304 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWH---FNRKKYFSKEVANLLINDILLHNVDHV 68
           +   +D+H        EL+ KR    V        R   +  EV +  + D+     D V
Sbjct: 92  IVVATDMHYLAE----ELAGKRCQSFVQMTYGSDGRVLLYGWEVMDAFVEDMKEKRPDLV 147

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNP-HDISIVPGNHDAYISGAK------------- 114
            ++GD+               LR +      + +VPGNHD     A+             
Sbjct: 148 VLSGDLTLNGERASHEELASILRELDEEDIPVLVVPGNHDINNPNARRFSGTQSYLVESV 207

Query: 115 -EKSLHAWKDYITSDTTCSTGKKLFPYLRIRNN-IALIGCSTAIATPPFSANGYFGQEQA 172
             +               S       YL   ++ + L+   +    P     G       
Sbjct: 208 SPEEFADIYADFGYVAADSRDPSSLSYLYKVDDSLWLLMLDSCQYDPANLTGGMIQSGTY 267

Query: 173 HATSKLLRKANKKGFFRIIMMHHPP-----VLDTSSLYNRMFGIQRFQKMIWHEGADLIL 227
                +L +A +     I + HH       V D       +   +   +M+      L L
Sbjct: 268 RWMEPILYEAWENDTEVITVTHHNLLEQSGVSDAFYDDCTIEHNEELLQMLSDNEVRLHL 327

Query: 228 HGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN----EYWTLEG 283
            GH HL            +  V   S             Y +  + +          +  
Sbjct: 328 SGHLHLQHYMEEDG----VTEVVTGSLVMA------PCGYGVVELYEDGSITYHTQPVNV 377

Query: 284 KRYT 287
           +++ 
Sbjct: 378 EKWA 381


>gi|238796969|ref|ZP_04640473.1| hypothetical protein ymoll0001_33810 [Yersinia mollaretii ATCC
           43969]
 gi|238719229|gb|EEQ11041.1| hypothetical protein ymoll0001_33810 [Yersinia mollaretii ATCC
           43969]
          Length = 282

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/294 (12%), Positives = 79/294 (26%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D +  
Sbjct: 23  RILQITDTHLFAGEHETLLGVNTSHSY------------RAVLDAIIAE--QHPFDLIVA 68

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 69  TGDLAQDHSVAAYQNFAKGIARL--PAPCLWLPGNHDFQPAMV--------------DAL 112

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                     + + +N  ++   + +   P+   G     Q     + L    ++    +
Sbjct: 113 ADADIAPSKQVLVGDNWQILLLDSQVFGVPY---GELSDYQLEWMERCLVAHPERYTLIL 169

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++ H      +L GH H +       +     ++
Sbjct: 170 LHHHPMPSGCTWLDQHSLRNAHMLAAVLTHYPRVTTLLCGHIHQDLDLDWYGK----RLL 225

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               +++  SD F
Sbjct: 226 ASPSTCVQFKPHCTN-----FTLDTVAPGWRY-LDLLPDGRLETEVRRLASDEF 273


>gi|122920483|pdb|2HY1|A Chain A, Crystal Structure Of Rv0805
          Length = 280

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/281 (14%), Positives = 77/281 (27%), Gaps = 52/281 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           +VL HISD HL                +           + +    L+  +       D 
Sbjct: 16  YVLLHISDTHL----------------IGGDRRLYGAVDADDRLGELLEQLNQSGLRPDA 59

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYI 125
           +  TGD+ +             +          +  V GNHD               +  
Sbjct: 60  IVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDR------------AELR 107

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 +        + + + + +I   T++   P   +G     Q    ++ L      
Sbjct: 108 KFLLDEAPSMAPLDRVCMIDGLRIIVLDTSV---PGHHHGEIRASQLGWLAEELATPAPD 164

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           G   I+ +HHPP+     +   +         +++       IL GH H ++        
Sbjct: 165 GT--ILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVG-- 220

Query: 244 KLIPVVGIASASQK---------VHSNKPQASYNLFYIEKK 275
             IPV   ++                       NL ++   
Sbjct: 221 --IPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPD 259


>gi|170077259|ref|YP_001733897.1| putative 3',5'-cyclic-nucleotide phosphodiesterase [Synechococcus
           sp. PCC 7002]
 gi|169884928|gb|ACA98641.1| Putative 3',5'-cyclic-nucleotide phosphodiesterase [Synechococcus
           sp. PCC 7002]
          Length = 255

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/292 (15%), Positives = 81/292 (27%), Gaps = 51/292 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++A I+D HL   P                    +   +      ++  +     D +
Sbjct: 1   MVLIAQITDTHLLDHPEA----------------EMRGVKTDASFQAVLAAVQQFKPDRL 44

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+ +             + +   P     +PGNHD     A         DY++ D
Sbjct: 45  ILTGDLAHHGEAISYERLRDLVEATQIPS--YWLPGNHDDPELMAG----ILQGDYLSPD 98

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              +             N  L+   + +   P    G+    Q    ++ L         
Sbjct: 99  KNVAL-----------GNWKLLLLDSFLEN-PEYGEGFLDTAQLAWLAERLEHHQNSPVA 146

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
             I  H  P          M     F +++ H      +  GH HL         +  IP
Sbjct: 147 IAIHHHVVPAGVDWLDQIDMTNRAEFWQIVQHHPQVKTVFFGHVHLEYSVT----QGGIP 202

Query: 248 VVGIASASQKVHSNKPQ-----------ASYNLFYIEKKNEYWTLEGKRYTL 288
             G  S   +V     +             + LF +      +  + +R   
Sbjct: 203 CFGTPSTCTQVTPPDQEPIEGDRQLWEQPGFRLFELHDDGR-FQTKVQRIPW 253


>gi|220911475|ref|YP_002486784.1| metallophosphoesterase [Arthrobacter chlorophenolicus A6]
 gi|219858353|gb|ACL38695.1| metallophosphoesterase [Arthrobacter chlorophenolicus A6]
          Length = 309

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 45/278 (16%), Positives = 76/278 (27%), Gaps = 52/278 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           L H+SD HL   P                        S+     L  ++       + V 
Sbjct: 15  LLHLSDPHLLGGPEPL----------------YGVVDSEARLAQLFEEVKASGARPEAVI 58

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +          +    GNHD               ++   
Sbjct: 59  FTGDLADRGEPGAYAKLRAIVDPACKELGAEVIWAMGNHDNR------------ANFREG 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                            N + +I   T   T P   +G     Q    ++ L      G 
Sbjct: 107 LLDQPRDDAPVDNSYFINGLRVITMDT---TVPGYHHGELCGSQLEWLARELETPAPDGT 163

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ +HHPPV     L   +          ++ +     IL GH H ++          
Sbjct: 164 --ILALHHPPVPSVLDLSVLVELRDQGSLAAVVRNSDVRTILAGHLHYSTTATFAG---- 217

Query: 246 IPVVGIASASQKVHSNKPQAS---------YNLFYIEK 274
           IPV   +++      N P            +NL ++ +
Sbjct: 218 IPVSVASASCYTQDLNVPVGGTRGQDGGQAFNLVHVYE 255


>gi|261867494|ref|YP_003255416.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412826|gb|ACX82197.1| Icc [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 274

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/298 (14%), Positives = 87/298 (29%), Gaps = 48/298 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           +F +  I+D HL                  +         ++E  + ++++I     + D
Sbjct: 13  VFRVIQITDPHL----------------FKDATGELLGVNTQESFSQVLSEIRQQSYDYD 56

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V  TGD+V  +           ++ +     +  +PGNHD               D   
Sbjct: 57  LVLATGDLVQDSSEEGYLRFCESVKPLEKT--VFWIPGNHDFQPKMFDILKRDNICDKKH 114

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                         + +  N  ++   + IA  P    G  GQ Q       L++  ++ 
Sbjct: 115 --------------ILLGENWQILLLDSQIAGVPH---GQLGQYQLDWLMAKLKEHPQRY 157

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKL 245
              ++  H           + +         +        IL+GH H      +  E   
Sbjct: 158 SLVVLHHHILSTHSAWLDQHNLRNAHELAYTLAPFNNVKGILYGHIHQ----QVDGEWNG 213

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             ++   S   +   +      N F ++     W  E + Y        +++     F
Sbjct: 214 YKIMATPSTGIQFKPDS-----NTFALDTAQPGWR-EIELYADGRIETRVKRIQHKTF 265


>gi|254298103|ref|ZP_04965556.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 406e]
 gi|157807208|gb|EDO84378.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 406e]
          Length = 318

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/246 (15%), Positives = 75/246 (30%), Gaps = 40/246 (16%)

Query: 3   KRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL 62
           +     M +LAHISD+H+    +                   ++  +       +  +  
Sbjct: 38  QSQRGTMMLLAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNA 81

Query: 63  H--NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
                D V +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +      
Sbjct: 82  LEPRPDAVLVTGDLTDFGDDDEYAHLKALLAPLAMPY--YLLVGNHDDRAALRRAFPAR- 138

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
                          +   Y      + +I   + I   P ++ G     +    +  L 
Sbjct: 139 ---------VELQSGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLD 186

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNS 235
            A  +    I+ +HHPP        + M        R   ++      + +L GH H   
Sbjct: 187 AARDR--PVIVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTM 244

Query: 236 LHWIKN 241
                 
Sbjct: 245 FARFGG 250


>gi|320326426|gb|EFW82479.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. glycinea str. B076]
 gi|320331602|gb|EFW87540.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. glycinea str. race 4]
 gi|330872327|gb|EGH06476.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. glycinea str. race 4]
          Length = 277

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 84/272 (30%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD         +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHDLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGRLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|108810689|ref|YP_646456.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pestis Nepal516]
 gi|108774337|gb|ABG16856.1| Icc-like protein [Yersinia pestis Nepal516]
          Length = 267

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/294 (12%), Positives = 76/294 (25%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D V  
Sbjct: 8   RILQITDTHLFAGEHETLLGVNTFHSY------------RAVLDAIIAE--QHPFDLVVA 53

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 54  TGDLAQDHSVAAYQNFAKGISRL--PVPCVWLPGNHDFQPAM--------------FDAL 97

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      +    +  ++   + +   P+   G     Q     + L    ++    +
Sbjct: 98  AEAGIAPSKQVLAGEHWQILLLDSQVFGVPY---GELSDYQLEWMERCLIAYPERYTLIL 154

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 155 LHHHPMPSGCTWLDQHSLRNAHMLAAILTRYPRVTTLLCGHIHQDLDLDWYGK----RLL 210

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               + +  SD F
Sbjct: 211 ASPSTCVQFKPHCTN-----FTLDAVAPGWRY-LDLLPDGGLETEVHRLDSDEF 258


>gi|261253835|ref|ZP_05946408.1| 3',5'-cyclic-nucleotide phosphodiesterase [Vibrio orientalis CIP
           102891]
 gi|260937226|gb|EEX93215.1| 3',5'-cyclic-nucleotide phosphodiesterase [Vibrio orientalis CIP
           102891]
          Length = 273

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 42/294 (14%), Positives = 89/294 (30%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            L  I+D HL        LS K +                 V + +++       D +  
Sbjct: 14  KLLQITDTHLFEPLDGSLLSVKTLDSF------------HAVVDAIVDSGASF--DALLS 59

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGDI               +  +  P     +PGNHD   S                   
Sbjct: 60  TGDISQDHSAISYQHFEQGIEKLELPC--FWLPGNHDFKPSMNSV--------------L 103

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            S+  +   ++ +  +  ++   + +   P    G+  ++Q     + L +  ++    +
Sbjct: 104 PSSQIQQVEHVLLGEHWQIVLLDSQVVGVPH---GFLTEQQLTMLDEKLSEHPERNTLVL 160

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H   V       + +     F +++        ++ GH H +     K     + V+
Sbjct: 161 LHHHPILVGSRWLDQHTLKEADSFWRVVEKHNNVKAVVCGHVHQDMNVMYKG----VQVM 216

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   N        F ++  +  W  E + Y     S  +++     F
Sbjct: 217 STPSTCVQFKPNCDD-----FSLDTLSPGWR-ELELYNDGSVSTEVKRLKPGSF 264


>gi|283798649|ref|ZP_06347802.1| serine/threonine protein phosphatase family protein [Clostridium
           sp. M62/1]
 gi|291073634|gb|EFE10998.1| serine/threonine protein phosphatase family protein [Clostridium
           sp. M62/1]
          Length = 496

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/304 (15%), Positives = 84/304 (27%), Gaps = 42/304 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWH---FNRKKYFSKEVANLLINDILLHNVDHV 68
           +   +D+H        EL+ KR    V        R   +  EV +  + D+     D V
Sbjct: 92  IVVATDMHYLAE----ELAGKRCQSFVQMTYGSDGRVLLYGWEVMDAFVEDMKEKRPDLV 147

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNP-HDISIVPGNHDAYISGAK------------- 114
            ++GD+               LR +      + +VPGNHD     A+             
Sbjct: 148 VLSGDLTLNGERASHEELASILRELDEEDIPVLVVPGNHDINNPNARRFSGTQSYLVESV 207

Query: 115 -EKSLHAWKDYITSDTTCSTGKKLFPYLRIRNN-IALIGCSTAIATPPFSANGYFGQEQA 172
             +               S       YL   ++ + L+   +    P     G       
Sbjct: 208 SPEEFADIYADFGYVAADSRDPSSLSYLYKVDDSLWLLMLDSCQYDPANLTGGMIQSGTY 267

Query: 173 HATSKLLRKANKKGFFRIIMMHHPP-----VLDTSSLYNRMFGIQRFQKMIWHEGADLIL 227
                +L +A +     I + HH       V D       +   +   +M+      L L
Sbjct: 268 RWMEPILYEAWENDTEVITVTHHNLLEQSGVSDAFYDDCTIEHNEELLQMLSDNEVRLHL 327

Query: 228 HGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN----EYWTLEG 283
            GH HL            +  V   S             Y +  + +          +  
Sbjct: 328 SGHLHLQHYMEEDG----VTEVVTGSLVMA------PCGYGVVELYEDGSITYHTQPVNV 377

Query: 284 KRYT 287
           +++ 
Sbjct: 378 EKWA 381


>gi|86148729|ref|ZP_01067004.1| cyclic AMP phosphodiesterase [Vibrio sp. MED222]
 gi|218708458|ref|YP_002416079.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Vibrio
           splendidus LGP32]
 gi|85833478|gb|EAQ51661.1| cyclic AMP phosphodiesterase [Vibrio sp. MED222]
 gi|218321477|emb|CAV17429.1| cyclic AMP phosphodiesterase [Vibrio splendidus LGP32]
          Length = 274

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/299 (13%), Positives = 91/299 (30%), Gaps = 48/299 (16%)

Query: 2   TKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL 61
           T ++      L  ++D HL    +   L                   +++    +++ I+
Sbjct: 6   TSKFDESSIKLVQLTDTHLFAPSNGSLL----------------SINTQDSFRAVVDAIV 49

Query: 62  LHNVD--HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
               D   +  TGDI               ++ +  P     +PGNHD   +        
Sbjct: 50  SQGFDYQAILATGDISQDHSAESYQKFESGIQPLDKPC--YWLPGNHDFKPNM------- 100

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
                       S   +   ++ + NN  ++   + +   P    G    +Q     + L
Sbjct: 101 -------GSVLPSPQIQCVEHVLLGNNWQMVMLDSQVVGVPH---GRLSDQQLDLLEQKL 150

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHW 238
            +  ++    ++  H   V       + +    +F +++        +L GH H +    
Sbjct: 151 TEFPERNTLVLLHHHPLLVGSAWLDQHNLKDADQFWEVVQQHTNVKAVLCGHVHQDMNRD 210

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
                  + V+   S   +   N        F ++  +  W  E + +     S  +++
Sbjct: 211 HHG----VQVMATPSTCVQFKPNSDD-----FAVDTLSPGWR-EIELHQDGSVSTQVRR 259


>gi|227535636|ref|ZP_03965685.1| phosphohydrolase [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|227186766|gb|EEI66833.1| phosphohydrolase [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
          Length = 442

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/312 (15%), Positives = 89/312 (28%), Gaps = 32/312 (10%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           +SD H        E +    I        +   +     N L+ + L      + ITGD+
Sbjct: 42  LSDTHFIAPSLHDEKTAYTQIKRSAA--GKDMDYQPVAINALVQNALKARPTALVITGDV 99

Query: 75  VNFTCNREIF-TSTHWLRSIGNPHDISIVPGNHDAYISGAKEK-------------SLHA 120
                              + N   + I+PGNHD Y   A+               S   
Sbjct: 100 TFNGEKASAESIMRRLQPLVANGTKVLIIPGNHDIYDGWARANKGKRQLLTEQISPSDWR 159

Query: 121 WKDYITSDTTCSTGKKLFPY-LRIRNNIALIGCSTAIAT-----PPFSANGYFGQEQAHA 174
              + + +   +       Y + +  N  L+   + I T      P +  G    +    
Sbjct: 160 NIFHTSYEQAVAQDPNSLSYRVNLNRNYQLLMLDSNIYTIEPSNRPPNTGGKLTPQTMKW 219

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGHTH 232
             + L    K     I+ MHH       +      +    + + ++      L+  GH H
Sbjct: 220 VRQQLAAGQKAHRKSIVFMHHNLYAHNEAVNQGFVLDNSDQLKTLLKAYHVPLLFSGHIH 279

Query: 233 LNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
              +    + +     V   + S         ASY +         +         +P  
Sbjct: 280 AQDISRDPDGQCPTIEVVSGAFSIS------PASYGVVTFTPNRITYQKHAT--DPTPYL 331

Query: 293 LSIQKDYSDIFY 304
            + Q+   D+ +
Sbjct: 332 TAKQRKNPDLLH 343


>gi|226363107|ref|YP_002780889.1| 3',5'-cyclic-nucleotide phosphodiesterase [Rhodococcus opacus B4]
 gi|226241596|dbj|BAH51944.1| 3',5'-cyclic-nucleotide phosphodiesterase [Rhodococcus opacus B4]
          Length = 287

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 77/279 (27%), Gaps = 52/279 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVS 69
           + H+SD H                          +  S      L + +       + + 
Sbjct: 11  ILHVSDTHFVTDGDLLHD----------------RVDSDANLTRLFDRLEKTGQRPEAIV 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +          +  V GNHDA               + + 
Sbjct: 55  FTGDLADMGEPEAYVRLRRIVEPAAERLGAKVIWVMGNHDARP------------AFRSG 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  +     +   N + +I   +   T P   +G    EQ    + +L +    G 
Sbjct: 103 LLDAEPTQDSVDAVVDVNGLRIIVLDS---TVPGFHHGLISDEQLAWLTDVLAEPAPHGT 159

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             ++ +HHPPV         +      R + ++       IL GH H ++          
Sbjct: 160 --LLALHHPPVPGLLDAMGSVELQDQHRLETVLAGTDVRGILAGHLHFSTTCTFAG---- 213

Query: 246 IPVVGIASASQKV---------HSNKPQASYNLFYIEKK 275
           IPV   ++                      YN+ ++ + 
Sbjct: 214 IPVSVASATCYTQDLLVGSGSIRGQDGAQGYNMVHVYRD 252


>gi|53724049|ref|YP_104567.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           ATCC 23344]
 gi|52427472|gb|AAU48065.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           ATCC 23344]
          Length = 354

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/246 (15%), Positives = 75/246 (30%), Gaps = 40/246 (16%)

Query: 3   KRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL 62
           +     M +LAHISD+H+    +                   ++  +       +  +  
Sbjct: 74  QSQRGTMMLLAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNA 117

Query: 63  H--NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
                D V +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +      
Sbjct: 118 LEPRPDAVLVTGDLTDFGDDDEYAHLKALLAPLAMPY--YLLVGNHDDRAALRRAFPAR- 174

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
                          +   Y      + +I   + I   P ++ G     +    +  L 
Sbjct: 175 ---------VELQSGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLD 222

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNS 235
            A  +    I+ +HHPP        + M        R   ++      + +L GH H   
Sbjct: 223 AARDR--PVIVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTM 280

Query: 236 LHWIKN 241
                 
Sbjct: 281 FARFGG 286


>gi|319956240|ref|YP_004167503.1| metallophosphoesterase [Nitratifractor salsuginis DSM 16511]
 gi|319418644|gb|ADV45754.1| metallophosphoesterase [Nitratifractor salsuginis DSM 16511]
          Length = 295

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 58/259 (22%), Positives = 97/259 (37%), Gaps = 13/259 (5%)

Query: 10  FVLAHISDIHLS---YSPSFFELSPKRIIGLVNWH--FNRKKYFSKEVANLLINDILLHN 64
             + H SD H      S  + +L  KR IG +N      R    ++E    L      + 
Sbjct: 1   MRILHCSDPHFDLSLRSIPWKKLFGKRAIGALNLLGGRGRYFDEAEEKIAALARFKERYG 60

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDIS-IVPGNHDAYISG--AKEKSLHAW 121
           VD V  TGD+       E+  +   L  +  P     I+PGNHD Y +     +   + +
Sbjct: 61  VDLVLCTGDVTALGLTAELENAAELLAPLAQPPKHFIIIPGNHDVYSADVIRGDHFHYYF 120

Query: 122 KDYITSDTTCSTGKKLFPYLRIR-NNIALIGCSTAIATP-PFSANGYFGQEQAHATSKLL 179
             Y+ +D         +P +R+   +IA++  ++A   P P+ ++GY    Q  A  K+L
Sbjct: 121 GQYMHTDWPQYAVDGPWPIVRLFSEDIAVVAVNSAKPNPLPWRSDGYIPPAQLEALEKIL 180

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMF---GIQRFQKMIWHEGADLILHGHTHLNSL 236
           +    K  +  +M H+   L                 F  +        IL+GH H    
Sbjct: 181 QDHRIKDRWIFVMTHYAARLANGRPDKPNHGLRNADEFLNVCRLIQKGAILNGHVHRCYR 240

Query: 237 HWIKNEKKLIPVVGIASAS 255
             + +E   I      S +
Sbjct: 241 TSLADEGLNIDEYCAGSVT 259


>gi|301065912|ref|YP_003787935.1| putative phosphohydrolase [Lactobacillus casei str. Zhang]
 gi|300438319|gb|ADK18085.1| Predicted phosphohydrolase [Lactobacillus casei str. Zhang]
          Length = 442

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 47/314 (14%), Positives = 89/314 (28%), Gaps = 36/314 (11%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           +SD H        E +    I        +   +     N L+ + L      + ITGD+
Sbjct: 42  LSDTHFIAPSLHDEKTAYTQIKRSAA--GKDMDYQPVAINALVQNALKARPTALVITGDV 99

Query: 75  VNFTCNREIF-TSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCST 133
                              + N   + I+PGNHD Y      ++    +  +T   + S 
Sbjct: 100 TFNGEKASAESIMRRLQPLVANGTKVLIIPGNHDIY--DGWARAYKGKRQLLTEQISPSD 157

Query: 134 GKKLFPYLRI----------------RNNIALIGCSTAIAT-----PPFSANGYFGQEQA 172
            + +F                       N  L+   + I T      P +  G    +  
Sbjct: 158 WRNIFHTSYEQAVAQDPNSLSYRVNLNRNYQLLMLDSNIYTIEPSNRPPNTGGKLTPQTM 217

Query: 173 HATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGH 230
               + L    K     I+ MHH       +      +    + + ++      L+  GH
Sbjct: 218 KWVRQQLAAGQKAHRKSIVFMHHNLYAHNEAVNQGFVLDNSDQLKTLLKAYHVPLLFSGH 277

Query: 231 THLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSP 290
            H   +    + +     V   + S         ASY +         +         +P
Sbjct: 278 IHAQDISRDPDGQCPTIEVVSGAFSIS------PASYGVVTFTPNRITYQKHAT--DPTP 329

Query: 291 DSLSIQKDYSDIFY 304
              + Q+   D+ +
Sbjct: 330 YLTAKQRKNPDLLH 343


>gi|327400518|ref|YP_004341357.1| metallophosphoesterase [Archaeoglobus veneficus SNP6]
 gi|327316026|gb|AEA46642.1| metallophosphoesterase [Archaeoglobus veneficus SNP6]
          Length = 381

 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 53/280 (18%), Positives = 90/280 (32%), Gaps = 54/280 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISDIH                          +   ++     +  I   + D V 
Sbjct: 1   MKIVHISDIHFG------------------------EELVRDKVRKAVRQINEMDPDLVI 36

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+  +  + E+  +   L ++        +PGNHDA   G +   L+          
Sbjct: 37  ITGDLTCWGTHHEMRDAYEELSNLTPE--FVALPGNHDARNIGYEYFKLYF--------- 85

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                      +    +  LI   +   T P    G+ G EQ       ++    KG   
Sbjct: 86  ------GKTKKVLDFEDFRLITADS---TQPDIDEGHIGIEQREWIEGNIK----KGKIN 132

Query: 190 IIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
            I +HH   P+ +T    N +       +++   G   +L GH H+     +        
Sbjct: 133 AIALHHHIVPIPETGRERNVLIDAGEMVELLIRNGVSFVLAGHRHMPYSIRL----MRTH 188

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
           ++   S         P  +YN+  IE      TL+   Y 
Sbjct: 189 IIHAGSLGSFKILGMPDHNYNIIEIEDDKISLTLKFVDYG 228


>gi|51597695|ref|YP_071886.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pseudotuberculosis IP 32953]
 gi|186896836|ref|YP_001873948.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Yersinia
           pseudotuberculosis PB1/+]
 gi|51590977|emb|CAH22635.1| Icc protein homologue [Yersinia pseudotuberculosis IP 32953]
 gi|186699862|gb|ACC90491.1| Calcineurin phosphoesterase domain protein [Yersinia
           pseudotuberculosis PB1/+]
          Length = 299

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/294 (12%), Positives = 75/294 (25%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D V  
Sbjct: 40  RILQITDTHLFAGEHETLLGVNTFHSY------------RAVLDAIIAE--QHPFDLVVA 85

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                   
Sbjct: 86  TGDLAQDHSVAAYQNFAKGISRL--PVPCVWLPGNHDFQPAMV--------------GAL 129

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      +    +  ++   + +   P+   G     Q     + L    ++    +
Sbjct: 130 AEAGIAPSKQVLAGEHWQILLLDSQVFGVPY---GELSDYQLEWMERCLIAYPERYTLIL 186

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 187 LHHHPMPSGCTWLDQHSLRNAHMLAAILTRYPRVTTLLCGHIHQDLDLDWYGK----RLL 242

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W               + +  SD F
Sbjct: 243 ASPSTCVQFKPHCTN-----FTLDAVAPGWRY-LDLLPDGGLETEVHRLDSDEF 290


>gi|253991003|ref|YP_003042359.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782453|emb|CAQ85617.1| icc protein [Photorhabdus asymbiotica]
          Length = 279

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/279 (12%), Positives = 78/279 (27%), Gaps = 47/279 (16%)

Query: 5   YTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
                  +  I+D HL        L                      V + ++      +
Sbjct: 10  VEGTTAKILQITDTHLFAGKEDTLLGINTYRSY------------HAVLDAILEQ--KTD 55

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
           +D +  TGD+      +        +  +  P     +PGNHD   +             
Sbjct: 56  IDLIVATGDLSQDQTLKAYQHFADGIARLSAPC--VWLPGNHDYQPAMV----------- 102

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
              D   + G      + +     L+   + +   P    G   + Q       L +  +
Sbjct: 103 ---DALAAAGVSPSKQILVGKYWQLLMLDSQVQGVPH---GELSEYQLEWMKSCLDEYPE 156

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKN 241
           +  + +I++HH P+    +  ++          + +        +L GH H      +  
Sbjct: 157 R--YTVILLHHHPLPSGCTWLDQHSLRNSHILAQYLRGYSRVKAMLCGHIHQ----ELDV 210

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
           +   I ++   S   +   +        F ++     W 
Sbjct: 211 DWNSIRMMATPSTCVQFKPHCTN-----FMLDTVAPGWR 244


>gi|56475738|ref|YP_157327.1| DNA repair exonuclease [Aromatoleum aromaticum EbN1]
 gi|56311781|emb|CAI06426.1| DNA repair exonuclease [Aromatoleum aromaticum EbN1]
          Length = 285

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 54/300 (18%), Positives = 94/300 (31%), Gaps = 44/300 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             LAHISD H     +                            + L  D+L    D V 
Sbjct: 1   MRLAHISDPHFGTEEAPVR-------------------------DALREDLLREAPDLVV 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGDI       +   +  +L S+  P  +  +PGNHD  +     +    ++ Y     
Sbjct: 36  LTGDITQRARQAQFRAARAFLDSL-APLPVLTLPGNHDLPLFDLFTRFTAPYRHYRRHIC 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
              +       L     +A++G ++         +G          ++ L    +   F+
Sbjct: 95  ASLSP------LWRGRRVAVVGVNSTRM--LRHKHGELPAPLVEQVARQLAALGES--FK 144

Query: 190 IIMMHHPP-VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           ++ +HHP  +++ S   NR+ G           GADL L GH HL       +  +   V
Sbjct: 145 VVALHHPLEIIEPSDRRNRVRGADAALAAWIAAGADLFLGGHIHLPYCVATGDGSRDALV 204

Query: 249 VGIASASQKVHSNKPQASYNLFYI-------EKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
           +   ++      N    SYNL            +     +E +                 
Sbjct: 205 LQAGTSMSTRRRNGRPNSYNLVRFVPIALRGAGEAGLRRIEIEERDHDARIGRFTIVTCR 264


>gi|313109975|ref|ZP_07795901.1| putative phosphohydrolase [Pseudomonas aeruginosa 39016]
 gi|310882403|gb|EFQ40997.1| putative phosphohydrolase [Pseudomonas aeruginosa 39016]
          Length = 272

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 82/303 (27%), Gaps = 57/303 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   +      ++  +       D + 
Sbjct: 16  LVQLSDSHLFAEDGARLLG----------------MDTAHSLEKVVERVAREQPRIDLIL 59

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                  +  P       GNHD      +               
Sbjct: 60  ATGDVSQDGSLDSYTRFRRLSAPLAAPLRWFA--GNHDEREPMQR--------------- 102

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             + G  L   +    N  ++   ++I        GY   +Q     + +  A ++  F 
Sbjct: 103 -ATEGSDLLEQIVDVGNWRVVLLDSSIPGAV---PGYLEDDQLDLLRRAIDSAGER--FL 156

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++  HH PV   S   + +     Q    ++        +L GH H         ++  +
Sbjct: 157 LVSFHHHPVPIGSDWMDPIGLRNPQALFDLLAPYPQVRCLLWGHIHQ----EFDRQRGPL 212

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF--- 303
            ++   S   +            F +++    +    + +        I +    +F   
Sbjct: 213 RLLASPSTCVQFAPGSSD-----FTLDRLAPGYR-WLRLHDDGRLETGISRVDDVVFEVD 266

Query: 304 YDT 306
           YDT
Sbjct: 267 YDT 269


>gi|167737975|ref|ZP_02410749.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 14]
          Length = 249

 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 74/240 (30%), Gaps = 40/240 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M +LAHISD+H+    +                   ++  +       +  +       D
Sbjct: 1   MMLLAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNALEPRPD 44

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +            
Sbjct: 45  AVLVTGDLTDFGDDDEYAHLKALLAPLAMPY--YLLVGNHDDRAALRRAFPAR------- 95

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    +   Y      + +I   + I   P ++ G     +    +  L  A  + 
Sbjct: 96  ---VELQSGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDR- 148

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              I+ +HHPP        + M        R   ++      + +L GH H         
Sbjct: 149 -PVIVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGG 207


>gi|317126730|ref|YP_004100842.1| metallophosphoesterase [Intrasporangium calvum DSM 43043]
 gi|315590818|gb|ADU50115.1| metallophosphoesterase [Intrasporangium calvum DSM 43043]
          Length = 296

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/295 (15%), Positives = 88/295 (29%), Gaps = 54/295 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVS 69
           +AH+SD+HL                            +       +  +      +D + 
Sbjct: 14  IAHLSDLHLIAGEGLLH----------------GHIDTAAQFRKALARVEESGEGIDALV 57

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNP--HDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           ++GD+ +             +  +       + +  GNHD                 + +
Sbjct: 58  LSGDLTDVGQPEAYALLREIVAPVSERLAAPVVVTGGNHDER-------------RALAA 104

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                   +    +   N + ++   +A+   P   +G F   Q    +  L +    G 
Sbjct: 105 GLHAVDTDEPQDTVTKVNGLRILTLDSAL---PGFHHGGFSDAQYAWLADQLTEPAPHGT 161

Query: 188 FRIIMMHHPPVLDTSSLYN--RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I++MHHPP+   S L        + R +  +       IL GH H+ S   +      
Sbjct: 162 --ILVMHHPPITYRSPLMQLLDFEDVPRLRTALEGTDVRAILSGHLHVTSFGTL----GA 215

Query: 246 IPVVGIASASQKVHSNKP---------QASYNLFYIEKKN-EYWTLEGKRYTLSP 290
           IPV           +  P           S+NL  +   +     +  +R+   P
Sbjct: 216 IPVFVAGGICYVDDAGAPRELLMAVDGPQSWNLIEVHADHVVGTVIPVERHETWP 270


>gi|289624786|ref|ZP_06457740.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. aesculi str. NCPPB3681]
 gi|330871183|gb|EGH05892.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. aesculi str. 0893_23]
          Length = 277

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHNLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGQLDYCQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|91784336|ref|YP_559542.1| putative cAMP phosphodiesterase [Burkholderia xenovorans LB400]
 gi|91688290|gb|ABE31490.1| Putative cAMP phosphodiesterase [Burkholderia xenovorans LB400]
          Length = 275

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/299 (15%), Positives = 87/299 (29%), Gaps = 52/299 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  LA ISD+H+    +                   ++  +       +  +       D
Sbjct: 1   ML-LAQISDLHIKRPGALA----------------YRRVDTGAYLARCVAALNALEPRPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+V+     +       L  +  P+   ++ GNHD            A +    
Sbjct: 44  AVIMTGDLVDQGDPEQYEHLKTLLAPLEIPY--FMLVGNHDERA---------ALRAAFP 92

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                ++G +   Y      + LI   + +   P  + G     +    +  L  A  +G
Sbjct: 93  DRKELASGGEFVQYAVDLGALRLIALDSMV---PGQSAGDLCDARLAWLAAQLDAA--QG 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              I+ +HHPP +      + +        R   +I      + ++ GH H         
Sbjct: 148 KPTIVALHHPPFVCGIGHMDELRLDPAAAGRLAALIARYPNVERVICGHVHRPMFVRFGG 207

Query: 242 ---EKKLIPVVGIAS-----ASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
                   P   +A      A        P  + + +          +    Y  + D 
Sbjct: 208 TIASAVPAPAHQVALDLREDAPSAFMMEPPAYALHHY----DPATGIVTHHAYVDAADG 262


>gi|85375401|ref|YP_459463.1| hypothetical protein ELI_12870 [Erythrobacter litoralis HTCC2594]
 gi|84788484|gb|ABC64666.1| hypothetical protein ELI_12870 [Erythrobacter litoralis HTCC2594]
          Length = 284

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/282 (16%), Positives = 91/282 (32%), Gaps = 39/282 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           + H+SDIH                               +  + +  +I     D V+IT
Sbjct: 6   IFHLSDIHFGLE-------------------------DNQALDWVQQEIAELRPDAVAIT 40

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+     +RE   +T W+R +G P  +++  GNHD       E+    ++ +       
Sbjct: 41  GDLTMRARHREFDAATKWIRGLGVP--VTVEVGNHDMPYFNPIERFFDPYRRFRGMQDLV 98

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKGFFR 189
                         +IA++   TA+   P    + G+  Q            A   G   
Sbjct: 99  EKE-------IDLPDIAIVPLKTAVRAQPRLNWSKGWVTQTALDKCLAA-VDALPPGTQA 150

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
           ++ +HHP     +          +  + +       ++ GH H       + ++  + ++
Sbjct: 151 LVAVHHPLREVGTEGTALTRNGTKALRELATRPVAAVISGHVHDAFDIVEQTDRGPVRMI 210

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPD 291
           G  + S++  S     S+N            +       S D
Sbjct: 211 GAGTLSKRTRST--PPSFNELRWNGSELTVRVRNLDDIESRD 250


>gi|255594763|ref|XP_002536159.1| conserved hypothetical protein [Ricinus communis]
 gi|223520651|gb|EEF26224.1| conserved hypothetical protein [Ricinus communis]
          Length = 224

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 50/259 (19%), Positives = 89/259 (34%), Gaps = 36/259 (13%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD+H                                V   L+        D +
Sbjct: 1   MSTILHISDLHFGTE-------------------------RPPVVRALLQLARELKPDLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGDI       +   +  ++ ++  P  + IV GNHD  +     ++LH +++Y  + 
Sbjct: 36  LITGDITQRARRAQFREAAAFVEALAAPAQV-IVSGNHDVPLYNLFARALHPFRNYRRAF 94

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                           +++ ++G ++          G    EQ    S  LR A      
Sbjct: 95  GANLEPD------FASDDLLVLGVNSTRP--QRHTRGSVSVEQIERVSARLRAAAPDQ-L 145

Query: 189 RIIMMHHPPVLDTSSLYNRM-FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           RI+ MHHP +  +    + +        +     GADLI+ GH HL  +  + +  + + 
Sbjct: 146 RIVAMHHPVLAISDGDRHNLLHNRAAALRAWALAGADLIIGGHIHLPYVRPLPDLPRSLW 205

Query: 248 VVGIASASQKVHSNKPQAS 266
            V   +A+          S
Sbjct: 206 TVQAGTATSWRVRGDAPNS 224


>gi|54297879|ref|YP_124248.1| hypothetical protein lpp1934 [Legionella pneumophila str. Paris]
 gi|53751664|emb|CAH13086.1| hypothetical protein lpp1934 [Legionella pneumophila str. Paris]
          Length = 270

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 79/279 (28%), Gaps = 40/279 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISD+H                                V N  + +  L   D + 
Sbjct: 1   MKIIHISDLHFGK-------------------------HQPAVLNAFLQETALDKPDIIL 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+     + +      ++  +  P     VPGNHD        + +  ++ Y     
Sbjct: 36  ISGDLTQRGLSYQYRELCSFINQL--PAQTLTVPGNHDIPFYNVPARFIFPFRHYKRYIN 93

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
           +  T           + + ++G ++         +G   +E  +   +            
Sbjct: 94  SDVT------TTFENDCVRILGVNSVNPLQ--LKDGELSRETLNRIKRYF---KPDDEKL 142

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            ++  H        L+  +   Q     +      L+  GH H   L  I        + 
Sbjct: 143 NLLFFHHNFDYMEGLHKPLANAQTLLSFLKQSTIHLVCTGHLHYAHLSLIAKNNGYSCLA 202

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKN--EYWTLEGKRY 286
             A +     S     SY +    +K     W +  + +
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIEANQKKCRITWRVFDQEH 241


>gi|254482702|ref|ZP_05095940.1| Calcineurin-like phosphoesterase C-terminal domain family protein
           [marine gamma proteobacterium HTCC2148]
 gi|214037061|gb|EEB77730.1| Calcineurin-like phosphoesterase C-terminal domain family protein
           [marine gamma proteobacterium HTCC2148]
          Length = 279

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/285 (15%), Positives = 79/285 (27%), Gaps = 53/285 (18%)

Query: 4   RYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH 63
           +       L  I+D HL  +P    L                   +     L+I   L  
Sbjct: 12  QTEGDTVRLVQITDTHLCANPGGTLL----------------DMDTDRSLKLVIERALQE 55

Query: 64  N--VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAW 121
               D V  TGD+ +    +        L+ I  P     +PGNHD              
Sbjct: 56  RGTPDGVLCTGDLSDQGSLQAYRRLIAHLQEIPAPD--FWLPGNHDDLSEMQ-------- 105

Query: 122 KDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRK 181
                                +  N  +I  ++ I        G  G ++       L +
Sbjct: 106 --------AAVDTSDRLCAEVLAGNWQVILLNSQIPGEVG---GRLGSDELEKLRLALER 154

Query: 182 ANKKGFFRIIMMHHPPVLDTSSL--YNRMFGIQRFQKMI-WHEGADLILHGHTHLNSLHW 238
           A  +G   ++ +HH PV   S+      +    +F +++        +L GH H      
Sbjct: 155 AQAEGLHSLVCLHHQPVAIGSAWIDQQMVEDADQFWEIVDAASSVKGVLWGHVHQ----Q 210

Query: 239 IKNEKKLIPVVGIASASQKVHSN-------KPQASYNLFYIEKKN 276
           I   +  I ++   S+  +                Y    +    
Sbjct: 211 IDERRGDIALMASPSSCVQFAPGSAMFKADDKPPGYRWLDLCSDG 255


>gi|52842169|ref|YP_095968.1| 3',5'-cyclic nucleotide phosphodiesterase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|52629280|gb|AAU28021.1| 3',5'-cyclic nucleotide phosphodiesterase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 269

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 78/279 (27%), Gaps = 40/279 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISD+H                               +V N  + +  L   D + 
Sbjct: 1   MKIIHISDLHFGM-------------------------HQPKVLNAFLQETALDKPDIIL 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+     + +      ++  +  P     VPGNHD        + +  ++ Y     
Sbjct: 36  ISGDLTQRGLSYQYRELCSFINQL--PAQTLSVPGNHDIPFYNVPARFIFPFRQYKRYIN 93

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
              T           + + ++G ++         +G    E  +   +            
Sbjct: 94  PDVT------TTFENDCVRILGVNSVNPLQ--LKDGKLSHETLNRIKRYF---KPDDEKL 142

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            ++  H        L+  +   Q     +      L+  GH H   L  I        + 
Sbjct: 143 NLLFFHHNFDYMEGLHKPLANAQTLLSFLKQSTIHLVCTGHLHYAHLSLIAKNNGYSCLA 202

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKN--EYWTLEGKRY 286
             A +     S     SY +    +K     W +  + +
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIEANQKKCRITWRVFDQEH 241


>gi|257483054|ref|ZP_05637095.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|331011712|gb|EGH91768.1| Ser/Thr protein phosphatase family protein [Pseudomonas syringae
           pv. tabaci ATCC 11528]
          Length = 277

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 49/272 (18%), Positives = 85/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           F++A ISD+HL                            +       +  I       D 
Sbjct: 5   FLIAQISDLHLKADGRLT----------------YGVVDTLGALRRAVEHINASKQRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V I+GD+V+F    E       L  +  P    +VPGNHD   +     +   +      
Sbjct: 49  VVISGDLVDFGREDEYAVLKPELERLHMP--FYLVPGNHDDRHNLLAAFAEQVYLP---- 102

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++  +  + LIG  T   T P    G     Q       L  + +   
Sbjct: 103 ----LSASGPLDWVVEKYPVRLIGMDT---TIPGEHGGRLDYGQLDWLHAQL--SRRPYV 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I++HHPP +      +R         +++I      + +L GH H            
Sbjct: 154 PTVIILHHPPFITGIGHMDREPFGNASALERVIAQHPQVERLLCGHLHRPMQRRFGGSVA 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            I        S ++  +  +A+   F +E   
Sbjct: 214 SI----CPGTSHQIVLDLDEAAPAHFNLEPAG 241


>gi|307544303|ref|YP_003896782.1| phosphohydrolase Icc [Halomonas elongata DSM 2581]
 gi|307216327|emb|CBV41597.1| K03651 Icc protein [Halomonas elongata DSM 2581]
          Length = 262

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/290 (15%), Positives = 82/290 (28%), Gaps = 58/290 (20%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             L  I+D HL   P+    +                         ++ +      D V 
Sbjct: 20  MRLIQITDCHLHADPAARSRTGV----------------PHRQFVRVVEEAASWRPDMVL 63

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+           +   L  +      S +PGNHD     A+ +             
Sbjct: 64  VTGDVSQDETAASYALAERELARLD--CPWSWLPGNHDEPARMAECR------------- 108

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                   F          L+   T +   P   +G  G  +  A ++ L +        
Sbjct: 109 -------PFDESVDLGQRRLLLLDTQV---PGQTHGALGAARLEALAERLAE---DERPT 155

Query: 190 IIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLI 246
           ++ MHHPPV   S       +   + F +++      + IL GH H             +
Sbjct: 156 LVAMHHPPVSVGSRWVDALGLVDAEAFWEVLATHERVEAILCGHIHQAFECRRATPHGEV 215

Query: 247 PVVGIASASQKVHSNKPQ--------ASYNLFYIEKKNEYWTLEGKRYTL 288
            +    + S +                 + +F +    +  +   +R  L
Sbjct: 216 AIYACPATSDQFLPGAETFAVDAAALPGFRVFDL---GDALSTRVERVAL 262


>gi|148979397|ref|ZP_01815503.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Vibrionales
           bacterium SWAT-3]
 gi|145961833|gb|EDK27126.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Vibrionales
           bacterium SWAT-3]
          Length = 274

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/299 (12%), Positives = 88/299 (29%), Gaps = 48/299 (16%)

Query: 2   TKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL 61
           T ++      L  ++D HL    +   L                   +++    +++ I+
Sbjct: 6   TSKFDESSIKLVQLTDTHLFAPSNGSLL----------------SINTQDSFRAVVDGIV 49

Query: 62  LHNVD--HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
               D   +  TGDI               ++ +  P     +PGNHD   +        
Sbjct: 50  SQGFDYQAILATGDISQDHSAESYQKFESGIQPLEKPC--YWLPGNHDFKPNM------- 100

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
                       S   +   ++ +     +I   + +   P    G    +Q     + L
Sbjct: 101 -------GSVLPSPQIQCVEHVLLDERWQMIMLDSQVVGVPH---GRLSDQQLDLLEQKL 150

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHW 238
            +  ++    ++  H   V       + +    +F  ++        +L GH H +    
Sbjct: 151 TEFPERNTLVLLHHHPLLVGSAWLDQHNLKDADQFWDVVQQHSNVKAVLCGHVHQDMNRE 210

Query: 239 IKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
                  + V+   S   +   N        F ++  +  W  E + +     S  +++
Sbjct: 211 HHG----VQVMATPSTCVQFKPNSDD-----FAVDTLSPGWR-EIELHQDGTVSTQVRR 259


>gi|116494403|ref|YP_806137.1| phosphohydrolase [Lactobacillus casei ATCC 334]
 gi|116104553|gb|ABJ69695.1| Predicted phosphohydrolase [Lactobacillus casei ATCC 334]
          Length = 442

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/314 (14%), Positives = 89/314 (28%), Gaps = 36/314 (11%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           +SD H        E +    I        +   +     N L+ + L      + ITGD+
Sbjct: 42  LSDTHFIAPSLHDEKTAYTQIKRSAA--GKDMDYQPVAINALVQNALKARPTALVITGDV 99

Query: 75  VNFTCNREIF-TSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCST 133
                              + N   + I+PGNHD Y      ++    +  +T   + S 
Sbjct: 100 TFNGEKASAESIMRRLQPLVANGTKVLIIPGNHDIY--DGWARAYKGKRQLLTEQISPSD 157

Query: 134 GKKLFPYLRI----------------RNNIALIGCSTAIAT-----PPFSANGYFGQEQA 172
            + +F                       N  L+   + I T      P +  G    +  
Sbjct: 158 WRNIFHTSYEQAVAQDPNSLSYRVNLNRNYQLLMLDSNIYTIEPSNRPPNTGGKLTPQTM 217

Query: 173 HATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGH 230
               + L    K     I+ MHH       +      +    + + ++      L+  GH
Sbjct: 218 KWVRQQLAAGQKAHRKSIVFMHHNLYAHNEAVNQGFVLDNSDQLKPLLKAYHVLLLFSGH 277

Query: 231 THLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSP 290
            H   +    + +     V   + S         ASY +         +         +P
Sbjct: 278 IHAQDISRDPDGQCPTIEVVSGAFSIS------PASYGVVTFAPNRITYQKHAT--DPTP 329

Query: 291 DSLSIQKDYSDIFY 304
              + Q+   D+ +
Sbjct: 330 YLTAKQRKNPDLLH 343


>gi|257386190|ref|YP_003175963.1| metallophosphoesterase [Halomicrobium mukohataei DSM 12286]
 gi|257168497|gb|ACV46256.1| metallophosphoesterase [Halomicrobium mukohataei DSM 12286]
          Length = 312

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/289 (15%), Positives = 74/289 (25%), Gaps = 49/289 (16%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
                  A ++D H+S   S                  +    + +     + DI   +V
Sbjct: 18  RGDHTRFAVLADPHVSTRESGTS---------------KLFEHTLDHLEAAVADIGRRDV 62

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D V   GD+               L  +  P     VPGNHD        K         
Sbjct: 63  DAVLSPGDLTKDGEPWNYDAVDEALSELDVP--FYAVPGNHDVP------KVRDEHDPLS 114

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFS--ANGYFGQEQAHATSKLLRKAN 183
                   G    PY      + +IG +TA           G   +       + L +A 
Sbjct: 115 VEAFADRYGPGELPYHAEVGGLDVIGLNTAGTADRLYESHEGRVTEATLDWLDETLAEAE 174

Query: 184 KKGFFRIIMMH-----------HPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
                 +++ H           H  +         M       + +   GA L+L GH H
Sbjct: 175 ---TPVVLLHHNLPSVSDQIDAHREIEPEMVEIPAMADADPLAETLADGGAQLLLSGHYH 231

Query: 233 LNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
           L +          +  +   +            SY L     +     L
Sbjct: 232 LPATGEYHG----LREIAAPTTCSFPQ------SYLLCETTPEGTTVRL 270


>gi|326386012|ref|ZP_08207636.1| metallophosphoesterase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209237|gb|EGD60030.1| metallophosphoesterase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 253

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 51/281 (18%), Positives = 87/281 (30%), Gaps = 41/281 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L HISD+H                              +     L+  +     + V
Sbjct: 1   MIRLFHISDLHFGLE-------------------------DRRALEWLVGLVRAERPEGV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD       RE   +  W+  +G P  +++ PGNHD       E+ +  ++ +   +
Sbjct: 36  VITGDFTMRARPREFAAAAQWIGELGVP--VTLDPGNHDLPYFNPVERFVDPYRRFRALE 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKG 186
                             +AL+   T          + G  G   A A +     A  K 
Sbjct: 94  AGLGA-------KLDLPGLALVRLPTTARAQWRLNWSKGCVGAA-ALARTLATLDALPKD 145

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
              I+  HHP V   +       G +R    +       +L GH H       +     I
Sbjct: 146 TPAIVTCHHPLVEAGTRGQALTRGGERALAELARRQVLAVLSGHVHDAFDLVRETAHGPI 205

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
            ++G  + SQ++ +  P   +N   +           +R  
Sbjct: 206 RMIGAGTLSQRLRTTPPT--FNELVLAD--GQLECRPRRLD 242


>gi|148271664|ref|YP_001221225.1| putative 3',5'-cyclic-nucleotide phosphodiesterase [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
 gi|147829594|emb|CAN00509.1| putative 3',5'-cyclic-nucleotide phosphodiesterase [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
          Length = 301

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 38/301 (12%), Positives = 83/301 (27%), Gaps = 36/301 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHV 68
             L H+SD HL       +                    +      ++ +      V  +
Sbjct: 9   LRLVHLSDTHLLRDGGLHQ----------------GVVDTGAALERVLVEADRVPEVRLL 52

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYIT 126
             +GD+               L    +     + + PGNHD   +              T
Sbjct: 53  VGSGDLSEDGTAESYALLRERLVPWTSSRGAALVLTPGNHDVRSAFRLVLGDGHGAPG-T 111

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D            + I +   +    T++   P    G   ++Q     +LL    + G
Sbjct: 112 DDGRDPAAVPPVDGVTIVDGWRIATLDTSV---PGKGYGALREQQLDGLRELLATPAEHG 168

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
              ++     P   T      + G +R  +++      +IL GH H + +  +      +
Sbjct: 169 TVLVLHHPPVPAPTTLHESLALQGPERLAEIVRGSDVRVILSGHYHHHIVGSLAG----V 224

Query: 247 PVVGIA--------SASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD 298
           PV+           +A          + + +  +       ++  + +    D   +   
Sbjct: 225 PVLVAPGVANETDVAAEPGTERIVRGSGFLVVDVRPDGRVTSVVVRAHA-EDDGDEVALL 283

Query: 299 Y 299
            
Sbjct: 284 D 284


>gi|239814268|ref|YP_002943178.1| metallophosphoesterase [Variovorax paradoxus S110]
 gi|239800845|gb|ACS17912.1| metallophosphoesterase [Variovorax paradoxus S110]
          Length = 286

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/255 (16%), Positives = 75/255 (29%), Gaps = 43/255 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVS 69
           L  ++D+H+                         +  +       +  +L      D V 
Sbjct: 12  LVQLTDLHIREPGRLA----------------YGRIDTAPYLERAVQSVLRLPQQPDAVV 55

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+ +F    E       L  +  P  + ++PGNHD          L           
Sbjct: 56  ITGDLSDFGRAAEYEHLARLLAPLTMP--VYLMPGNHDERGQ------LRRSFPGHAYLA 107

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                     Y      + L+   T +   P +++G    E+     + L     +G   
Sbjct: 108 AGVGSAGFVQYSVRVGALRLLTLDTCV---PGASHGELCSERLAWLEEQLDAC--RGEPV 162

Query: 190 IIMMHHPPVLDTSSLYNRM---FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
           +I MHHPP        + +    G +  + ++      + ++ GH H             
Sbjct: 163 VIAMHHPPFRTLIGHMDEIGLLQGAEALEALVARHRNVERVICGHLHRAIDVRFGG---- 218

Query: 246 IPVVGIASASQKVHS 260
                IAS S     
Sbjct: 219 ----SIASTSPAPAH 229


>gi|22298313|ref|NP_681560.1| 3',5'-cyclic-nucleotide phosphodiesterase [Thermosynechococcus
           elongatus BP-1]
 gi|22294492|dbj|BAC08322.1| 3',5'-cyclic-nucleotide phosphodiesterase [Thermosynechococcus
           elongatus BP-1]
          Length = 261

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/292 (13%), Positives = 72/292 (24%), Gaps = 51/292 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           L  +SD+HL  +     L                          ++     H+ + V +T
Sbjct: 7   LIQLSDLHLFATDEGRLLGLPTAQS----------------LAAVLEATRRHSPNAVLLT 50

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+                R       +  +PGNHD   +                    
Sbjct: 51  GDLAQEPITPTYERLATAFRDFS--CPVYWIPGNHDEPRAMV---------------PAL 93

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
                             +  S+ +        G    E        L     +  F  I
Sbjct: 94  ERPPLRGDRQIHLGTWQGLLLSSQVEGKVH---GELSPETLSWLEATLSHTGDRPTF--I 148

Query: 192 MMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPV 248
            +HHPP    +   +       +    ++       L+L GH H   +   +     +  
Sbjct: 149 ALHHPPFETGAPWLDSSRLQNPEDLFAVLDSHPQVKLVLFGHIHQELMTERQG----VMY 204

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
           +G  S   +     P+     F +E     +      Y        I++   
Sbjct: 205 LGCPSTCIQFLPRAPE-----FSLEPVGPGFR-HLSLYPNGTFKTHIERVEI 250


>gi|217978481|ref|YP_002362628.1| metallophosphoesterase [Methylocella silvestris BL2]
 gi|217503857|gb|ACK51266.1| metallophosphoesterase [Methylocella silvestris BL2]
          Length = 278

 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 83/279 (29%), Gaps = 41/279 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            L H+SD H          +       +                           D   +
Sbjct: 9   RLVHLSDPHFGTENGDAVEAAAAAARAL-------------------------RPDLTIV 43

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+     ++E   +  WL S+  P    + PGNHD  +    ++    +  Y      
Sbjct: 44  SGDLTAEGRSQEFSAARDWLASL--PQPQIVTPGNHDTPVWNLPQRLFWPFGRYRAYVGQ 101

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            +    L         + +   +TA    P       G     A  +  ++         
Sbjct: 102 PAAAGFL-------PGLTVRSLNTARGVQPRFDWSK-GSIDLDAVRQAAKEMTVATKALK 153

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQK--MIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           + + H P+++ ++        +      ++  +  DLIL GH H      +         
Sbjct: 154 VFVCHHPLVEMTNAAVSGGVHRGLAAARLLAEQNIDLILSGHVHNPFSLALPWGDGKTYA 213

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
           VG  + SQ+       A +    IE   +   +  + +T
Sbjct: 214 VGAGTLSQRTR--GTPACF--LTIEAGPDTIRVAVQEWT 248


>gi|330960112|gb|EGH60372.1| Ser/Thr protein phosphatase [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 268

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/297 (13%), Positives = 76/297 (25%), Gaps = 54/297 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   +++    ++  +L      D V 
Sbjct: 12  LVQLSDSHLFAEAEGALLGMS----------------TRDSLEQVVERVLAEQPKVDLVV 55

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            +GDI                  I  P       GNHD                      
Sbjct: 56  ASGDISQDGSVESYEAFRRISAQIVAPARWFA--GNHDELPQM----------------E 97

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             + G+ L   +       +    +A+   P S  G+   EQ     + L +A  +    
Sbjct: 98  HVAQGEGLLDPVVDIGQWRVTLLDSAV---PGSVPGFLANEQLQLLERSLSEAPDRH--H 152

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HH PV         +          ++        +L GH H             +
Sbjct: 153 LVCLHHHPVAIGCEWMAPIGLRNADALFAVLDRFPQVKAVLWGHVHQEFDQVRNG----V 208

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            ++   S   +            F ++     +    + +        + +    +F
Sbjct: 209 RLLASPSTCIQFAPGSVD-----FKVDNSAPGYR-WLRLHDDGRLKTGVSRVEGMLF 259


>gi|94986520|ref|YP_594453.1| phosphodiesterase [Lawsonia intracellularis PHE/MN1-00]
 gi|94730769|emb|CAJ54131.1| phosphodiesterase [Lawsonia intracellularis PHE/MN1-00]
          Length = 267

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 42/257 (16%), Positives = 74/257 (28%), Gaps = 48/257 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD-- 66
           +    HISD H+S        +  R+                      I++I   ++D  
Sbjct: 4   IIKFIHISDTHISAQGCLVYDNNPRV-----------------KLQTCIDEIKRDHLDAA 46

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            + +TGD+ N             L  +  P    +V GNHD      K+    A  +Y  
Sbjct: 47  FLILTGDVTNDGSMECFSFLQEVLSEL--PMPWYLVMGNHD-----LKQSLFTAIPEYPR 99

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                        +         I   T IA     ++G     +    +  L++A    
Sbjct: 100 D------PNGFVQFTVDTPVGLCIILDTTIANQ---SSGILCAARLDWLANELKQA---T 147

Query: 187 FFRIIMMHHPPVLDTSSLY----NRMFGIQRFQKMIWHE--GADLILHGHTHLNSLHWIK 240
              ++  HHPP            + +   + F  ++         +  GH H        
Sbjct: 148 KPVLLFFHHPPFSLGIPSMDAIVHSLKNSEEFFAVLKPYKDKIRHMFVGHIHRPICGSWN 207

Query: 241 NEKKLIPVVGIASASQK 257
                IP     S + +
Sbjct: 208 G----IPFSCAPSTAHQ 220


>gi|239631150|ref|ZP_04674181.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|239525615|gb|EEQ64616.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
          Length = 423

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 47/314 (14%), Positives = 89/314 (28%), Gaps = 36/314 (11%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           +SD H        E +    I        +   +     N L+ + L      + ITGD+
Sbjct: 23  LSDTHFIAPSLHDEKTAYTQIKRSAA--GKDMDYQPVAINALVQNALKARPTALVITGDV 80

Query: 75  VNFTCNREIF-TSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCST 133
                              + N   + I+PGNHD Y      ++    +  +T   + S 
Sbjct: 81  TFNGEKASAESIMRRLQPLVANGTKVLIIPGNHDIY--DGWARAYKGKRQLLTEQISPSD 138

Query: 134 GKKLFPYLRI----------------RNNIALIGCSTAIAT-----PPFSANGYFGQEQA 172
            + +F                       N  L+   + I T      P +  G    +  
Sbjct: 139 WRNIFHTSYEQAVAQDPNSLSYRVNLNRNYQLLMLDSNIYTIEPSNRPPNTGGKLTPQTM 198

Query: 173 HATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGH 230
               + L    K     I+ MHH       +      +    + + ++      L+  GH
Sbjct: 199 KWVRQQLAAGQKAHRKSIVFMHHNLYAHNEAVNQGFVLDNSDQLKTLLKAYHVPLLFSGH 258

Query: 231 THLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSP 290
            H   +    + +     V   + S         ASY +         +         +P
Sbjct: 259 IHAQDISRDPDGQCPTIEVVSGAFSIS------PASYGVVTFTPNRITYQKHAT--DPTP 310

Query: 291 DSLSIQKDYSDIFY 304
              + Q+   D+ +
Sbjct: 311 YLTAKQRKNPDLLH 324


>gi|283787163|ref|YP_003367028.1| phosphoesterase [Citrobacter rodentium ICC168]
 gi|282950617|emb|CBG90289.1| putative phosphoesterase [Citrobacter rodentium ICC168]
          Length = 275

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/294 (11%), Positives = 73/294 (24%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V   +         D +  
Sbjct: 16  RILQITDTHLFAEKHETLLGVNTWESY------------QAVLEAI--HADGQEYDLIVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               + S   P     +PGNHD   +                   
Sbjct: 62  TGDLAQDQTAAAYQHFAEGIASFRAPC--VWLPGNHDFQPAM--------------YSAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      +    +  ++   + +   P    G   + Q       L  A ++    +
Sbjct: 106 QEAGISPAKCVMAGEHWQILLLDSQVFGVPH---GELSEFQLEWLENKLAAAPERYTLLL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   +    + +        ++ +      +L GH H +             ++
Sbjct: 163 LHHHPMPAGCSWLDQHSLRNAAELDSVLANYPRVTHLLCGHIHQDLDVDWNGR----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++  +  W    + +        I +   D F
Sbjct: 219 ATPSTCVQFKPHCAN-----FTLDTISPGWR-TLELFADGTLQTDICRLQGDAF 266


>gi|332289537|ref|YP_004420389.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Gallibacterium anatis UMN179]
 gi|330432433|gb|AEC17492.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Gallibacterium anatis UMN179]
          Length = 275

 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/301 (13%), Positives = 85/301 (28%), Gaps = 46/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           +  +  L  ++D HL        L                   + +    ++++I     
Sbjct: 9   SAGVIKLLQVTDPHLFADEDGELLG----------------INTFDSFRQVLSEIKKSGF 52

Query: 66  D--HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
           +  ++  TGD V              +  +G    I  +PGNHD          L+    
Sbjct: 53  ESNYILATGDFVQDNSEAGYHRFVKEIVQLGK--KIFWIPGNHDFQPKMEAVFDLYK--- 107

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                       +   +L +  +  +I   + +   P    G   +E+     + L    
Sbjct: 108 ---------AVIQPEKHLLLGESWQVILLDSQLYGVPH---GMLSEEELKWLEQRLSLYP 155

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
            +    ++  H  P        + +     F +++        I++GH H       +  
Sbjct: 156 DRNTLIVLHHHLLPTNSAWLDQHNLRNPYDFSEILAKHKNIKAIVYGHIHQEVNAVWQG- 214

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
              IPV    S   +   +        F ++     W  E   Y        + +    +
Sbjct: 215 ---IPVFATPSTCIQFKPDC-----AYFTLDNLQPGWR-EISLYPDGRLETKVHRIKDKV 265

Query: 303 F 303
           F
Sbjct: 266 F 266


>gi|308178618|ref|YP_003918024.1| phosphoesterase [Arthrobacter arilaitensis Re117]
 gi|307746081|emb|CBT77053.1| putative phosphoesterase [Arthrobacter arilaitensis Re117]
          Length = 276

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/270 (17%), Positives = 86/270 (31%), Gaps = 45/270 (16%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +  +SD HL                            + ++             D V 
Sbjct: 4   LTVVQVSDTHLCPEGQLLH----------------GSIDTWQLTEQAFEAAASFAPDAVV 47

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGN-PHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +TGD+ +         +  + ++  +    +  +PGNHD   + A+            + 
Sbjct: 48  VTGDVSDRGAKIHRRAAQIFNQAQQDLGCPVITIPGNHDPLGAIAES----------FNT 97

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              STG      +     + +IG  T        A G   +EQ    + LL     +G F
Sbjct: 98  KRLSTGPYPADTVHEVMGLRIIGLDT---GGFQQAQGQLNREQLDWLASLLTVPAPRGTF 154

Query: 189 RIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
             +++HHPPV  TS                +       +IL GH H  +   + N     
Sbjct: 155 --LLLHHPPVEATSQARAGRGLHNPMELAAITAGSDIRMILSGHYHQMATSQLMN----T 208

Query: 247 PVVGIASASQKVHS-------NKPQASYNL 269
           PV    + S  ++        ++P A++ +
Sbjct: 209 PVFMAPAVSYNMNPFAPTQILDEPGAAFAV 238


>gi|120612111|ref|YP_971789.1| metallophosphoesterase [Acidovorax citrulli AAC00-1]
 gi|120590575|gb|ABM34015.1| metallophosphoesterase [Acidovorax citrulli AAC00-1]
          Length = 285

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 74/234 (31%), Gaps = 34/234 (14%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           L  +SD+H+            R  G + +       + ++    ++        D +  T
Sbjct: 15  LLQLSDLHI------------REPGRLAYGRLDTAPYLRQAVETVLRMP--QRPDAIVAT 60

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+ +F    E       L  +G    + ++PGNHD            A           
Sbjct: 61  GDLTDFGRPEEYGHLRKLLAPLGA-IPLYLLPGNHDDR----------AQLRASFPGHGY 109

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
                   +      + LI   T +   P ++ G    E+    +  L     +G   +I
Sbjct: 110 LGTDGFVQFSVSVGGLQLIALDTVV---PGASEGSLCAERLEWLAAQLD--ASRGRPVVI 164

Query: 192 MMHHPPVLDTSSLYNRM---FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
            MHHPP        + +    G Q  + ++      + ++ GH H +       
Sbjct: 165 AMHHPPFRTLIGHMDEIGLLEGAQALEALVARHPNVERVICGHLHRSIQVRFGG 218


>gi|209516621|ref|ZP_03265474.1| metallophosphoesterase [Burkholderia sp. H160]
 gi|209502896|gb|EEA02899.1| metallophosphoesterase [Burkholderia sp. H160]
          Length = 274

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/240 (17%), Positives = 75/240 (31%), Gaps = 40/240 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  LA ISD+H+                        +   +       +  +       D
Sbjct: 1   ML-LAQISDLHIKQPGVLA----------------YRLVDTAAYLTRCVAALNALVPRPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V I+GD+V+    ++       L  +  P+   ++ GNHD            A +    
Sbjct: 44  AVLISGDLVDQGDPQQYAHLKTLLAQLAIPY--FLMVGNHDER---------KALRAAFP 92

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
             T   +G +   Y      + LI   T I   P  + G     +    ++ L  A  +G
Sbjct: 93  ERTELQSGGEFVQYAFDVGPLRLIALDTLI---PGESGGMLCDTRLAWLAQQLDAA--RG 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGI----QRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              ++ +HHPP        + +        +   +I      + +L GH H +       
Sbjct: 148 KPVVVALHHPPFACGIGHMDEIRLDQAASDKLAALIAQHPNVERVLCGHVHRSMFVRFGG 207


>gi|296107559|ref|YP_003619260.1| 3',5'-cyclic-nucleotide phosphodiesterase [Legionella pneumophila
           2300/99 Alcoy]
 gi|295649461|gb|ADG25308.1| 3',5'-cyclic-nucleotide phosphodiesterase [Legionella pneumophila
           2300/99 Alcoy]
          Length = 270

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 78/279 (27%), Gaps = 40/279 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISD+H                                V N  + +  L   D + 
Sbjct: 1   MKIIHISDLHFGK-------------------------HQPAVLNAFLQETALDKPDIIL 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+     + +      ++  +  P     VPGNHD        + +  ++ Y     
Sbjct: 36  ISGDLTQRGLSYQYRELCSFINQL--PAQTLTVPGNHDIPFYNVPARFIFPFRHYKRYIN 93

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
           +  T           + + ++G ++         +G    E  +   +            
Sbjct: 94  SDVT------TTFENDCVRILGVNSVNPLQ--LKDGKLSHETLNRIERYF---KPDDEKL 142

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            ++  H        L+  +   Q     +      L+  GH H   L  I        + 
Sbjct: 143 NLLFFHHNFDYMEGLHKPLANAQTLLSFLKQSTIHLVCTGHLHYAHLSLIAKNNGYSCLA 202

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKN--EYWTLEGKRY 286
             A +     S     SY +    +K     W +  + +
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIEANQKKCRITWRVFDQEH 241


>gi|266619537|ref|ZP_06112472.1| serine/threonine protein phosphatase family protein [Clostridium
           hathewayi DSM 13479]
 gi|288868889|gb|EFD01188.1| serine/threonine protein phosphatase family protein [Clostridium
           hathewayi DSM 13479]
          Length = 481

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/291 (13%), Positives = 77/291 (26%), Gaps = 27/291 (9%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +   SDIH                  V     +   +  E+ +  I  +   + D V +
Sbjct: 80  RILLASDIHY--LSRGLTDFGDGFKYKVEHGDGKVVNYIWEITDAFIEAVKKEDPDLVIL 137

Query: 71  TGDIV-NFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYIS--------------GAKE 115
           +GD+  N   +  +  +            + ++PGNHD   +                  
Sbjct: 138 SGDLTLNGERDSHLDFAKKLKEIEDAGIHVIVIPGNHDINNTAAAQFTGAQALGTAHIGP 197

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNI-ALIGCSTAIATPPFSANGYFGQEQAHA 174
                       D   S       Y+   ++    +   T    P     G   +E    
Sbjct: 198 DDFAEIYRDFGYDEAVSRDTASLSYVYQIDDYNRALMLDTCQYEPYNQVGGMIQEETYDW 257

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEGADLILHGHTH 232
               +  A   G   I + HH  + ++        +   ++    +      L L GH H
Sbjct: 258 IENQMEDAWDLGMNVIPVGHHNLLDESEVYVEDCTIEHSEQLIDQLDSWDVPLFLSGHLH 317

Query: 233 LNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
           +        +  +  +V  + A+       P   Y +        +     
Sbjct: 318 VQHFMREDEDYGIYEIVTSSLAT-------PPCQYGMLDYGDDGSFQYHTV 361


>gi|288871144|ref|ZP_06410033.1| serine/threonine protein phosphatase family protein [Clostridium
           hathewayi DSM 13479]
 gi|288864633|gb|EFC96931.1| serine/threonine protein phosphatase family protein [Clostridium
           hathewayi DSM 13479]
          Length = 457

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/304 (12%), Positives = 87/304 (28%), Gaps = 38/304 (12%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
            T  F +   +D+H               + +      +   ++ E+ +  + D+     
Sbjct: 55  ETSSFTIVTATDLHYLSPE--LTDYGTGFMRMAANGDGKLVQYAPEIVDAFVTDMAKLRP 112

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIG-NPHDISIVPGNHDAYISGA----------- 113
           D V ++GD+               L  +      + ++PGNHD     A           
Sbjct: 113 DAVILSGDLSFNGEKASHEELAEKLSCLQEQGIPVLVLPGNHDISYPFAASFEAETVTRT 172

Query: 114 ----KEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQ 169
                 +    +K     D   + G  L    ++   + ++         P    G    
Sbjct: 173 ERVNGVEFRDLYKQLGYRDAAETDGDSLSFLYQLSERVWILLLDANTEDAP----GRIKD 228

Query: 170 EQAHATSKLLRKANKKGFFRIIMMHHPPVLDTS--SLYNRMFGIQRFQKMIWHEGADLIL 227
                  + + +A + G   I + H   +      S    +   +  ++++   G  L +
Sbjct: 229 STLQWAERQMERAEEAGAAVITVTHQNVLAQNKLLSRGFLLDNHEELERLLKGHGVVLNV 288

Query: 228 HGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN----EYWTLEG 283
            GH H+  +     E   +  +   S +           Y +  +        E   +  
Sbjct: 289 SGHVHIQHIA----ENGGLYDIATGSLTVA------PNRYGVLTVGSDGSTSYETRKVHV 338

Query: 284 KRYT 287
            R+ 
Sbjct: 339 GRWD 342


>gi|187924629|ref|YP_001896271.1| metallophosphoesterase [Burkholderia phytofirmans PsJN]
 gi|187715823|gb|ACD17047.1| metallophosphoesterase [Burkholderia phytofirmans PsJN]
          Length = 275

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/240 (15%), Positives = 74/240 (30%), Gaps = 40/240 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  LA ISD+H+    +                   ++  +       +  +       D
Sbjct: 1   ML-LAQISDLHIKRPGALA----------------YRRVDTGAYLARCVAALNALEPRPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+V+     +       L  +  P+   ++ GNHD            A +    
Sbjct: 44  AVIMTGDLVDQGDPEQYEHLKTLLAPLEIPY--FMLVGNHDERA---------ALRAAFP 92

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                 +G +   Y      + +I   + +   P  + G     +    +  L  A  +G
Sbjct: 93  DRKELQSGGEFVQYAVDVGPLRVIALDSMV---PGQSAGDLCDARLAWLATQLDAA--QG 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              ++ +HHPP +      + +        +   +I      + ++ GH H         
Sbjct: 148 KPTVVALHHPPFVCGIGHMDELRLDPAAANKLAALIACYPNVERVICGHVHRPMFVRFGG 207


>gi|323526673|ref|YP_004228826.1| metallophosphoesterase [Burkholderia sp. CCGE1001]
 gi|323383675|gb|ADX55766.1| metallophosphoesterase [Burkholderia sp. CCGE1001]
          Length = 275

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/240 (15%), Positives = 73/240 (30%), Gaps = 40/240 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  LA ISD+H+    +                   ++  +       +  +       D
Sbjct: 1   ML-LAQISDLHIKRPGALA----------------YRRVDTAAYLERCVAALNALDPRPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+V+    ++       L  +  P+   ++ GNHD            A +    
Sbjct: 44  AVIMTGDLVDQGEPQQYEHLKALLAPLEIPY--FLLVGNHDDRA---------ALRAAFP 92

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                  G     Y      + LI   + +   P  + G     +    +  L  A   G
Sbjct: 93  DRAELHGGGDFVHYALDVGPLRLIALDSMV---PGHSAGTLCVARLAWLAAQLDAAG--G 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGI----QRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              ++ +HHPP        +++       +R   +I      + ++ GH H         
Sbjct: 148 KPTVVALHHPPFACGIGHMDKLRLDPTAAERLAALIARYPNVERVICGHVHRPMFVRFGG 207


>gi|149201294|ref|ZP_01878269.1| metallophosphoesterase [Roseovarius sp. TM1035]
 gi|149145627|gb|EDM33653.1| metallophosphoesterase [Roseovarius sp. TM1035]
          Length = 265

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 50/298 (16%), Positives = 85/298 (28%), Gaps = 48/298 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV-DH 67
           M    H+SD+H+               G +           +E  + L   +      D 
Sbjct: 1   MARFLHLSDLHVVPE------------GQLVSGRLDTGRLLQEAVDTLRTRLDAIGPVDA 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           + +TGD+           +   L  +G  H + +VPGNHD                   S
Sbjct: 49  ILVTGDLSEDGSAESYAIARRELERLG--HRLLVVPGNHDGR----------ETFRAAFS 96

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D        L  ++    +  +IG  T I     +  G    E      + L +    G 
Sbjct: 97  DLPEIRPTGLIDWVADIADTRVIGLDTLIEG---NGGGILRAESLAFLDQALAETG--GR 151

Query: 188 FRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADL-ILHGHTHLNSLHWIKNEKK 244
             ++ +HHPP+       + +        + ++    A + +L GH H            
Sbjct: 152 QVVVALHHPPLRTGIRFMDAIGLENPDALRLVLERHQAPIWVLSGHVH----GVYHGLLG 207

Query: 245 LIPVVGIASASQKVHSNKP----------QASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
             PVV   S       +                 L         WT    R+   P +
Sbjct: 208 RHPVVTAPSCCSAFALDLRQEAPVGFMTGPTGCGLID-TGPGGVWTELPLRHGDGPFA 264


>gi|254259580|ref|ZP_04950634.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1710a]
 gi|254218269|gb|EET07653.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1710a]
          Length = 275

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 74/240 (30%), Gaps = 40/240 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M +LAHISD+H+    +                   ++  +       +  +       D
Sbjct: 1   MMLLAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNALEPRPD 44

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +            
Sbjct: 45  AVLVTGDLTDFGDDDEYAHLKALLAPLAMPY--YLLVGNHDDRAAMRRAFPAR------- 95

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    +   Y      + +I   + I   P ++ G     +    +  L  A  + 
Sbjct: 96  ---VELQSGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDR- 148

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              I+ +HHPP        + M        R   ++      + +L GH H         
Sbjct: 149 -PVIVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGG 207


>gi|262375894|ref|ZP_06069125.1| phosphohydrolase [Acinetobacter lwoffii SH145]
 gi|262308988|gb|EEY90120.1| phosphohydrolase [Acinetobacter lwoffii SH145]
          Length = 258

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/272 (15%), Positives = 78/272 (28%), Gaps = 47/272 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           + H+SD+H                               E    + +    H ++ V I+
Sbjct: 2   ILHLSDLHFGTEK-------------------------PECLEAIRHFCQTHPLEAVVIS 36

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+       + F    +L  +  P+ +  +PGNHD  +     +  + +  Y       
Sbjct: 37  GDLTQRARLGQFFACKKFLDQLNTPYMV--IPGNHDIPLYHLWNRLFNPFTRYQIFFGEL 94

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
                    +    N  LIG ++      +   G+   EQ       L +A       I+
Sbjct: 95  EP-------IFETENFYLIGVNSIR--RRYHTKGHLSLEQIQRIDLQLAQAPASKLKIIV 145

Query: 192 MMHHPPVLDTSSLYNRMFGIQRF----QKMIWHEGADLILHGHTHLNSLHWIK-----NE 242
              H P                      +     G   +LHGH H  +++ +        
Sbjct: 146 --SHQPFYVPFQNKRGFKDSPLMAKIALEAWAEHGLFAVLHGHLHQPAIYDLNQMFGLGM 203

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEK 274
              +  V   +++          S+NL     
Sbjct: 204 DHPVYDVHAGTSASNRLHKNEPNSFNLIDATG 235


>gi|304310606|ref|YP_003810204.1| predicted metallophosphoesterase [gamma proteobacterium HdN1]
 gi|301796339|emb|CBL44547.1| predicted metallophosphoesterase [gamma proteobacterium HdN1]
          Length = 278

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/283 (13%), Positives = 77/283 (27%), Gaps = 55/283 (19%)

Query: 7   TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-- 64
           T +  +  +SD HL                  +         ++     +++ +      
Sbjct: 17  TAVLRILQLSDSHL----------------FASEQGKLLGLNTEYSLCKVLDLVDQEQSA 60

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            D V  TGD+               ++    P  +  + GNHD Y +  K ++       
Sbjct: 61  PDLVLATGDLSQDHSVASYLRFHDHMQRFKAP--VYWLQGNHDLYDAMKKGEAAERIG-- 116

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
                         P +    +  ++   ++I   P    G F           L +A  
Sbjct: 117 --------------PCVIDLASWRIVLLDSSI---PRKVPGRFSPSALEFLRTALAEAQD 159

Query: 185 KGFFRIIMMHHPPVLDTSSLY--NRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKN 241
           +    ++ +HH PV   S       +     F   I        ++ GH H       + 
Sbjct: 160 RH--LLVALHHQPVKVGSPWLDVQMVGNADEFWAEIDRSKQVRAVIWGHVHQ----VFET 213

Query: 242 EKKLIPVVGIASASQKVHSNK-------PQASYNLFYIEKKNE 277
            +  + ++ + S   +   N            Y    +     
Sbjct: 214 MRNQVKLMSVPSTCVQFKPNSVDFAVDTENPGYRWLDLYPDGR 256


>gi|283836433|ref|ZP_06356174.1| 3',5'-cyclic-nucleotide phosphodiesterase [Citrobacter youngae ATCC
           29220]
 gi|291067807|gb|EFE05916.1| 3',5'-cyclic-nucleotide phosphodiesterase [Citrobacter youngae ATCC
           29220]
          Length = 275

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/297 (11%), Positives = 76/297 (25%), Gaps = 48/297 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHV 68
            +  I+D HL        L                          +++ I   +   D +
Sbjct: 16  RILQITDTHLFAEKHETLLGVNTWDSY----------------QSVLDAIHAESPEYDLI 59

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+               + S   P     +PGNHD   +                 
Sbjct: 60  VATGDLAQDQSAAAYQHFAEGIASFRAPC--VWLPGNHDFQPAM--------------YS 103

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G      + I     ++   + +   P    G   + Q     + L  A ++   
Sbjct: 104 ALQDAGISPAKRVFIGEQWQILLLDSQVFGVPH---GELSEFQLEWLERKLADAPERNTL 160

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  H  P   +    + +        ++ +      +L GH H               
Sbjct: 161 LLLHHHPLPAGCSWLDQHSLRNAAELDNVLVNYPRVKYLLCGHIHQELDLDWNGR----R 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           ++   S   +   +        F ++  +  W    + +        + +   + F+
Sbjct: 217 LLATPSTCVQFKPHCSN-----FTLDTISPGWR-TLELFADGTLQTQVCRLQGNRFH 267


>gi|195452712|ref|XP_002073467.1| GK14134 [Drosophila willistoni]
 gi|194169552|gb|EDW84453.1| GK14134 [Drosophila willistoni]
          Length = 674

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 47/339 (13%), Positives = 89/339 (26%), Gaps = 52/339 (15%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELS--------------PKRIIGLVNWHFNRKK 46
           M +R    +  +  ++DIH         L+                   G   W   R  
Sbjct: 207 MPERGDNDVL-ILQLTDIHYDPEYRVGGLADCEEPMCCRDALPAGAETTGAGFWSDYRNC 265

Query: 47  YFSKEVANLLINDI-LLHNVDHVSITGDI--------VNFTCNREIFTSTHWLRSIGNPH 97
              K +       I   H +D +  TGD+                +      L       
Sbjct: 266 DTPKTLIVNAFEHISKTHKLDWIYHTGDVPPHNIWSTTKQGNLDMLTEIDGLLTENFPNI 325

Query: 98  DISIVPGNHDAY----------------ISGAKEKSLHAWKDYITSDTTCSTGKKLFPYL 141
            +    GNH+ +                +          W  ++ +    +  +  +  +
Sbjct: 326 PVYSCLGNHEPHPTNVFVNENDIPAELNVDWLYSHVWSLWSKWLPASAEETVLRGGYYTV 385

Query: 142 RIRNNIALIGCSTAI---ATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPV 198
                  +I  ++            NG    EQ +     L +A + G    I+  H P 
Sbjct: 386 LPPTGPRIIALNSMDCYLFNWWLYYNGSLVMEQLNWLHDTLTEAERNGEKVHIL-THIPS 444

Query: 199 LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKV 258
            D          + R            I +GHTH + ++   +       V     S   
Sbjct: 445 GDGDCWTVYARELNRILARFNK-IITGIFNGHTHKDEMNVHYSTDNHAYAVSWNGGSLTT 503

Query: 259 HSNKPQASYNLFYIEK------KNEYWTLEGKRYTLSPD 291
           +S      Y L+ +         +  + +      L+PD
Sbjct: 504 YSYMNPN-YRLYELSGQTWQVLDHHTYIVNLTEANLNPD 541


>gi|319792049|ref|YP_004153689.1| metallophosphoesterase [Variovorax paradoxus EPS]
 gi|315594512|gb|ADU35578.1| metallophosphoesterase [Variovorax paradoxus EPS]
          Length = 285

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/236 (16%), Positives = 70/236 (29%), Gaps = 35/236 (14%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVS 69
           L  ++D+H+                         +  +       +  +L      D V 
Sbjct: 11  LVQLTDLHIREPGRLA----------------YGRIDTAPYLQQAVQSVLALPQQPDAVV 54

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+ +F    E       L  +  P  + ++PGNHD          L           
Sbjct: 55  ITGDLTDFGRAAEYEHLARLLAPLTMP--VYLMPGNHDDR------DQLRKSFPGHAYLG 106

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
           T         Y      + L+   T +   P +++G    ++       L     +G   
Sbjct: 107 TGDDTAGFIQYSVRVGALRLLTLDTCV---PGASHGTLCDKRLGWLEAQLDAC--RGEPV 161

Query: 190 IIMMHHPPVLDTSSLYNRM---FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
           ++ MHHPP        + +    G    + +I      + ++ GH H         
Sbjct: 162 VVAMHHPPFTTLIGHMDEIGLLEGAGALETLIARYPNVERVICGHLHRAIDVRFGG 217


>gi|296395375|ref|YP_003660259.1| metallophosphoesterase [Segniliparus rotundus DSM 44985]
 gi|296182522|gb|ADG99428.1| metallophosphoesterase [Segniliparus rotundus DSM 44985]
          Length = 315

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 42/275 (15%), Positives = 76/275 (27%), Gaps = 52/275 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           +AHISD HL                            +      L + I       D + 
Sbjct: 21  IAHISDTHLIAGDGLL----------------YGDVDADAKLAELFSRIEASQPALDALV 64

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +          +  V GNHD                    
Sbjct: 65  FTGDLADTGQPDAYRKLRDVVEPAAARLGAQVIWVMGNHDDR------------GALREH 112

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
               +              + ++   T++   P S +G    EQ    ++ L +    G 
Sbjct: 113 LLREAPSLAPLDRTHDVEGLRIVVLDTSV---PGSHHGEITPEQLDWLNEQLAEPAPFGT 169

Query: 188 FRIIMMHHPPVLD--TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ MHHPPV      ++   +       +++       +L GH H ++          
Sbjct: 170 --ILAMHHPPVPSVLDLAVSVELRDQAPLAQVLRGSDVRCVLAGHLHYSTSATFAG---- 223

Query: 246 IPVVGIASASQK---------VHSNKPQASYNLFY 271
           IPV   +++                    ++NL +
Sbjct: 224 IPVSVASASCYTQDLLVEAGGTRGRDEAQAFNLVH 258


>gi|170780694|ref|YP_001709026.1| putative phosphoesterase [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169155262|emb|CAQ00363.1| putative phosphoesterase [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 301

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/304 (11%), Positives = 86/304 (28%), Gaps = 36/304 (11%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHV 68
             L H+SD HL       +                    +    + ++ +     +V  +
Sbjct: 9   LRLVHLSDTHLLRDGGLHQ----------------GVVDTGAALDRVLVEADRVPHVRLL 52

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYIT 126
             +GD+               L    +     + + PGNHD                  T
Sbjct: 53  VGSGDLSEDGTPESYALLREQLVPWTSSRGAALVLTPGNHDVRSGFRLVLGDGHGGPG-T 111

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D            + I +   +    T++   P    G   ++Q     +LL    ++G
Sbjct: 112 DDGQDPAVVPPIDGVTIVDGWRIATLDTSV---PGKGYGALREQQLDGLRELLATPAERG 168

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
              ++     P          +   +R  +++      +IL GH H + +  +      +
Sbjct: 169 TVLVLHHPPVPAPTVLHESLALQDPERLAEIVRGSDVRVILSGHYHHHIVGSLAG----V 224

Query: 247 PVVGIASAS--------QKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD 298
           PV+     +                 + + +  ++      ++  + +    D   +   
Sbjct: 225 PVLVAPGVANETDVAADPGTERIVRGSGFLVVDVDPAGVVTSVVVRAHA-EDDGDEVALL 283

Query: 299 YSDI 302
            +++
Sbjct: 284 DAEL 287


>gi|326318125|ref|YP_004235797.1| metallophosphoesterase [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323374961|gb|ADX47230.1| metallophosphoesterase [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 285

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/241 (16%), Positives = 77/241 (31%), Gaps = 34/241 (14%)

Query: 5   YTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN 64
           +T    +L  +SD+H+            R  G + +       + ++    ++       
Sbjct: 8   FTAPTTLLLQLSDLHI------------REPGRLAYGRLDTAPYLRQAVETVLRMP--QR 53

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
            D +  TGD+ +F    E       L  +G    + ++PGNHD            A    
Sbjct: 54  PDAIVATGDLTDFGRPEEYAHLRGLLAPLGA-IPLYLLPGNHDDR----------AQLRA 102

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
                          +      + LI   T +   P ++ G    E+    +  L     
Sbjct: 103 SFPGHGYLGTSGFVQFSVPVGGLQLIALDTVV---PGASEGSLCAERLEWLAAQLDAC-- 157

Query: 185 KGFFRIIMMHHPPVLDTSSLYNRM---FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIK 240
           +G   +I MHHPP        + +    G Q  + ++      + ++ GH H +      
Sbjct: 158 RGRPVVIAMHHPPFRTLIGHMDEIGLLEGTQALEALVARHPNVERVICGHLHRSIQVRFG 217

Query: 241 N 241
            
Sbjct: 218 G 218


>gi|330807206|ref|YP_004351668.1| phosphoesterase [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327375314|gb|AEA66664.1| Putative phosphoesterase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 271

 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/294 (13%), Positives = 79/294 (26%), Gaps = 57/294 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVD--HVS 69
           L  +SD HL        L                   +++    +I+ +L    D   + 
Sbjct: 15  LVQLSDSHLFAEADASLLG----------------MNTRDSLWAVIDLVLKQQPDIDLML 58

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                  I  P     +PGNHD                      
Sbjct: 59  ATGDLSQDGTLESYAAFRQLTARIDAPAR--WIPGNHDEPQVM----------------L 100

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             +    L   +    N  +    +A+   P S  G+  +EQ    +  L +A ++    
Sbjct: 101 EAAVKSTLLNPVVDIGNWRVTMLDSAV---PGSVPGFLAEEQLILLANALSEAPERH--H 155

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HH PV    +    +     +    ++        +L GH H       +     +
Sbjct: 156 LVCLHHHPVSIGCAWMEPIGLRNPEALFAVLDRFPQVRAVLWGHVHQEVDRMREG----V 211

Query: 247 PVVGIASASQKVHS-------NKPQASYNLFYIEKKNE--YWTLEGKRYTLSPD 291
            ++   S   +                Y    +               +  +PD
Sbjct: 212 RLLASPSTCIQFEPGSEDFAVGSQAPGYRWLRLLPDGRLETGVERVVGFAFTPD 265


>gi|197103773|ref|YP_002129150.1| 3',5'-cyclic-nucleotide phosphodiesterase [Phenylobacterium
           zucineum HLK1]
 gi|196477193|gb|ACG76721.1| 3',5'-cyclic-nucleotide phosphodiesterase [Phenylobacterium
           zucineum HLK1]
          Length = 264

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 53/280 (18%), Positives = 90/280 (32%), Gaps = 41/280 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            LAH+SDIH                             + E      + +     D V +
Sbjct: 4   RLAHLSDIHFGGE-------------------------NPEAVAAAADMLRGERFDLVVV 38

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD+  +    E   +  WL  +  P    + PGNHDA      E+    ++ +      
Sbjct: 39  SGDLTRYGEAWEFEQAKAWLDGL--PEQRLVTPGNHDAPYLAWAERIFAPFRRFERWIGA 96

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKGFF 188
                 L P       +A+ G +TA    P    + G   + QA   +     A      
Sbjct: 97  APAQTWLAP------GVAVRGINTARGAQPRLNWSKGQIARRQAEEAAAWFDTAPPD-AV 149

Query: 189 RIIMMHHPPVLDTSSLYN-RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           RI+++HHP +         R++G +           DL+L GH H               
Sbjct: 150 RIVVVHHPLIEMLGGPMTARVWGGEAAAAAFAGAKVDLVLSGHIHAPFTWPYPYGDGRTY 209

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYT 287
            VG  + S +         +N+  +E     + +    +T
Sbjct: 210 AVGAGTLSVR--ERGVPPGFNIVEVEAD--CFRVTALAWT 245


>gi|167625560|ref|YP_001675854.1| calcineurin phosphoesterase domain-containing protein [Shewanella
           halifaxensis HAW-EB4]
 gi|167355582|gb|ABZ78195.1| Calcineurin phosphoesterase domain protein [Shewanella halifaxensis
           HAW-EB4]
          Length = 279

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 46/295 (15%), Positives = 82/295 (27%), Gaps = 52/295 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHV 68
            +  ++D HL   P    L                   + +    ++N I   N   D +
Sbjct: 17  RIVQVTDPHLFADPEAQLLG----------------VNTAQSLGAVLNTISAVNYPADFM 60

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGDI     N    +    +  +  P     +PGNHD     +               
Sbjct: 61  LATGDISQDYSNESYHSFVDAISPLEIPC--HYLPGNHDDPRIMSLHMQGPKVFGQKR-- 116

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                         +  N  ++   + +   P    G+    +       +  A +    
Sbjct: 117 -------------ILAGNWQILMLDSTVRGRPG---GHMSDAELDLIDSAI--AAEPERH 158

Query: 189 RIIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
            +++MHH P+L   +    + M     F +          +L GH H       K     
Sbjct: 159 TLLVMHHNPILAGCNWLDQHCMDNGSHFIEKAAQYPQVKGLLWGHIHQTIDTEHKGPHGA 218

Query: 246 IPVVGIASASQKVHSNKP-------QASYNLFYIEKKNEYWT--LEGKRYTLSPD 291
           + ++   S   +     P       Q  Y L  ++      T        T SPD
Sbjct: 219 LKLMATPSTCIQFKPKSPYFALDAQQPGYRLLELKSDGSILTNVYRVPGETFSPD 273


>gi|325983364|ref|YP_004295766.1| metallophosphoesterase [Nitrosomonas sp. AL212]
 gi|325532883|gb|ADZ27604.1| metallophosphoesterase [Nitrosomonas sp. AL212]
          Length = 280

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 48/292 (16%), Positives = 91/292 (31%), Gaps = 39/292 (13%)

Query: 14  HISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGD 73
            ISD+H                               EV + L   I     + V ++GD
Sbjct: 4   QISDLHFGTE-------------------------RPEVVSALEALIHSMPPELVVLSGD 38

Query: 74  IVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCST 133
           I       +   +  ++  +G P    ++PGNHD  +     ++L+ + ++  S      
Sbjct: 39  ITQRARRSQFQAARSFVDRLGAPA-TLVIPGNHDIPLFNLISRALNPYANHCRSFGAELE 97

Query: 134 GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMM 193
                P       + +IG +T         +G     Q    ++ L  A+ +    ++  
Sbjct: 98  PVYDSPT------LLVIGVNTTR--RWRHVDGEVSAYQRQRVAQRLSHASAEQLRIVVTH 149

Query: 194 HHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH----WIKNEKKLIPVV 249
               V     + N + G +         GAD+IL GH HL  +        N  + +   
Sbjct: 150 QPVAVTREEDVTNLLHGHKAAVHEWSSAGADIILGGHIHLPFVVPLHKHYDNLARRLWAA 209

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLE-GKRYTLSPDSLSIQKDYS 300
              +A           S NL      +        +R+  S  +      ++
Sbjct: 210 QAGTAVSSRIRRGANNSVNLVRSTGLSNGTRAAIVQRWDYSDTTRMFTLKHT 261


>gi|158422410|ref|YP_001523702.1| putative ICC protein [Azorhizobium caulinodans ORS 571]
 gi|158329299|dbj|BAF86784.1| putative ICC protein [Azorhizobium caulinodans ORS 571]
          Length = 276

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/269 (15%), Positives = 78/269 (28%), Gaps = 43/269 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  +A ++D H+                            +       +  +       D
Sbjct: 1   ML-IAQLTDTHIRLPGRLA----------------YGVVDTAAYLERAVAYLRSLPRQPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ +F    E          +  P  +  VPGNHD+           A +    
Sbjct: 44  VVIVTGDLTDFDTPEEYARFRAITAPLSMP--LLPVPGNHDSSAGLRAAFPQIARQ---- 97

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                        Y+   + + L+   +++   P    G  G          L  A ++ 
Sbjct: 98  ---AGGGASDKLNYVVDGHPVRLVLLDSSVPGKPH---GELGTATLAWLDAQLGAAPERP 151

Query: 187 FFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLIL-HGHTHLNSLHWIKNEK 243
              +I +HHPP +      +    F     ++++      L L  GH H   +       
Sbjct: 152 T--LIGLHHPPFVTGIRHMDVQNLFDAAALEEVLLRHPQVLALTCGHIHRTVVTGFAGR- 208

Query: 244 KLIPVVGIAS---ASQKVHSNKPQASYNL 269
              P +   S   A     +     S+++
Sbjct: 209 ---PAMIAPSPAHAVSLALAPDAPPSFHM 234


>gi|254507480|ref|ZP_05119614.1| cyclic AMP phosphodiesterase [Vibrio parahaemolyticus 16]
 gi|219549550|gb|EED26541.1| cyclic AMP phosphodiesterase [Vibrio parahaemolyticus 16]
          Length = 272

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/273 (13%), Positives = 75/273 (27%), Gaps = 47/273 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDHV 68
            L  I+D HL                      +     + E    ++N I       D +
Sbjct: 13  KLLQITDTHL----------------FEATDGSLLSVNTGESFKAVVNAIVEQECRFDAL 56

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGDI               +  +  P     +PGNHD   +                 
Sbjct: 57  LATGDISQDHSEASYQCFERGIEPLLKPC--FWLPGNHDYKPNMTSV------------- 101

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              S   +   ++ +  +  +I   + +   P    G    +Q     + L +   +   
Sbjct: 102 -LPSPQIQQVDHVLLGEHWQMILLDSQVIGVPH---GRLSDKQLALLDEKLAQYADRHTL 157

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  H   V       + +     F +++      + +L GH H +           + 
Sbjct: 158 VLLHHHPILVGSAWLDQHTLKDADDFWQVVQKHDNVNAVLCGHVHQDMNVMHHG----VR 213

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
           V+   S   +   N        F ++  +  W 
Sbjct: 214 VMATPSTCVQFKPNSDD-----FALDTTSPGWR 241


>gi|290888933|gb|ADD69827.1| cyclic AMP phosphodiesterase [Pseudomonas aeruginosa]
          Length = 272

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 41/303 (13%), Positives = 82/303 (27%), Gaps = 57/303 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   +      ++  +       D + 
Sbjct: 16  LVQLSDSHLFAEDGARLLG----------------MDTAHSLEKVVERVAREQPRIDLIL 59

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                  +  P       GNHD      +               
Sbjct: 60  ATGDVSQDGSLDSYTRFRRLSAPLAAPLRWFA--GNHDEREPMQR--------------- 102

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             + G  L   +    N  ++   ++I        GY   +Q     + +  A ++  F 
Sbjct: 103 -ATEGSDLLEQIVDVGNWRVVLLDSSIPGAV---PGYLEDDQLDLLRRAIDSAGER--FL 156

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGA-DLILHGHTHLNSLHWIKNEKKLI 246
           ++  HH PV   S   + +     Q    ++        +L GH H         ++  +
Sbjct: 157 LVSFHHHPVPIGSDWMDPIGLRNPQALFDLLAPYPQLRCLLWGHIHQ----EFDRQRGPL 212

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF--- 303
            ++   S   +            F +++    +    + +        I +    +F   
Sbjct: 213 RLLASPSTCVQFAPGSSD-----FTLDRLAPGYR-WLRLHDDGRLETGISRVDDVVFEVD 266

Query: 304 YDT 306
           YDT
Sbjct: 267 YDT 269


>gi|167845119|ref|ZP_02470627.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei B7210]
 gi|217423699|ref|ZP_03455200.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 576]
 gi|217393557|gb|EEC33578.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 576]
          Length = 275

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 75/240 (31%), Gaps = 40/240 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M +LAHISD+H+    +                   ++  +       +  +       D
Sbjct: 1   MMLLAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNALEPRPD 44

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +            
Sbjct: 45  AVLVTGDLTDFGDDDEYAHLKALLAPLAMPY--YLLVGNHDDRAALRRAFPAR------- 95

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    +   Y      + +I   + I   P ++ G     +    +  L  A  + 
Sbjct: 96  ---VELQSGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDR- 148

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              I+ +HHPP        + M        R   ++      + +L GH H  +      
Sbjct: 149 -PVIVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTTFARFGG 207


>gi|300718431|ref|YP_003743234.1| cyclic 3\',5\'-adenosine monophosphate phosphodiesterase [Erwinia
           billingiae Eb661]
 gi|299064267|emb|CAX61387.1| cyclic 3\',5\'-adenosine monophosphate phosphodiesterase [Erwinia
           billingiae Eb661]
          Length = 275

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/296 (12%), Positives = 75/296 (25%), Gaps = 48/296 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHV 68
            +  I+D HL        L                        + ++  I     + D +
Sbjct: 16  RILQITDTHLFAGKDETLLGVNTWASY----------------DAVLQAISASPRHYDLI 59

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+               +  +  P     +PGNHD   +     +     D     
Sbjct: 60  VATGDLAQDHTVEAYQHFAEGIARL--PAPCVWLPGNHDFQPAMFSTLAESQIADEKH-- 115

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       + I ++  ++   + +   P    G     Q       L K   +   
Sbjct: 116 ------------VLIGDSWQIVLLDSQVFGVPH---GMLSDYQLEWLENTLAKEPHRHTL 160

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  H  P   T    + +        ++     A  +L GH H +             
Sbjct: 161 VLLHHHPLPSGCTWLDQHSLRNPHSLDAVLQKYPLATTLLCGHIHQDLDLNWNGR----R 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           ++   S   +   +        F I+ +   W               +++  +  F
Sbjct: 217 LLATPSTCVQFKPHCTN-----FTIDSEAPGWR-WLDLLPDGRVETQVERLATRAF 266


>gi|120553739|ref|YP_958090.1| calcineurin phosphoesterase C-terminal domain-containing protein
           [Marinobacter aquaeolei VT8]
 gi|120323588|gb|ABM17903.1| Calcineurin phosphoesterase C-terminal domain protein [Marinobacter
           aquaeolei VT8]
          Length = 268

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 77/284 (27%), Gaps = 47/284 (16%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           MTK  T     +  ++D HL                + +         +++    +I ++
Sbjct: 1   MTKPTTARPLNVLQLTDPHL----------------MASADGALLGVNTRDSLAAVIGEV 44

Query: 61  --LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSL 118
                  D +  TGD+               L++   P     + GNHD           
Sbjct: 45  LRNHGQPDLILATGDLTQDASPEAYRYFGEQLQAFDCPS--LWIAGNHDDSA-------- 94

Query: 119 HAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
                     +  +          I+     +   +++    F   G    ++     + 
Sbjct: 95  --------LLSAIAAETGSDQKQWIQGGWQFVMLDSSVHGKVF---GELSADELSFLDRA 143

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNS 235
           L +  +     ++ +HH PV   S    ++       F ++I       ++L GH H   
Sbjct: 144 LSERPE--LPAMVCLHHHPVDIGSDWMEKIGLKNRDAFWQVIDRHPQVRVVLWGHIHQEL 201

Query: 236 LHWIKNE---KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
                           +  A+ S           Y    ++   
Sbjct: 202 EQQRNGACLLATPSTCIQFATGSSDFAVEPLAPGYRWLELDPSG 245


>gi|325578753|ref|ZP_08148800.1| 3',5'-cyclic-nucleotide phosphodiesterase [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325159577|gb|EGC71709.1| 3',5'-cyclic-nucleotide phosphodiesterase [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 274

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 43/310 (13%), Positives = 90/310 (29%), Gaps = 52/310 (16%)

Query: 1   MTKRYT----TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLL 56
           M  R+     + +  L  I+D HL    S   L                   + E  + +
Sbjct: 1   MNNRFEYEPASEVVKLLQITDPHLFKDTSKDLLG----------------INTHESFSQV 44

Query: 57  INDIL--LHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAK 114
           + +I       D V  TGD+V  + +         ++ +     +  +PGNHD     A 
Sbjct: 45  LKEIQLESFEYDVVLATGDLVQDSSDEGYLRFVEMVKPLNK--WVFWLPGNHDFQPKMA- 101

Query: 115 EKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHA 174
                        +    +      +L +  +  +I   + +   P    G     Q   
Sbjct: 102 -------------EHLSQSPINASKHLLLGKHWQVILLDSQVFGVPH---GELSPYQLDW 145

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHL 233
               L +   +    ++  H  P        + +     F  ++        IL+GH H 
Sbjct: 146 LKTKLAENPARHSLVVLHHHLLPTNSAWLDQHNLRNAHEFSVVLAQFNNVKGILYGHIHQ 205

Query: 234 NSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
                +    +    +   +   +   +      N F ++     W  E + +       
Sbjct: 206 ----EVDGYWQGYQTMATPATCIQFKPDS-----NHFALDTLQPGWR-EIELHPDGRIET 255

Query: 294 SIQKDYSDIF 303
            +++    IF
Sbjct: 256 RVKRIKQKIF 265


>gi|54294842|ref|YP_127257.1| hypothetical protein lpl1921 [Legionella pneumophila str. Lens]
 gi|53754674|emb|CAH16161.1| hypothetical protein lpl1921 [Legionella pneumophila str. Lens]
          Length = 269

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 78/279 (27%), Gaps = 40/279 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISD+H                               +V N  + +  L   D + 
Sbjct: 1   MKIIHISDLHFGM-------------------------HQPKVLNAFLQETALDKPDIIL 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+     + +      ++  +  P     VPGNHD        + +  ++ Y     
Sbjct: 36  ISGDLTQRGLSYQYRELCSFINQL--PAQTLTVPGNHDIPFYNVPARFIFPFRQYKRYIN 93

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
              T           + + ++G ++         NG    E  +   +            
Sbjct: 94  PDIT------TTFENDCVRILGVNSVNPLQ--LKNGKLSHETLNRIKRYF---KLDDEKL 142

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            ++  H        L+  +   Q     +      L+  GH H   L  I        + 
Sbjct: 143 NLLFFHHNFDYMEGLHKPLANAQTLLSFLKQSTVHLVCTGHLHYAHLSLIAKNNGYSCLA 202

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKN--EYWTLEGKRY 286
             A +     S     SY +    +K     W +  + +
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIEANQKKCRITWRVFDQEH 241


>gi|295676992|ref|YP_003605516.1| metallophosphoesterase [Burkholderia sp. CCGE1002]
 gi|295436835|gb|ADG16005.1| metallophosphoesterase [Burkholderia sp. CCGE1002]
          Length = 274

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/240 (16%), Positives = 78/240 (32%), Gaps = 40/240 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  LA ISD+H+    +                   ++  +       I+ +       D
Sbjct: 1   ML-LAQISDLHIKQPGALA----------------YRRVDTAPYLARCIDALNALTPRPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+V+    R+       L  +  P+   ++ GNHD           +A +    
Sbjct: 44  AVLMTGDLVDQGDPRQYAHLKTLLDRLEIPY--FLMVGNHDER---------NALRAAFP 92

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                 +G +   Y      + +I   + +   P S+ G     +    ++ L  A   G
Sbjct: 93  EREELLSGGEFVQYAVDVGPLRVIALDSLV---PGSSAGMLCDTRLAWLAQQLDAA--HG 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGI----QRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              ++ +HHPP        + +        +   +I      + +L GH H +       
Sbjct: 148 KPVVVALHHPPFACGIGHMDEIRLDPAASDKLAALIARYPNVERVLCGHVHRSMFVRFGG 207


>gi|237807169|ref|YP_002891609.1| Calcineurin phosphoesterase domain-containing protein [Tolumonas
           auensis DSM 9187]
 gi|237499430|gb|ACQ92023.1| Calcineurin phosphoesterase domain protein [Tolumonas auensis DSM
           9187]
          Length = 273

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 38/300 (12%), Positives = 84/300 (28%), Gaps = 54/300 (18%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           ++K    I+  L  ISD HL    +                 +     + +    +++ I
Sbjct: 6   LSKPDDGIV-RLLQISDTHLFAETN----------------RDLLGIATADSFQAVLDAI 48

Query: 61  LLHN--VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSL 118
                  D V  TGD+               + ++  P  +  +PGNHD  +    E  +
Sbjct: 49  TELPQTYDVVLATGDLSQDHSAASYQRFARMVTTLQKP--VHWLPGNHDHRVLMQNELQV 106

Query: 119 HAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
              +  +                 + ++  +I   + +   P    G+    Q       
Sbjct: 107 SGIRPEMQ---------------LVGDHWQVILLDSQVYGTPH---GWLSHLQLEQLEAA 148

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLH 237
           L +  +K     +  H  P+       + +     F  ++        +L GH H     
Sbjct: 149 LLQYPEKHVLICLHHHTFPIGSIWLDQHDLKNASDFLAVLARYPRVKAVLCGHVHQEYDQ 208

Query: 238 WIKNEKKLIPVVGIASASQKVHS-------NKPQASYNLFYIEKKNEYWTLEGKRYTLSP 290
           + +     I  +   S   +          +     +    +        +  + + L P
Sbjct: 209 YHQG----IRFLTSPSTCIQFQPLSVDFSLDTMSPGWRYLQLYPDG---RIATQVWRLEP 261


>gi|84489354|ref|YP_447586.1| phosphohydrolase [Methanosphaera stadtmanae DSM 3091]
 gi|84372673|gb|ABC56943.1| predicted phosphohydrolase [Methanosphaera stadtmanae DSM 3091]
          Length = 243

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 54/266 (20%), Positives = 85/266 (31%), Gaps = 47/266 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + HISD+H                            F +++    I++I       V
Sbjct: 1   MTKIVHISDLH-----------------------TGYAQFREDLLLQTIDEINKIQPSAV 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            I+GD+ +    RE   +  ++  I       IVPGNHDA   G         K Y   +
Sbjct: 38  VISGDLTDQGFYREFIEAKEYIDLIQPKT--LIVPGNHDARNIGDTVFEELFGKRYSVLE 95

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                             I +IG  ++    P   +G  G+ Q       +  A +KG F
Sbjct: 96  LKEEA-------------IKIIGLDSS---EPDLGHGKIGRLQKKFMEDEIADAKEKGLF 139

Query: 189 RI--IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
            I  +  H   + +T    N +         I     +L+L GH H+     + N     
Sbjct: 140 IIIVLHHHIISIPNTGRERNILSDAGDILLTILENNVNLVLSGHKHVPHAWKMNN----T 195

Query: 247 PVVGIASASQKVHSNKPQASYNLFYI 272
                 + S          SYN+  I
Sbjct: 196 LFATAGTVSSMKLRGNTCPSYNVIDI 221


>gi|206559498|ref|YP_002230259.1| putative phosphodiesterase [Burkholderia cenocepacia J2315]
 gi|198035536|emb|CAR51415.1| putative phosphodiesterase [Burkholderia cenocepacia J2315]
          Length = 274

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/270 (14%), Positives = 86/270 (31%), Gaps = 44/270 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       +  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCVEKLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L ++  P+   ++ GNHD      +            +D 
Sbjct: 47  VTGDLTDFGHDEEYGNLRGLLAALEIPY--YLMIGNHDDRAGLRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + ++   + +   P +++G     +    +  L  A ++    
Sbjct: 95  AELQDGEFVQYALDVGAVRVLALDSQV---PGASHGDLCDARLAWLAAQLDAARER--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMI-----WHEGADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +      +++         +      H   + +L GH H            
Sbjct: 150 IVALHHPPFVSGIGHMDKLRLAPAAAAKLDALLRDHPNVERVLCGHVHRTMFTRF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEK 274
              V  + S + +V  +      + F +E 
Sbjct: 206 GTLVSAVPSPAHQVAFDLRADGPSAFRLEP 235


>gi|237729958|ref|ZP_04560439.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Citrobacter
           sp. 30_2]
 gi|226908564|gb|EEH94482.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Citrobacter
           sp. 30_2]
          Length = 275

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/297 (11%), Positives = 78/297 (26%), Gaps = 48/297 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHV 68
            +  I+D HL        L                          +++ I   +   D +
Sbjct: 16  RILQITDTHLFAEKHETLLGVNTWDSY----------------QSVLDAIHAESPEYDLI 59

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+               + S   P     +PGNHD   +                 
Sbjct: 60  VATGDLAQDQSAAAYQHFAEGIASFRAPC--VWLPGNHDFQPAM--------------YS 103

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G      + I     ++   + +   P    G   + Q     + L  A ++   
Sbjct: 104 ALQDAGISPAKRVFIGEQWQILLLDSQVFGVPH---GELSEFQLEWLERKLADAPERNTL 160

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  H  P   +    + +        ++ +   A  +L GH H               
Sbjct: 161 LLLHHHPLPAGCSWLDQHSLRNAAELDNVLVNYPRARYLLCGHIHQELDLDWNGR----R 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
           ++   S   +   +        F ++  +  W    + +        +++   + F+
Sbjct: 217 LLATPSTCVQFKPHCSN-----FTLDTISPGWR-TLELFADGTLQTQVRRLQGNRFH 267


>gi|160935136|ref|ZP_02082519.1| hypothetical protein CLOBOL_00031 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441867|gb|EDP19564.1| hypothetical protein CLOBOL_00031 [Clostridium bolteae ATCC
           BAA-613]
          Length = 521

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/252 (14%), Positives = 73/252 (28%), Gaps = 20/252 (7%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            L   +D+H     +      +     V     +   +  E+    +++++      + +
Sbjct: 111 RLILATDLHY--QSALAGDGGEAFRLFVERSDGKVVQYLPELLEAFLDEVIEERPSALVL 168

Query: 71  TGDIVNFTCNREIFT-STHWLRSIGNPHDISIVPGNHDAYISGAKEKS------------ 117
           +GDI            +    R       + ++PGNHD     A                
Sbjct: 169 SGDITMNGERLNHEELAARLKRVQDAGIQVLVIPGNHDINNHDASVYYGARKEPAPYIDG 228

Query: 118 --LHAWKDYITSDTTCSTGKKLFPYLR-IRNNIALIGCSTAIATPPFSANGYFGQEQAHA 174
              H        D   S       Y+  + +   L+   +    P     G         
Sbjct: 229 PEFHEIYHEYGYDQALSRDDSSLSYVYALDDRNWLLMLDSCQYEPDNKVEGRLKDSTMAW 288

Query: 175 TSKLLRKANKKGFFRIIMMHHPPV--LDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
             + L +A ++G F I + HH  +      +    M   +    ++      L   GH H
Sbjct: 289 ADEQLARAKEEGVFVIPIAHHNLLAQSRMYTTQCAMDNNKEVISLLQKYELPLFFSGHLH 348

Query: 233 LNSLHWIKNEKK 244
           +  +   K+E  
Sbjct: 349 VQRIRKHKSEPG 360


>gi|296158422|ref|ZP_06841253.1| metallophosphoesterase [Burkholderia sp. Ch1-1]
 gi|295891366|gb|EFG71153.1| metallophosphoesterase [Burkholderia sp. Ch1-1]
          Length = 275

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/297 (15%), Positives = 89/297 (29%), Gaps = 48/297 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  LA ISD+H+    +                   ++  +       +  +       D
Sbjct: 1   ML-LAQISDLHIKRPGALA----------------YRRVDTGAYLARCVAALNALEPRPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+V+     +       L  +  P+   ++ GNHD            A +    
Sbjct: 44  AVIMTGDLVDQGDPEQYEHLKTLLAPLEIPY--FMLVGNHDERA---------ALRAAFP 92

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                ++G +   Y      + LI   + +   P  + G     +    +  L  A  +G
Sbjct: 93  DRKELASGGEFVQYAVDLGALRLIALDSMV---PGQSAGTLCDARLAWLAAQLDAA--QG 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGI----QRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              I+ +HHPP +      + +        R   +I      + ++ GH H         
Sbjct: 148 KPTIVALHHPPFVCGIGHMDELRLDPAAADRLAALIARYPNVERVICGHVHRPMFVRFGG 207

Query: 242 EKKLIPVVGIASASQKVHSNKP------QASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
                        +  +H + P        +Y L + +       +    Y  + D 
Sbjct: 208 TIASAVPAPAHQVALDLHEDAPSAFMMEPPAYALHHYDPATGI--VTHHAYVDAADG 262


>gi|311110696|ref|ZP_07712093.1| putative 3,5-cyclic-nucleotide phosphodiesterase [Lactobacillus
           gasseri MV-22]
 gi|311065850|gb|EFQ46190.1| putative 3,5-cyclic-nucleotide phosphodiesterase [Lactobacillus
           gasseri MV-22]
          Length = 410

 Score =  103 bits (255), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 45/291 (15%), Positives = 90/291 (30%), Gaps = 35/291 (12%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           ISD HL           +    +      +  Y+ +   +  +          + +TGD+
Sbjct: 13  ISDTHLIAD--SLHDDGQAFSQMQKTSQGKDLYYQETALSAFVRMAEEKKPAAIIVTGDV 70

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
                           + +     + ++PGNHD Y      +  H  K Y     +    
Sbjct: 71  TFNGERVSAERFAEIFKPL-TKTKLLVLPGNHDIY--DGWAREFHGKKQYYAGQISPRMW 127

Query: 135 KKLF----------------PYLRIRNNIALIGCSTAIATPPFSA-----NGYFGQEQAH 173
           + +F                  +++  +  LI   +       SA      G+ G+EQ  
Sbjct: 128 RNIFRTSYETAVSVDSSSLAYSVQLNPDYLLILADSNDYGKEESATAPATAGFLGKEQRK 187

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGHT 231
              + L+ A++     I  MHH       +      +   +  +K++      L+  GH 
Sbjct: 188 WIKEQLQYASQHNLRVIFCMHHNLYAHNPAVNKGYVVDDYRELRKLLAQYNVKLVFSGHI 247

Query: 232 HLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           H      I   +   P + + +AS   +       Y +  +  K   +T  
Sbjct: 248 H---AQNIMPPQNSCPAMEVVTASFCSNDQV----YGVVKVSPKEISYTCH 291


>gi|292486924|ref|YP_003529794.1| hypothetical protein EAMY_0436 [Erwinia amylovora CFBP1430]
 gi|292900682|ref|YP_003540051.1| phosphoesterase [Erwinia amylovora ATCC 49946]
 gi|291200530|emb|CBJ47659.1| putative phosphoesterase [Erwinia amylovora ATCC 49946]
 gi|291552341|emb|CBA19386.1| Uncharacterized protein syc0937_d [Erwinia amylovora CFBP1430]
          Length = 275

 Score =  103 bits (255), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 38/296 (12%), Positives = 79/296 (26%), Gaps = 48/296 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                      V   +  +    + D +  
Sbjct: 16  RILQITDTHLFAGKDETLLGVNTWASFD------------AVLEAVAAE--QRHYDLIVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +        +  D       
Sbjct: 62  TGDLAQDHSVEAYQHFAEGIARLSAPC--VWLPGNHDYQPTMFSTLGASSIADQKQ---- 115

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                     + I ++   +   + +   P    G   + Q     + +  A +     +
Sbjct: 116 ----------VLIGDHWQAMLLDSQVFGVPH---GELSEYQLEWLDRAM--AAEPQRHTL 160

Query: 191 IMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           I++HH P+    S  ++           ++     A  +L GH H               
Sbjct: 161 ILLHHHPLPSGCSWLDQHSLRNPHMLDAVLQRYPRAKTLLCGHIHQELDLNWHGR----R 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           V+   S   +   +        F I+ +   W               +++  + +F
Sbjct: 217 VLATPSTCVQFKPHCTN-----FTIDAEAPGWR-WLDLAADGHLETEVKRLNTRMF 266


>gi|227508602|ref|ZP_03938651.1| metallophosphoesterase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227191934|gb|EEI72001.1| metallophosphoesterase [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 291

 Score =  103 bits (255), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 46/282 (16%), Positives = 80/282 (28%), Gaps = 41/282 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDHV 68
            +  ISD HL+ +                   N ++   +E    + +DI     + D +
Sbjct: 7   KIVQISDTHLTPAG--------------AKPANHQRLDPEEKLRTVFDDIYNSNVDPDLI 52

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNP--HDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            I+GD+++           H L          I ++ GNHD                +  
Sbjct: 53  VISGDLIHEGDAEAYADFHHMLDQEQERLMAPIKVILGNHD------------RTDQFYK 100

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                      + Y      +      T          GY  Q Q H     L++  + G
Sbjct: 101 GFLGKKRVATRYYYHESLEGLECYFLDTKCGD---IEQGYLDQTQLHWLKNQLQEYQRPG 157

Query: 187 FFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
              II MHHP                      +I H     I  GH H  + + +     
Sbjct: 158 ---IIFMHHPLYGPPLQQMRYSILQNGDDLLNVIDHTYVKAIFSGHVHFANSYVVDGILN 214

Query: 245 LI---PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
           ++       I  A+   H      +YN+  ++  +       
Sbjct: 215 VVADSTAYHINCANPHEHFVTDGTAYNVITVDGDDIGVEQRL 256


>gi|160937713|ref|ZP_02085073.1| hypothetical protein CLOBOL_02606 [Clostridium bolteae ATCC
           BAA-613]
 gi|158439358|gb|EDP17110.1| hypothetical protein CLOBOL_02606 [Clostridium bolteae ATCC
           BAA-613]
          Length = 480

 Score =  103 bits (255), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/320 (13%), Positives = 93/320 (29%), Gaps = 32/320 (10%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  ++DIH                 +V     +   +  E+ +  + +I L + D + I
Sbjct: 74  RIILMTDIHYLAE--SLTDRGNMFQSMVEHGDGKLTNYVWEITDAALEEIKLLSPDALII 131

Query: 71  TGDIVNFTCNREIFT-STHWLRSIGNPHDISIVPGNHD--------------AYISGAKE 115
           +GD+      +     +            + ++PGNHD                      
Sbjct: 132 SGDLSLQGEKKSHEELAKKLDEVEKAGITVLVIPGNHDINNPSASVYSGGDRYPAEPTAP 191

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRNN-IALIGCSTAIATPPFSANGYFGQEQAHA 174
           +               S       Y       + L+   T    P     G    E    
Sbjct: 192 EDFERIYKEFGYSEASSRDANSLSYTYDLGPSMRLLMLDTCQYEPRNKVGGMIKTETYEW 251

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDT--SSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232
             + L++A +     + + HH  + ++   +    +   +   +M+  E   L L GH H
Sbjct: 252 IKEQLKQAARDSVILLPVAHHNLLEESKVYADDCTIEHSEELIQMLEGENIPLFLSGHLH 311

Query: 233 LNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYW----TLEGKRYTL 288
           +       N    I  V  +S S       P   Y +    +   ++     ++ +++  
Sbjct: 312 VQHFMR--NNDIGIYEVVTSSLST------PPCQYGVLDYMEDETFYYYSRKVDMEKWAR 363

Query: 289 SPDSLSIQKDYSDIFYDTLV 308
              S        D +   ++
Sbjct: 364 KNKSTDENLLNFDTYSPPVL 383


>gi|85058247|ref|YP_453949.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Sodalis
           glossinidius str. 'morsitans']
 gi|84778767|dbj|BAE73544.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 275

 Score =  103 bits (255), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/276 (13%), Positives = 68/276 (24%), Gaps = 43/276 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
                 +  I+D HL        L  K                   V   +       + 
Sbjct: 11  RGANIRILQITDTHLFAGEDETLLGVKTFRSYS------------AVLKAV--QAEQRHF 56

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           D V  TGD+      +        +  +  P     +PGNHD   +              
Sbjct: 57  DLVVATGDLAQDHSPQAYRHFAAGIARL--PAPCVWLPGNHDFQPAMV------------ 102

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
             D     G      + I +   L+   + +   P    G     Q    ++ L    ++
Sbjct: 103 --DVLAECGISCAKQVLIGDEWQLLLLDSQVYGVPH---GELSDYQLEWLARALASQPER 157

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKK 244
               ++  H  P        + +       +++        +L GH H            
Sbjct: 158 HTLLLLHHHPFPSGCIWLDQHSLRNAHMLAEVLQPHQRVKTLLCGHIHQELDVDWLGR-- 215

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
              V+   S   +   +        F I+     W 
Sbjct: 216 --RVLATPSTCVQFKPHCTN-----FTIDTLGPGWR 244


>gi|238854254|ref|ZP_04644598.1| Ser/Thr protein phosphatase family protein [Lactobacillus gasseri
           202-4]
 gi|238833065|gb|EEQ25358.1| Ser/Thr protein phosphatase family protein [Lactobacillus gasseri
           202-4]
          Length = 410

 Score =  103 bits (255), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 45/291 (15%), Positives = 90/291 (30%), Gaps = 35/291 (12%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           ISD HL           +    +      +  Y+ +   +  +          + +TGD+
Sbjct: 13  ISDTHLIAD--SLHDDGQAFSQMQKTSQGKDLYYQETALSAFVRMAEEKKPAAIIVTGDV 70

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
                           + +     + ++PGNHD Y      +  H  K Y     +    
Sbjct: 71  TFNGERVSAERFAEIFKPL-TKTKLLVLPGNHDIY--DGWAREFHGKKQYYAGQISPRMW 127

Query: 135 KKLF----------------PYLRIRNNIALIGCSTAIATPPFSA-----NGYFGQEQAH 173
           + +F                  +++  +  LI   +       SA      G+ G+EQ  
Sbjct: 128 RNIFRTSYETAVSVDSSSLAYSVQLNPDYLLILADSNDYGKEESATAPATAGFLGKEQRK 187

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGHT 231
              + L+ A++     I  MHH       +      +   +  +K++      L+  GH 
Sbjct: 188 WIKEQLQYASQHNLRVIFCMHHNLYAHNPAVNKGYVVDDYRELRKLLAQYNVKLVFSGHI 247

Query: 232 HLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           H      I   +   P + + +AS   +       Y +  +  K   +T  
Sbjct: 248 H---AQNIMPPQNSCPAMEVVTASFCSNDQV----YGVVKVSPKEISYTCH 291


>gi|67643401|ref|ZP_00442147.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei GB8
           horse 4]
 gi|121601377|ref|YP_992543.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           SAVP1]
 gi|124383960|ref|YP_001026654.1| 3',5'-cyclic-nucleotide phosphodiesterase [Burkholderia mallei NCTC
           10229]
 gi|126450491|ref|YP_001080064.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           NCTC 10247]
 gi|126453145|ref|YP_001065685.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1106a]
 gi|167002455|ref|ZP_02268245.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           PRL-20]
 gi|167823575|ref|ZP_02455046.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 9]
 gi|167902113|ref|ZP_02489318.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei NCTC 13177]
 gi|167910353|ref|ZP_02497444.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 112]
 gi|237811694|ref|YP_002896145.1| 3',5'-cyclic-nucleotide phosphodiesterase [Burkholderia
           pseudomallei MSHR346]
 gi|242317579|ref|ZP_04816595.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1106b]
 gi|254180266|ref|ZP_04886865.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1655]
 gi|254197687|ref|ZP_04904109.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei S13]
 gi|254201653|ref|ZP_04908017.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           FMH]
 gi|254206985|ref|ZP_04913336.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           JHU]
 gi|254358899|ref|ZP_04975172.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           2002721280]
 gi|121230187|gb|ABM52705.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           SAVP1]
 gi|124291980|gb|ABN01249.1| 3',5'-cyclic-nucleotide phosphodiesterase [Burkholderia mallei NCTC
           10229]
 gi|126226787|gb|ABN90327.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1106a]
 gi|126243361|gb|ABO06454.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           NCTC 10247]
 gi|147747547|gb|EDK54623.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           FMH]
 gi|147752527|gb|EDK59593.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           JHU]
 gi|148028026|gb|EDK86047.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           2002721280]
 gi|169654428|gb|EDS87121.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei S13]
 gi|184210806|gb|EDU07849.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1655]
 gi|237506370|gb|ACQ98688.1| 3',5'-cyclic-nucleotide phosphodiesterase [Burkholderia
           pseudomallei MSHR346]
 gi|238524749|gb|EEP88180.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei GB8
           horse 4]
 gi|242140818|gb|EES27220.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 1106b]
 gi|243061867|gb|EES44053.1| Ser/Thr protein phosphatase family protein [Burkholderia mallei
           PRL-20]
          Length = 275

 Score =  103 bits (255), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 74/240 (30%), Gaps = 40/240 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M +LAHISD+H+    +                   ++  +       +  +       D
Sbjct: 1   MMLLAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNALEPRPD 44

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +            
Sbjct: 45  AVLVTGDLTDFGDDDEYAHLKALLAPLAMPY--YLLVGNHDDRAALRRAFPAR------- 95

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    +   Y      + +I   + I   P ++ G     +    +  L  A  + 
Sbjct: 96  ---VELQSGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDR- 148

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              I+ +HHPP        + M        R   ++      + +L GH H         
Sbjct: 149 -PVIVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGG 207


>gi|73668764|ref|YP_304779.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina barkeri
           str. Fusaro]
 gi|72395926|gb|AAZ70199.1| 3,5-cyclic-nucleotide phosphodiesterase [Methanosarcina barkeri
           str. Fusaro]
          Length = 230

 Score =  103 bits (255), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 44/251 (17%), Positives = 88/251 (35%), Gaps = 32/251 (12%)

Query: 50  KEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAY 109
            E+AN ++ +I   + D + ITGD+       E   +  ++  I   + + IVPGNHD+ 
Sbjct: 2   PEIANSMLENINRSSPDIIVITGDLTENGLAAEYNGAKKFIDRIECKNKV-IVPGNHDSR 60

Query: 110 ISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQ 169
            +G             +                    I ++G  ++    P    G+ G+
Sbjct: 61  NAGYLFFEDLFKTRSTSGQF---------------GEITVVGLDSS---QPELDEGHIGR 102

Query: 170 EQAHATSKLLRKANKKGFFRIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLIL 227
           E  +              F++  +HH   P+  T    N +       +++   G +L+L
Sbjct: 103 ENYNWIENTFSV----NGFKVFALHHHLIPIPRTGRGNNVLVDAGDVLELLDRSGVNLVL 158

Query: 228 HGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEK---KNEYWTLEGK 284
            GH H+  +  +      + V+   +        K    YN   ++      + W L+  
Sbjct: 159 CGHWHIPWVWRLN----DMLVISAGTVCSSKVRGKMSQCYNFIEVDAPESDCKRWHLQVC 214

Query: 285 RYTLSPDSLSI 295
           R     +   +
Sbjct: 215 RVFSRGEKEKV 225


>gi|282852223|ref|ZP_06261575.1| Ser/Thr phosphatase family protein [Lactobacillus gasseri 224-1]
 gi|282556642|gb|EFB62252.1| Ser/Thr phosphatase family protein [Lactobacillus gasseri 224-1]
          Length = 410

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 45/291 (15%), Positives = 90/291 (30%), Gaps = 35/291 (12%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           ISD HL           +    +      +  Y+ +   +  +          + +TGD+
Sbjct: 13  ISDTHLITD--SLHDDGQAFSQMQKTSQGKDLYYQETALSAFVRMAEEKKPAAIIVTGDV 70

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
                           + +     + ++PGNHD Y      +  H  K Y     +    
Sbjct: 71  TFNGERVSAERFAEIFKPL-TKTKLLVLPGNHDIY--DGWAREFHGKKQYYAGQISPRMW 127

Query: 135 KKLF----------------PYLRIRNNIALIGCSTAIATPPFSA-----NGYFGQEQAH 173
           + +F                  +++  +  LI   +       SA      G+ G+EQ  
Sbjct: 128 RNIFRTSYETAVSVDSSSLAYSVQLNPDYLLILADSNDYGKEESATAPATAGFLGKEQRK 187

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGHT 231
              + L+ A++     I  MHH       +      +   +  +K++      L+  GH 
Sbjct: 188 WIKEQLQYASQHNLRVIFCMHHNLYAHNPAVNKGYVVDDYRELRKLLAQYNVKLVFSGHI 247

Query: 232 HLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           H      I   +   P + + +AS   +       Y +  +  K   +T  
Sbjct: 248 H---AQNIMPPQNSCPAMEVVTASFCSNDQV----YGVVKVSPKEISYTCH 291


>gi|227890016|ref|ZP_04007821.1| metallophosphoesterase [Lactobacillus johnsonii ATCC 33200]
 gi|227849460|gb|EEJ59546.1| metallophosphoesterase [Lactobacillus johnsonii ATCC 33200]
          Length = 410

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 45/292 (15%), Positives = 84/292 (28%), Gaps = 39/292 (13%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           ISD HL           +    +      +  Y+ +   +  +          + +TGD+
Sbjct: 13  ISDTHLIAD--SLHDHGQAFSQMQKTSQGKDLYYQETALSAFVRMAQKKKPAAIIVTGDV 70

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
                           + +     + ++PGNHD Y      +     K Y     +    
Sbjct: 71  TFNGERVSAEKFAEIFKPLEE-TQLLVLPGNHDIY--DGWAREFRGKKQYYAGQISPRMW 127

Query: 135 KKLF----------------PYLRIRNNIALIGCSTAIATPPFSA-----NGYFGQEQAH 173
           + +F                  +++  N  LI   +       S       G+ G+EQ  
Sbjct: 128 RNIFKTSYKNAVSVDDKSLAYSVQLNPNYLLILADSNDYGKEESTTAPATAGFLGREQRR 187

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGHT 231
                L+ A++     I  MHH       +      +   +  +K++      L+  GH 
Sbjct: 188 WIKAQLQYASENNLQVIFCMHHNLYAHNPAVNKGYVVDDYRELRKLLAQYNVKLVFSGHI 247

Query: 232 HLNSLHWIKNEKKLIPV--VGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
           H      I   +   P   V  AS             Y +  +  K   +T 
Sbjct: 248 H---AQNIMLPQDPCPATEVVTASFCS------NDQGYGVVKVSPKEVSYTC 290


>gi|148239726|ref|YP_001225113.1| phosphohydrolase [Synechococcus sp. WH 7803]
 gi|147848265|emb|CAK23816.1| Predicted phosphohydrolase [Synechococcus sp. WH 7803]
          Length = 265

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 41/294 (13%), Positives = 77/294 (26%), Gaps = 51/294 (17%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L  +SD HL                        +   +  +    +   L    D +
Sbjct: 1   MPRLIQLSDPHLVARAE----------------GRVRGRSALSLFQKALAQALQEQPDLL 44

Query: 69  SITGDIVNFTCNREIFTSTH-----WLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
            +TGD  +                   +       +    GNHD                
Sbjct: 45  LVTGDCCHDETWCGYVRLRDAVDAAIQQQAARTVCLGFTAGNHDHPQ------------- 91

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                        + P +       L+  S+  A       G  G  Q    +  LR+A 
Sbjct: 92  --RLRAVLGRHWVVAPGVMDAGCWRLLVVSSHRAGG---CAGVIGGVQLSWLNTQLREAE 146

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIK 240
             G F ++ +HHPPV    +  + +     ++    +       ++L GH H +      
Sbjct: 147 TLGKFVVVALHHPPVPIGDASMDTIGLSDGEQLMDSLKRWPAVRVVLFGHIHQHWKGMAA 206

Query: 241 NEKKLIPVVGIASASQKVHS-------NKPQASYNLFYIEKKNEYWTLEGKRYT 287
             +  + ++G  S     H                L  + +          R++
Sbjct: 207 -PRSDLSLLGCPSTLVSFHPVQPCPLGRAWDPGGRLLDLMEDGS-VQERLMRWS 258


>gi|170695945|ref|ZP_02887084.1| metallophosphoesterase [Burkholderia graminis C4D1M]
 gi|170139129|gb|EDT07318.1| metallophosphoesterase [Burkholderia graminis C4D1M]
          Length = 275

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 43/297 (14%), Positives = 86/297 (28%), Gaps = 48/297 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  LA ISD+H+    +                   ++  +       ++ +       D
Sbjct: 1   ML-LAQISDLHIKRPGALA----------------YRRVDTAAHFARCVDALNALDPRPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+V+    ++       L  +  P+   ++ GNHD            A +    
Sbjct: 44  VVIMTGDLVDQGEPQQYEHLKTLLAPLQIPY--FLLVGNHDDRA---------ALRAAFP 92

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                  G +   Y      + LI   + +   P  + G     +    +  L  AN  G
Sbjct: 93  DRAELHGGDEFVQYAADIGPLRLIALDSMV---PGQSAGTLCDARLSWLAAQLDAAN--G 147

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGI----QRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              ++ +HHPP        + +        +   +I      + ++ GH H         
Sbjct: 148 KPTVVALHHPPFACGIGHMDALRLDPLAADKLAALIARYPNVERVICGHVHRPMFVRFGG 207

Query: 242 EKKLIPVVGIASASQKVHSNKP------QASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
                        +  +  + P        +Y L   +       +    Y  + D 
Sbjct: 208 TIASAVPAPAHQVALDLRDDAPSAFMMEPPAYALHRYDPATGI--VTHHAYVDAADG 262


>gi|312170994|emb|CBX79253.1| Uncharacterized protein syc0937_d [Erwinia amylovora ATCC BAA-2158]
          Length = 275

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 38/296 (12%), Positives = 79/296 (26%), Gaps = 48/296 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                      V   +  +    + D +  
Sbjct: 16  RILQITDTHLFAGKDETLLGVNTWASFD------------AVLEAVAAE--QRHYDLIVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +        +  D       
Sbjct: 62  TGDLAQDHSVEAYQHFAEGIARLSAPC--VWLPGNHDYQPTMFSTLGASSIADQKQ---- 115

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                     + I ++   +   + +   P    G   + Q     + +  A +     +
Sbjct: 116 ----------VLIGDHWQAMLLDSQVFGVPH---GELSEYQLDWLDRAM--AAEPQRHTL 160

Query: 191 IMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           I++HH P+    S  ++           ++     A  +L GH H               
Sbjct: 161 ILLHHHPLPSGCSWLDQHSLRNPHMLDAVLQRYPRAKTLLCGHIHQELDLNWHGR----R 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           V+   S   +   +        F I+ +   W               +++  + +F
Sbjct: 217 VLATPSTCVQFKPHCTN-----FTIDAEAPGWR-WLDLAADGHLETEVKRLNTRMF 266


>gi|225386378|ref|ZP_03756142.1| hypothetical protein CLOSTASPAR_00122 [Clostridium asparagiforme
           DSM 15981]
 gi|225047515|gb|EEG57761.1| hypothetical protein CLOSTASPAR_00122 [Clostridium asparagiforme
           DSM 15981]
          Length = 490

 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 40/300 (13%), Positives = 86/300 (28%), Gaps = 32/300 (10%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +  ++D+H            +    +VN    +   + +E+ +  + + +  N D + 
Sbjct: 82  TRVVLMTDMHY--LAGSLRDEGEAFTTMVNHGDGKLVNYVEEIVDAALEEAISQNADVLI 139

Query: 70  ITGDIVNFTCNREIFT-STHWLRSIGNPHDISIVPGNHD--------------AYISGAK 114
           ++GD+            +    +       + ++PGNHD                 +   
Sbjct: 140 LSGDLSLNGEEESHKELAKKLDKVEMAGIPVLVIPGNHDINNPKAAGYQGKDIYPANNTD 199

Query: 115 EKSLHAWKDYITSDTTCSTGKKLFPY-LRIRNNIALIGCSTAIATPPFSANGYFGQEQAH 173
            +           D   S       Y   +  N  L+   T    P     G    E   
Sbjct: 200 PEEFAEIYGEFGYDEANSRDSNSLSYTYYLDQNTCLLMLDTCQYEPRNLVGGMIKTETYE 259

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDT--SSLYNRMFGIQRFQKMIWHEGADLILHGHT 231
              + L +A + G   + + HH  + ++        +    R   ++      L L GH 
Sbjct: 260 WIEQQLDEAEEAGMRVLPVAHHNLLDESKVYVDDCTIEHSDRLIDLLEERNIPLFLSGHL 319

Query: 232 HLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN----EYWTLEGKRYT 287
           H+            I  V  +S +       P   Y +               ++ +R+ 
Sbjct: 320 HVQHFMQHD--DIGIYEVVTSSLAT------PPCQYGVLDYMSDESFSYRTRQVDMERWA 371


>gi|88855784|ref|ZP_01130447.1| hypothetical protein A20C1_06786 [marine actinobacterium PHSC20C1]
 gi|88815108|gb|EAR24967.1| hypothetical protein A20C1_06786 [marine actinobacterium PHSC20C1]
          Length = 305

 Score =  102 bits (254), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 45/279 (16%), Positives = 78/279 (27%), Gaps = 52/279 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           + H+SD H                             S+     L  ++       + + 
Sbjct: 15  VLHLSDTHFLAGSG----------------RLYDTLDSEAKLRQLFAELEASGSRPEAIV 58

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +          I  V GNHD   + A            T+
Sbjct: 59  FTGDLADKGDEVAYREIRAIVEPAAERLGAHIVWVMGNHDDRRNFA------------TT 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                  ++    +   N + +I   +   T P   +G+    Q      +L      G 
Sbjct: 107 LLDEPASEQPIDRVTDINGLRIISLDS---TVPGQHHGHVTDAQLLWLHNVLATPAPHGT 163

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQR--FQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ MHHPPV     L   +    +     +I       I+ GH H ++          
Sbjct: 164 --ILAMHHPPVPSVLDLAVTVELRSQKELAAVIRGSDIRSIIAGHLHYSTTATFAG---- 217

Query: 246 IPVVGIASASQK---------VHSNKPQASYNLFYIEKK 275
           IPV   ++               S     S+NL ++   
Sbjct: 218 IPVSVASATCYTQNLNVPVGGTRSQDGAQSFNLIHVYDD 256


>gi|88855248|ref|ZP_01129913.1| hypothetical protein A20C1_05181 [marine actinobacterium PHSC20C1]
 gi|88815776|gb|EAR25633.1| hypothetical protein A20C1_05181 [marine actinobacterium PHSC20C1]
          Length = 312

 Score =  102 bits (254), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/253 (13%), Positives = 64/253 (25%), Gaps = 41/253 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +AH+SD HL                            + +     +  +         + 
Sbjct: 14  IAHVSDTHLLAGGRPL----------------YGAVNTIDHLEQALAQLERSTARPQAIV 57

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +          I  V GNHD                  +S
Sbjct: 58  FTGDLADLGEPDAYKRLREVVEPAAARMKAQIIWVMGNHDERAQ-------------YSS 104

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                        + + + + +I   T   T P   +G     Q    S  L      G 
Sbjct: 105 LLFDDESDAPQDRVYMVDGLRIISFDT---TIPGYHHGDITDAQLQWLSNELATPAPHGT 161

Query: 188 FRIIMMHHPPVLD-TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
              +     P     +     +   +R  +++       IL GH H ++          I
Sbjct: 162 LLAVHHPPIPTPMLEAMGMLELQRQERLAEVLRGTDVRAILAGHLHYSTHSTFAG----I 217

Query: 247 PVVGIASASQKVH 259
           PV   ++    + 
Sbjct: 218 PVSVASATCYTLD 230


>gi|126727545|ref|ZP_01743378.1| Metallophosphoesterase [Rhodobacterales bacterium HTCC2150]
 gi|126703135|gb|EBA02235.1| Metallophosphoesterase [Rhodobacterales bacterium HTCC2150]
          Length = 263

 Score =  102 bits (254), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 41/274 (14%), Positives = 77/274 (28%), Gaps = 50/274 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN---- 64
           M  +  I+D H+    +                    +  + +    L+  I        
Sbjct: 1   MTAILQITDTHIVPDGNLVS----------------GRLETSDALARLVERITSIGHQIG 44

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
            +D V ++GD+ +             +  +  P  I ++PGNHD+  +            
Sbjct: 45  PIDAVLVSGDVSDDGSAESYARFKSLMAPLHLP--IHVIPGNHDSRETMR---------- 92

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
              +            + R   N+ LIG  T +        G    E        L  A 
Sbjct: 93  --AAFADQLPVSGPLNWCRKVGNVQLIGLDTLVEG---HGYGTLAPETLVFLKDALSNA- 146

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADL-ILHGHTHLNSLHWIK 240
             G   ++ +HHPP        + +        +  I +   +L ++ GH H   +  I 
Sbjct: 147 -DGSPVLLALHHPPFQSGIDFMDDIGLTNQSNLRDAIANHSGELRLVCGHIHCMVVTNIA 205

Query: 241 NEKKLIPVVGIASASQKV---HSNKPQASYNLFY 271
                   +   S              A Y+   
Sbjct: 206 GH----IAMSAPSPCSTFASDFRGDAPAGYHTLE 235


>gi|309789926|ref|ZP_07684503.1| metallophosphoesterase [Oscillochloris trichoides DG6]
 gi|308228058|gb|EFO81709.1| metallophosphoesterase [Oscillochloris trichoides DG6]
          Length = 268

 Score =  102 bits (254), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 46/299 (15%), Positives = 90/299 (30%), Gaps = 43/299 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            + HISD+H                            F  +VA  L         D V I
Sbjct: 4   RILHISDLHAGPP------------------------FRPQVAQHLAAQAQRLKPDLVVI 39

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           +GD V        + +   LR+   P    +V GNHD  +     + L+    Y    + 
Sbjct: 40  SGDFVQRADFASQWRAAKELRA-ALPTPQLVVAGNHDVPLFNLHLRLLNPMGRYRRHISR 98

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                   P + +       G +           G   + Q++   ++L     + +  +
Sbjct: 99  DLNPVCELPGVVVVGANTAHGLT--------FDGGRLSRSQSNTLRRILAGYGPEVYKVV 150

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK----KLI 246
           +  H             M G     +++   G DL+L GH H+ +L+  ++      +  
Sbjct: 151 VWHHPVVTPPGGKRDRTMQGAHAAMQLLDECGVDLLLSGHLHVFALNHTRDLDPSLRRGT 210

Query: 247 PVVGIASASQKVHSN--KPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            +    +++ +        + S NL  +E +     +          +          F
Sbjct: 211 LLCQCGTSTSRRGHGSEHGKNSCNLITLEDQ----QVRITHMLYDDAAAEFVPAAEHTF 265


>gi|330501593|ref|YP_004378462.1| calcineurin phosphoesterase C-terminal domain-containing protein
           [Pseudomonas mendocina NK-01]
 gi|328915879|gb|AEB56710.1| calcineurin phosphoesterase C-terminal domain-containing protein
           [Pseudomonas mendocina NK-01]
          Length = 271

 Score =  102 bits (254), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 36/278 (12%), Positives = 70/278 (25%), Gaps = 55/278 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   + +    +I  +L      D + 
Sbjct: 15  LVQLSDSHLFADADGKLLG----------------MDTCDSLQRVIQQVLEEQPQIDLIL 58

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                 + G P     + GNHD                      
Sbjct: 59  ATGDLSQDGSEASYQRFRQLTAAFGTPSR--WLAGNHDETPPMQAAC------------- 103

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
               G +L   +       ++   ++I        G+   +Q     + L +A ++    
Sbjct: 104 ---KGSELLEPVIDVGAWRIVMLDSSIPGAV---PGFLADDQLELLERTLDEAPQRH--H 155

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HH PV         +          ++     A  +L GH H          +  +
Sbjct: 156 LVCLHHHPVPIGCKWMEPIGLRNADALFAILDRHPQARAVLWGHIHQ----EFDQMRGNL 211

Query: 247 PVVGIASASQKVHS-------NKPQASYNLFYIEKKNE 277
            ++   S   +                Y    +     
Sbjct: 212 RLLASPSTCVQFAPGSEDFQVGNEAPGYRWLRLHADGG 249


>gi|145297600|ref|YP_001140441.1| cyclic AMP phosphodiesterase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850372|gb|ABO88693.1| cyclic AMP phosphodiesterase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 272

 Score =  102 bits (254), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 42/307 (13%), Positives = 81/307 (26%), Gaps = 51/307 (16%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           + +     +  L  I+D HL  S     L+             R       V   +   +
Sbjct: 5   LPQAQDGSV-RLLQITDTHLFASAEGRLLA------------VRTAESLAAVLEQV--QV 49

Query: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
             H  D +  TGD+               +  +  P  I  +PGNHD             
Sbjct: 50  NEHPFDLILATGDLSQDHSPESYQRFASMMAPLARP--IYWLPGNHD------------- 94

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
               +T     +   +    +       ++   T +   P    G  G  Q  A    LR
Sbjct: 95  DGPLMTEYLHAAGISEAKQLVGEH--WQVMLLDTQVRGKPH---GVLGDHQLAALDSALR 149

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWI 239
           +  ++     +     PV       + +        ++        IL GH H       
Sbjct: 150 QHPERHALIALHHQAVPVGCAWLDQHNLKNADDLFAVLARHPQQKTILFGHVHQ----EF 205

Query: 240 KNEKKLIPVVGIASASQKVHS-------NKPQASYNLFYIEKKNE----YWTLEGKRYTL 288
               + + ++   S   +          ++    +    +          W L   ++  
Sbjct: 206 DEVHRGVRLIASPSTCIQFKPLSDGFALDESGPGWRYLTLHPDGRVASQVWRLPVGQFVP 265

Query: 289 SPDSLSI 295
            PD+   
Sbjct: 266 DPDATGY 272


>gi|146305641|ref|YP_001186106.1| calcineurin phosphoesterase C-terminal domain-containing protein
           [Pseudomonas mendocina ymp]
 gi|145573842|gb|ABP83374.1| Calcineurin phosphoesterase C-terminal domain protein [Pseudomonas
           mendocina ymp]
          Length = 271

 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 37/277 (13%), Positives = 71/277 (25%), Gaps = 55/277 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHVS 69
           L  +SD HL        L                   +++    +I  +      +D + 
Sbjct: 15  LVQLSDSHLFAEADGKLLG----------------MDTRDSLQRVIERVQQEQAQIDLIL 58

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                 +IG P     + GNHD                      
Sbjct: 59  ATGDLSQDGSQASYQRFRQLTAAIGAPAR--WLAGNHDETPPMQAAC------------- 103

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
               G  L   +       ++   ++I        G+    Q     + L +A ++    
Sbjct: 104 ---QGSDLLEPVIDLGAWRIVMLDSSIPGAV---PGFLADSQLELLERALSEAPQRH--H 155

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           +I +HH PV         +          ++     A  +L GH H         ++  +
Sbjct: 156 LICLHHHPVPIGCKWMAPIGLRNPDALFAVLDRHPQARALLWGHVHQ----EFDQQRGNL 211

Query: 247 PVVGIASASQKVHS-------NKPQASYNLFYIEKKN 276
            ++   S   +                Y    +    
Sbjct: 212 RLLASPSTCVQFAPGSEEFQVGSEAPGYRWLRLHADG 248


>gi|158339993|ref|YP_001521163.1| phosphodiesterase, putative [Acaryochloris marina MBIC11017]
 gi|158310234|gb|ABW31849.1| phosphodiesterase, putative [Acaryochloris marina MBIC11017]
          Length = 259

 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 41/288 (14%), Positives = 82/288 (28%), Gaps = 47/288 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            LA ISD HL    +                   +     +    ++  +    +D + +
Sbjct: 6   TLAQISDTHLLADTTAL----------------LRGTNPWQSLQAVLQQVNRDQLDGILL 49

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+ +             +  +  P     +PGNHD   +  +                
Sbjct: 50  TGDLADQGSVVAYQHLMRAILPLKMPA--YWLPGNHDQVEAMHR---------------E 92

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             + +   P      +  LI  ++ + +  F   GY           +L +   K    +
Sbjct: 93  LQSPQLYGPQAIHLGSWLLISLNSVLPSAQF-GEGYLSVSALQQLQSVLTQHPHKPT--V 149

Query: 191 IMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEG-ADLILHGHTHLN--SLHWIKNEKKL 245
           I +HH PV          ++        ++       ++L GH HL+    H        
Sbjct: 150 IALHHHPVAIGIDWLDQMQVQNADALLTLLESFPQVKVVLFGHIHLDFQYQHVFSQRPSP 209

Query: 246 IPVVGIASASQK-----VHSNKPQASYNLFYIEKKNEYWTLEGKRYTL 288
           I   G  S   +        +     + L  ++    +     +R   
Sbjct: 210 IYFYGCPSTCLQVNPPVPTDHTHLPGFRLLSLDPNGTH-RTWVQRVEY 256


>gi|53718935|ref|YP_107921.1| putative phosphodiesterase [Burkholderia pseudomallei K96243]
 gi|126442276|ref|YP_001058448.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 668]
 gi|134283787|ref|ZP_01770484.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 305]
 gi|167718974|ref|ZP_02402210.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei DM98]
 gi|167815157|ref|ZP_02446837.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 91]
 gi|167893670|ref|ZP_02481072.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 7894]
 gi|167918381|ref|ZP_02505472.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei BCC215]
 gi|52209349|emb|CAH35294.1| putative phosphodiesterase [Burkholderia pseudomallei K96243]
 gi|126221769|gb|ABN85275.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 668]
 gi|134244775|gb|EBA44872.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei 305]
          Length = 275

 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 74/240 (30%), Gaps = 40/240 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M +LAHISD+H+    +                   ++  +       +  +       D
Sbjct: 1   MMLLAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNALEPRPD 44

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +            
Sbjct: 45  AVLVTGDLTDFGDDDEYAHLKALLAPLAMPY--YLLVGNHDDRAALRRAFPAR------- 95

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    +   Y      + +I   + I   P ++ G     +    +  L  A  + 
Sbjct: 96  ---VELQSGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLAGQLDAARDR- 148

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              I+ +HHPP        + M        R   ++      + +L GH H         
Sbjct: 149 -PVIVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGG 207


>gi|238026691|ref|YP_002910922.1| Ser/Thr protein phosphatase family protein [Burkholderia glumae
           BGR1]
 gi|237875885|gb|ACR28218.1| Ser/Thr protein phosphatase family protein [Burkholderia glumae
           BGR1]
          Length = 274

 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/266 (14%), Positives = 80/266 (30%), Gaps = 43/266 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+    +                   ++  +       +  +       D V 
Sbjct: 3   LAQISDLHIKRPGALA----------------YRRVDTAASLARTVARLNALAPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+ +F  + E       L  +  P+   ++ GNHD   +  +            ++ 
Sbjct: 47  ITGDLTDFGHDDEYRHLKRLLAPLAMPY--YLLIGNHDERGALRRA----------FAER 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + +I   + I      + G     +    +  L+ A   G   
Sbjct: 95  AELQTGEFVQYALDLGPLRVIALDSQITGQ---SRGMLCDARLDWLAAELQAAA--GRPV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIW-----HEGADLILHGHTHLNSLHWIKNEKK 244
           ++ +HHPP     +  +         + +      H   + +L GH H   +        
Sbjct: 150 VVALHHPPFACGIAHMDAQRLDPAAARRLETILRGHPNVERVLCGHVHRPMVARFGGTLA 209

Query: 245 LIPVVGIASASQKVH-SNKPQASYNL 269
               VG  +            +++ L
Sbjct: 210 S--AVGAPAHQVAFDLRADGPSAFTL 233


>gi|254417705|ref|ZP_05031429.1| Ser/Thr protein phosphatase family protein [Brevundimonas sp. BAL3]
 gi|196183882|gb|EDX78858.1| Ser/Thr protein phosphatase family protein [Brevundimonas sp. BAL3]
          Length = 283

 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 51/297 (17%), Positives = 87/297 (29%), Gaps = 37/297 (12%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +   SD+H                                     +        D V
Sbjct: 1   MGRVLQFSDVHFGCEHKG-------------------------AVAAALEYAHATPNDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGDI       E   +  W+R++  P    ++ GNHD        +  H W+ + T+ 
Sbjct: 36  LITGDITQKGYPVEFRAAGEWMRAM--PEPRFVIVGNHDVPYWSPVARLFHPWRAFETAT 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              +       +      +  +  +      P  + G    +Q    ++ LR+A   G  
Sbjct: 94  GFPAHDG---QFCNDTVMVRGVVTARGWQARPNWSKGVIDLDQTRRAAEALRQAPI-GAL 149

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMI-WHEGADLILHGHTHLNSLHWIKNEKKLIP 247
           RI+  HHP V    +             +I    G DLI+ GH H+     I    +   
Sbjct: 150 RILACHHPLVEMIGTPMTGDVKRGDEAALIFAEAGVDLIMTGHVHVPFALPIDLADRCSY 209

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYW-TLEGKRYTLSPD--SLSIQKDYSD 301
            VG  + S           +N    + +      L       SP       ++  + 
Sbjct: 210 AVGCGTLS--HRERGSPPGFNQVDWDARTITVTALAWDGRGYSPHQVWRLPRRQDTR 264


>gi|219522384|gb|ACL14494.1| cAMP-phosphodiesterase [Serratia marcescens]
          Length = 275

 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 37/290 (12%), Positives = 80/290 (27%), Gaps = 47/290 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                      V + +       +VD +  
Sbjct: 16  RILQITDTHLFAGEHETLLGINTYRSY------------HAVLDAI--QAQRRDVDLIVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHSQEAYRHFAAGIAQL--PAPCVWLPGNHDFQPAMV--------------DAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            + G      + + +N  ++   + +   P    G   + Q     + L+   ++    +
Sbjct: 106 AAAGIAPSKQVLLGDNWQVLMLDSQVFGVPH---GELSEYQLEWMERCLQAHPERYTLLL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++      + ++ GH H +     +       ++
Sbjct: 163 LHHHPLPSGCTWLDQHSLRNPHMLGAILLRYPKVNTVVCGHIHQDLDLEWQGR----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
              S   +   +        F I+  +  W        L PD     + +
Sbjct: 219 ATPSTCVQFKPHCTN-----FTIDDVSPGWRY----LDLLPDGRVETQVF 259


>gi|122920485|pdb|2HYO|A Chain A, Crystal Structure Of Rv0805 N97a Mutant
          Length = 280

 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 76/281 (27%), Gaps = 52/281 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           +VL HISD HL                +           + +    L+  +       D 
Sbjct: 16  YVLLHISDTHL----------------IGGDRRLYGAVDADDRLGELLEQLNQSGLRPDA 59

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYI 125
           +  TGD+ +             +          +  V G HD               +  
Sbjct: 60  IVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGAHDDR------------AELR 107

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 +        + + + + +I   T++   P   +G     Q    ++ L      
Sbjct: 108 KFLLDEAPSMAPLDRVCMIDGLRIIVLDTSV---PGHHHGEIRASQLGWLAEELATPAPD 164

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           G   I+ +HHPP+     +   +         +++       IL GH H ++        
Sbjct: 165 GT--ILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVG-- 220

Query: 244 KLIPVVGIASASQK---------VHSNKPQASYNLFYIEKK 275
             IPV   ++                       NL ++   
Sbjct: 221 --IPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPD 259


>gi|122920487|pdb|2HYP|A Chain A, Crystal Structure Of Rv0805 D66a Mutant
          Length = 280

 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/281 (14%), Positives = 76/281 (27%), Gaps = 52/281 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           +VL HISD HL                +           + +    L+  +       D 
Sbjct: 16  YVLLHISDTHL----------------IGGDRRLYGAVDADDRLGELLEQLNQSGLRPDA 59

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYI 125
           +  TGD+               +          +  V GNHD               +  
Sbjct: 60  IVFTGDLAAKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDR------------AELR 107

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                 +        + + + + +I   T++   P   +G     Q    ++ L      
Sbjct: 108 KFLLDEAPSMAPLDRVCMIDGLRIIVLDTSV---PGHHHGEIRASQLGWLAEELATPAPD 164

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
           G   I+ +HHPP+     +   +         +++       IL GH H ++        
Sbjct: 165 GT--ILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVG-- 220

Query: 244 KLIPVVGIASASQK---------VHSNKPQASYNLFYIEKK 275
             IPV   ++                       NL ++   
Sbjct: 221 --IPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPD 259


>gi|115351167|ref|YP_773006.1| metallophosphoesterase [Burkholderia ambifaria AMMD]
 gi|115281155|gb|ABI86672.1| metallophosphoesterase [Burkholderia ambifaria AMMD]
          Length = 274

 Score =  102 bits (253), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 38/278 (13%), Positives = 82/278 (29%), Gaps = 44/278 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       I  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCIAKLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD      +            +D 
Sbjct: 47  VTGDLTDFGHDDEYRHLRDLLAPLEIPY--YLMVGNHDDRAGLRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + ++   + +   P +++G     +    +  L  A  +    
Sbjct: 95  PELQDGEFVQYALDVGAVRVLALDSQV---PGASHGDLCDARLAWLAAQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH-----EGADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +      + +         +          + +L GH H            
Sbjct: 150 IVALHHPPFVSGIGHMDALRLAPAAAAKLDALLRGYPNVERVLCGHVHRTMFTRF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
                 + + + +V  +      + F +E       + 
Sbjct: 206 GTLASAVPAPAHQVAFDLRADGPSAFRLEPPAFAVHVH 243


>gi|157963374|ref|YP_001503408.1| calcineurin phosphoesterase domain-containing protein [Shewanella
           pealeana ATCC 700345]
 gi|157848374|gb|ABV88873.1| Calcineurin phosphoesterase domain protein [Shewanella pealeana
           ATCC 700345]
          Length = 279

 Score =  102 bits (253), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 44/293 (15%), Positives = 77/293 (26%), Gaps = 48/293 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  ++D HL   P    L       L                              +  
Sbjct: 17  RIVQVTDPHLFADPEAQLLGVNTANSLGAVLNTISAVNYPAHL--------------MLA 62

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGDI     N    +    +  +  P     +PGNHD                       
Sbjct: 63  TGDISQDYSNESYHSFVKAIEPVNLPC--HYLPGNHDDPRIMNLHMQGPKIFAQKR---- 116

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                       +  N  +I   + +   P    G+  + +       ++   + G   +
Sbjct: 117 -----------ILAGNWQIIMLDSTVRERPG---GHMSEAELELIDSSIK--AEPGRNVL 160

Query: 191 IMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           ++MHH PVL   +    + M     F + +        +L GH H +           + 
Sbjct: 161 LVMHHNPVLTGCNWLDQHCMDNGASFIERVAQYPQVKGLLWGHVHQSIDTKHMGPHGALH 220

Query: 248 VVGIASASQKVHSNKP-------QASYNLFYIEKKNEYWT--LEGKRYTLSPD 291
           ++   S   +     P       Q  Y L  ++      T        T SPD
Sbjct: 221 LMATPSTCIQFKPKSPYFALDALQPGYRLLELKSDGSILTNVYRVPGETFSPD 273


>gi|255263935|ref|ZP_05343277.1| metallophosphoesterase [Thalassiobium sp. R2A62]
 gi|255106270|gb|EET48944.1| metallophosphoesterase [Thalassiobium sp. R2A62]
          Length = 266

 Score =  102 bits (253), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 49/301 (16%), Positives = 91/301 (30%), Gaps = 51/301 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN---- 64
           M  +  ISD H+                         +  + +  + L+  I        
Sbjct: 1   MKTILQISDTHIVAPGG----------------RVAGRLDTADALDRLVIRIGAIRHQVG 44

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
            +D V ++GD+ +    R        +  +G P  +  +PGNHD            A   
Sbjct: 45  GLDAVLVSGDLSDDGSARSYDHFKKLIAPLGVPLHV--IPGNHD------------AHAP 90

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
              +      G     +      + LIG  T +       +G   +E        L +A 
Sbjct: 91  MRAAFADQIPGAGPINWDHRIGEVCLIGLDTLVEGQ---KHGTLTRETLAFLRAALNRA- 146

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADL-ILHGHTHLNSLHWIK 240
             G   ++ +HHPP        + +     Q F   +     +L I+ GH H   +  I 
Sbjct: 147 -DGLPVLLALHHPPFPCGIRFMDDIGLTNKQDFADAVRSYAGELRIVCGHIHAMMIQTIA 205

Query: 241 NEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYS 300
                   +   S +     ++   +   F+ ++          R+     S+ I  D  
Sbjct: 206 GH----VAISAPSPNSTFAYDRRPDAPVGFHTQEDG----CLLHRWDGGFQSIRIGPDDG 257

Query: 301 D 301
           D
Sbjct: 258 D 258


>gi|87198323|ref|YP_495580.1| metallophosphoesterase [Novosphingobium aromaticivorans DSM 12444]
 gi|87134004|gb|ABD24746.1| metallophosphoesterase [Novosphingobium aromaticivorans DSM 12444]
          Length = 287

 Score =  102 bits (253), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 39/311 (12%), Positives = 85/311 (27%), Gaps = 59/311 (18%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  +A ++DIHL + P   +                     ++  + ++ ++       D
Sbjct: 1   ML-IAQVTDIHLGFEPDSPDEFN------------------RQRLDRVLAELAAMDPRPD 41

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            +  TGD+++               ++  P  +    GNHD   + +             
Sbjct: 42  LLLATGDLIDRGDRESYERLRDAFSNL--PFPVHYALGNHDERETFSAV----------- 88

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                +       Y+     + +I   T          G F   +A      L +A    
Sbjct: 89  -FPEAAFTDGFLQYIVDAGPLRIIVLDTLEEGR---HGGAFCDVRARWLKARLDEAPD-- 142

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIW----HEGADLILHGHTHLNSLHWIKNE 242
              +I+ HHPPV    +  N        +++            ++ GH H       +  
Sbjct: 143 TRTLIVQHHPPVEVGIAWMNTDPAEPWVERLGQCLRGRTNVVGVVCGHIHRAITTAWEG- 201

Query: 243 KKLIPVVGIASAS------QKVHSNKPQASYNLFYIEKKNEYW-----TLEGKRYTLSPD 291
                V    S +       +          NL   +                 +  + D
Sbjct: 202 ---TVVATCPSTAPQVALDLRPIDPDVPDQRNLIIADPPGYALHWFNGRELITHWDTAED 258

Query: 292 SLSIQKDYSDI 302
              + +  +++
Sbjct: 259 HQVLARYDANL 269


>gi|325962027|ref|YP_004239933.1| phosphohydrolase [Arthrobacter phenanthrenivorans Sphe3]
 gi|323468114|gb|ADX71799.1| putative phosphohydrolase [Arthrobacter phenanthrenivorans Sphe3]
          Length = 309

 Score =  102 bits (253), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 45/278 (16%), Positives = 82/278 (29%), Gaps = 52/278 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           L H+SD HL+  P+                       S+     L +++       + V 
Sbjct: 15  LLHLSDPHLTGGPNPL----------------YGVVDSEARLIQLFDEVKASGARPEAVI 58

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +          +    GNHD               ++ T 
Sbjct: 59  FTGDLADKGDPEAYVKLRAIVEPACEELGAEVIWAMGNHDNR------------ANFRTG 106

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                            N + +I   T++   P   +G     Q    ++ L      G 
Sbjct: 107 LLDEPANDAPVDKSYFINGLRVITMDTSV---PGFHHGELSDSQLDWLTRQLDTPAPDGT 163

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ +HHPPV     L   +        + ++ +     IL GH H ++          
Sbjct: 164 --ILALHHPPVPSVLDLSVLVELRDQASLEAVVRNSDVRTILAGHLHYSTTASFAG---- 217

Query: 246 IPVVGIASASQKVHSNKPQAS---------YNLFYIEK 274
           IPV   +++      N P            +NL ++ +
Sbjct: 218 IPVSVASASCYTQDLNVPVGGTRGQDGGQAFNLVHVYE 255


>gi|307610670|emb|CBX00258.1| hypothetical protein LPW_20031 [Legionella pneumophila 130b]
          Length = 269

 Score =  102 bits (253), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 79/279 (28%), Gaps = 40/279 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             + HISD+H                               +V N  + +  L   D + 
Sbjct: 1   MKIIHISDLHFGM-------------------------HQPKVLNAFLQETALDKPDIIL 35

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+     + +      ++  +  P     VPGNHD        + +  ++ Y     
Sbjct: 36  ISGDLTQRGLSYQYREICSFINQL--PAQTLTVPGNHDIPFYNVPARFIFPFRQYKRYIN 93

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
              T           + + ++G ++         NG    E  +   +            
Sbjct: 94  PDIT------TTFENDCVRILGVNSVNPLQ--LKNGKLSHETLNRIERYF---KPDDEKL 142

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249
            ++  H        L+  +   Q     +      L+  GH H   L  I        + 
Sbjct: 143 NLLFFHHNFDYMEGLHKPLANAQTLLSFLKQSTIHLVCTGHLHYAHLSLIAKNNGYSCLA 202

Query: 250 GIASASQKVHSNKPQASYNLFYIEKK--NEYWTLEGKRY 286
             A +     S     SY +    +K  +  W +  + +
Sbjct: 203 LHAGSLLCPRSKDNLNSYYVIEANQKKCHITWRVFDQEH 241


>gi|268319468|ref|YP_003293124.1| hypothetical protein FI9785_990 [Lactobacillus johnsonii FI9785]
 gi|262397843|emb|CAX66857.1| hypothetical protein predicted by Glimmer/Critica [Lactobacillus
           johnsonii FI9785]
          Length = 410

 Score =  102 bits (253), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 44/292 (15%), Positives = 85/292 (29%), Gaps = 39/292 (13%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           ISD HL           +    +      +  Y+ +   +  +          + +TGD+
Sbjct: 13  ISDTHLIAD--SLHDHGQAFSQMQKTSQGKDLYYQETALSAFVRMAQKKKPAAIIVTGDV 70

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
                           + +     + ++PGNHD Y      +     K Y     +    
Sbjct: 71  TFNGERVSAEKFAEIFKPLEE-TQLLVLPGNHDIY--DGWAREFRGKKQYYAGQISPRMW 127

Query: 135 KKLF----------------PYLRIRNNIALIGCSTAIATPPFSA-----NGYFGQEQAH 173
           + +F                  +++  N  LI   +       +       G+ G+EQ  
Sbjct: 128 RNIFKTSYKNAVSVDDKSLAYSVQLNPNYLLILADSNDYGKEEATTAPATAGFLGREQRR 187

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGHT 231
                L+ A++     I  MHH   +   +      +   +  +K++      L+  GH 
Sbjct: 188 WIKAQLQYASENNLQVIFCMHHNLYVHNPAVNKGYVVDDYRELRKLLAQYNVKLVFSGHI 247

Query: 232 HLNSLHWIKNEKKLIPV--VGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
           H      I   +   P   V  AS             Y +  +  K   +T 
Sbjct: 248 H---AQNIMLPQDPCPATEVVTASFCS------NDQGYGVVKVSPKEVSYTC 290


>gi|167582385|ref|ZP_02375259.1| Ser/Thr protein phosphatase family protein [Burkholderia
           thailandensis TXDOH]
          Length = 274

 Score =  102 bits (253), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 38/237 (16%), Positives = 72/237 (30%), Gaps = 40/237 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LAHISD+H+    +                   ++  +       +  +       D V 
Sbjct: 3   LAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNALEPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +     A         
Sbjct: 47  VTGDLTDFGDDEEYAHLKSLLAPLAMPY--YLIVGNHDDRAALRRAFPARA--------- 95

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + +I   + I   P ++ G     +    +  L  A  +    
Sbjct: 96  -ELQSGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLAGQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQR----FQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
           I+ +HHPP        + M            ++      + +L GH H         
Sbjct: 150 IVALHHPPFACGIGHMDAMRLAPHASSRLDALLRRFPNVERVLCGHVHRTMFARFGG 206


>gi|261344791|ref|ZP_05972435.1| hypothetical protein PROVRUST_06056 [Providencia rustigianii DSM
           4541]
 gi|282567236|gb|EFB72771.1| 3',5'-cyclic-nucleotide phosphodiesterase [Providencia rustigianii
           DSM 4541]
          Length = 279

 Score =  102 bits (253), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 38/299 (12%), Positives = 79/299 (26%), Gaps = 50/299 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  ++D HL        L                      V + +        +D +  
Sbjct: 16  RILQVTDTHLFADTENTLLGINTYRSY------------HAVLDAIAEQ--NLPIDLIVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+V     +        +  I  P     +PGNHD   +                   
Sbjct: 62  TGDLVQDQSPKAYQHFATGIEHI--PAPCVWLPGNHDYPPAMVGT--------------L 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      + I +   ++   + +      A+G   ++Q       L    +     +
Sbjct: 106 KIAGISSAKQVFIGDEWQILMLDSQLQD---VAHGELSEQQLEWMKACLD--AEPTRTTL 160

Query: 191 IMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           IM+HH P+    +  ++            + +      +L GH H             I 
Sbjct: 161 IMLHHHPLPSGCTWLDQHSLRNSHILADYLKNYPNVKAMLCGHIHQEMDEDWHG----IR 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWT---LEGKRYTLSPDSLSIQKDYSDIF 303
           ++   S   +   +        F ++     W    L          +  + +  +  F
Sbjct: 217 LLATPSTCVQFKPHCTN-----FALDCMAPGWRYLELCIDENGHREITTHVHRLNTREF 270


>gi|219849812|ref|YP_002464245.1| metallophosphoesterase [Chloroflexus aggregans DSM 9485]
 gi|219544071|gb|ACL25809.1| metallophosphoesterase [Chloroflexus aggregans DSM 9485]
          Length = 276

 Score =  102 bits (253), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 54/293 (18%), Positives = 92/293 (31%), Gaps = 44/293 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F + HISD+H                            F+   A  LI D      D V 
Sbjct: 3   FRILHISDVHTGPP------------------------FNPAAAERLIADAHTLKPDLVV 38

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD V        + +   LR    P    +V GNHD  +    E+ LH  + Y    +
Sbjct: 39  ISGDFVQRADFAAQWRAARILRE-RLPQPQLVVAGNHDVPLFNLPERLLHPLRRYQQQIS 97

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                      +     +A++G  TA         G     Q  A  + L +      ++
Sbjct: 98  PDLNP------VFTAPGLAVVGACTAHG--WTVDGGKLYPNQMTALRQRLSQFGPD-VYK 148

Query: 190 IIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI----KNEK 243
           I++ HHP             +       +++     DL+L GH H++ +        + +
Sbjct: 149 IVVWHHPVALPPTYRRKRVTISNAHEAIRLLDELAVDLLLCGHLHISFVGNTRDFQPDVR 208

Query: 244 KLIPVVGIASASQKVHSNKPQ--ASYNLFYIEKKNEYWTLEGKRYTLSPDSLS 294
               +V   + + +          + NL  IE       ++  R     D   
Sbjct: 209 HGTYIVQSGTTTSRRGYGPEHGMNTCNLITIEHDG--ACVQHLRLDQHGDGFR 259


>gi|311693347|gb|ADP96220.1| phosphohydrolase [marine bacterium HP15]
          Length = 268

 Score =  101 bits (252), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 44/297 (14%), Positives = 87/297 (29%), Gaps = 56/297 (18%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           MT +       +  ++D HL                +     +     ++E    +I ++
Sbjct: 1   MTTKEKNRPLRVLQLTDPHL----------------MARADGDLLGVRTRESLQAVIAEV 44

Query: 61  LLH--NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSL 118
           L      D +  TGD+               L+S   P     + GNHD       +  L
Sbjct: 45  LKVHGQPDLILATGDLAQDGSVEAYRVFGESLKSFSCPS--VWIAGNHDHI-----DNLL 97

Query: 119 HAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKL 178
              ++Y  SD              I+     +   +++    F   G   + +    S+ 
Sbjct: 98  QVSREYNASDRH-----------VIQGGWQFVMLDSSVPGKVF---GALAESELAFLSET 143

Query: 179 LRKANKKGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNS 235
           L +        +I +HH PV   S    ++       F +++       ++L GH H   
Sbjct: 144 LEQHPD--IPAVIALHHHPVDIGSDWMEKIGLTNRDAFWQVLDRFPQVRIVLWGHIHQEH 201

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSN-------KPQASYNLFYIEKKNEYWTLEGKR 285
                     + ++   S   +  S             Y         + +  E +R
Sbjct: 202 ERERNG----VQLLATPSTCIQFTSGSSKFSVEDLPPGYRWLEFHDSGD-FATEVRR 253


>gi|294012653|ref|YP_003546113.1| putative phosphohydrolase [Sphingobium japonicum UT26S]
 gi|292675983|dbj|BAI97501.1| putative phosphohydrolase [Sphingobium japonicum UT26S]
          Length = 293

 Score =  101 bits (252), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 49/297 (16%), Positives = 92/297 (30%), Gaps = 47/297 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  +AH+SD+H                                +       +  H  D V
Sbjct: 1   MARIAHLSDVHFGA-------------------------HDPRIVAATEAWLQRHRPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSI-GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            I+GD        +   +  WL  +     ++ +VPGNHD  +     +     + Y   
Sbjct: 36  VISGDFTQRARPEQFRQAAAWLNRLRAAGMELLVVPGNHDVPLYDLARRFGAPLRRYKRY 95

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
            +               + +A++G +TA +      +G    +Q             +  
Sbjct: 96  ISNDLCP------FFQDDAVAILGLNTARSLT--IKDGRINHDQMDMLRASFASVAPE-K 146

Query: 188 FRIIMMHHP----PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN-- 241
            RI++ HHP    P+     L   +   +   +     G  + L GH H           
Sbjct: 147 TRILVTHHPLFAMPIGKGGELSEAVGRHEDAVRAAAEAGIHIALAGHFHRTYAEAADRMV 206

Query: 242 -EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
                  V+   +A+     N    S+N  ++ + +E   +E +      D  S Q+
Sbjct: 207 AHAGGALVIQAGTATSTRLRNAEPQSFNWLHVHRHDE---IELQVVVW--DGASFQR 258


>gi|320016771|gb|ADW00343.1| 3',5'-cyclic-nucleotide phosphodiesterase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 256

 Score =  101 bits (252), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 38/283 (13%), Positives = 74/283 (26%), Gaps = 47/283 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +I +   H  D V  
Sbjct: 16  RILQITDTHLFAGEHETLLGVNTFHSY------------RAVLDAIIAE--QHPFDLVVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHSVAAYQNFAKGISRL--PVPCVWLPGNHDFQPAM--------------FDAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      +    +  ++   + +   P+   G     Q     + L    ++    +
Sbjct: 106 AEAGIAPSKQVLAGEHWQILLLDSQVFGVPY---GELSDYQLEWMERCLIAYPERYTLIL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H +       +     ++
Sbjct: 163 LHHHPMPSGCTWLDQHSLRNAHMLAAILTRYPRVTTLLCGHIHQDLDLDWYGK----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
              S   +   +        F ++     W        L PD 
Sbjct: 219 ASPSTCVQFKPHCTN-----FTLDAVAPGWRY----LDLLPDG 252


>gi|251791332|ref|YP_003006053.1| calcineurin phosphoesterase domain-containing protein [Dickeya zeae
           Ech1591]
 gi|247539953|gb|ACT08574.1| Calcineurin phosphoesterase domain protein [Dickeya zeae Ech1591]
          Length = 275

 Score =  101 bits (252), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 38/294 (12%), Positives = 78/294 (26%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL  +     L                    + V   +       +VD ++ 
Sbjct: 16  RILQITDTHLFAAEQGTLLGVNTYRSY------------QAVLAAI--AAQQLDVDLITA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+             H +R    P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHTQDAYTHFAHGIRRFNAPC--VWLPGNHDFQPAMV--------------DVL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
             +G     ++ + ++  +I   + +   P    G   + Q     + L     +    +
Sbjct: 106 ARSGIVPSKHVLLGDHWQVILLDSQVFGVPH---GELSEYQLEWLERSLLSQPARHTLLM 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++        +L GH H               ++
Sbjct: 163 LHHHPLPSGCTWLDQHSLRNAHSLDALLARFPQVRTVLCGHIHQEMDLDWNGR----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F I+     W    +          + +   + F
Sbjct: 219 ATPSTCVQFKPHCTN-----FTIDNVAPGWRY-LELLPDGEVETQVCRLDGNEF 266


>gi|42519117|ref|NP_965047.1| hypothetical protein LJ1192 [Lactobacillus johnsonii NCC 533]
 gi|41583404|gb|AAS09013.1| hypothetical protein LJ_1192 [Lactobacillus johnsonii NCC 533]
          Length = 410

 Score =  101 bits (252), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 43/293 (14%), Positives = 84/293 (28%), Gaps = 39/293 (13%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           ISD HL           +    +      +  Y+ +   +  +          + +TGD+
Sbjct: 13  ISDTHLIAD--SLHDHGQAFSQMQKTSQGKDLYYQETALSAFVRMAQKKKPAAIIVTGDV 70

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
                           + +     + ++PGNHD Y      +     K Y     +    
Sbjct: 71  TFNGERVSAEKFAEIFKPLEE-TQLLVLPGNHDIY--DGWAREFRGKKQYYAGQISPRMW 127

Query: 135 KKLF----------------PYLRIRNNIALIGCSTAIATPPFSA-----NGYFGQEQAH 173
           + +F                  +++  +  LI   +       +       G+ G+EQ  
Sbjct: 128 RNIFKTSYKNAVSVDDESLAYSVQLNPDYLLILADSNDYGKEEATTAPATAGFLGREQRR 187

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGHT 231
                L+ A++     I  MHH       +      +   +  +K++      L+  GH 
Sbjct: 188 WIKAQLQYASENNLQVIFCMHHNLYAHNPAVNKGYVVDDYRELRKLLAQYNVKLVFSGHI 247

Query: 232 HLNSLHWIKNEKKLIPV--VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           H      I   +   P   V  AS             Y +  +  K   +T  
Sbjct: 248 H---AQNIMLPQDPCPATEVVTASFCS------NDQGYGVVKVSPKEVSYTCH 291


>gi|213965152|ref|ZP_03393350.1| putative secreted protein [Corynebacterium amycolatum SK46]
 gi|213952266|gb|EEB63650.1| putative secreted protein [Corynebacterium amycolatum SK46]
          Length = 485

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 53/305 (17%), Positives = 88/305 (28%), Gaps = 33/305 (10%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +A  +D H+            R           ++ F       L+  +    +D + +
Sbjct: 171 TIALTNDTHIGKPNH----DGIRFGNFGLSSEPGEQPFPSMQLESLLKTVKEDGIDTIVV 226

Query: 71  TGDIVNFTCNREIFTSTHWLRSIG-NPHDISIVPGNHDAYI------SGAKEKSLHAWKD 123
            GD  +     E       +   G       +  GNHD +       +G + + +   K 
Sbjct: 227 NGDCTDSNRPEEYDEFLRVMNQFGEMGKQWFVTRGNHDIHPPGLPNINGRRGRDIRKGKT 286

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           YI    +         ++     + LIG  TA       A G   + Q  A    L  A 
Sbjct: 287 YIPDYFSGLLVPTQQHWVTQVGEVRLIGLDTAEFG---YAGGRINERQMRAVRAEL--AQ 341

Query: 184 KKGFFRIIMMHHPPVL-------DTSSLYNRMFGIQRFQKMIWH-EGADLILHGHTHLNS 235
                 I+  HHP             S           QK++    GA  +  GHTH N 
Sbjct: 342 DPERPTILFAHHPITDDAVQSHLGGPSFMLERTQAAALQKILAATPGAKAVFAGHTHRNR 401

Query: 236 LHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSI 295
                        VG     ++  S      Y   +I       T   +  T    + S+
Sbjct: 402 RGVAD--------VGATDFCERGSSLGYPGGYTRIHIHTDGSQVTYH-RTRTPESLAWSV 452

Query: 296 QKDYS 300
           +  +S
Sbjct: 453 KTRWS 457


>gi|148654842|ref|YP_001275047.1| metallophosphoesterase [Roseiflexus sp. RS-1]
 gi|148566952|gb|ABQ89097.1| metallophosphoesterase [Roseiflexus sp. RS-1]
          Length = 274

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 48/285 (16%), Positives = 91/285 (31%), Gaps = 38/285 (13%)

Query: 14  HISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGD 73
           HISD+H   +                        F  +VA  L  +      D V ++GD
Sbjct: 2   HISDLHAGRT------------------------FHPQVAEQLAREAHDLRPDLVIVSGD 37

Query: 74  IVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCST 133
           +V        +           P    I+PGNHD  +    E+       Y    ++   
Sbjct: 38  LVQRADFTSQWE-QIVQYLQRLPEPRLIIPGNHDVPLFHLFERFFRPLDRYRRYISSDLN 96

Query: 134 GKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMM 193
                  +  R  + ++G ++A         GY   +Q  A  +   +         ++ 
Sbjct: 97  P------VFERPGLVVVGGNSAYG--WTIDGGYVDPDQQQAMERRFARYPDDVCKIAVLH 148

Query: 194 HHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIAS 253
           H           + +       +M+   G D++L GH H+  +      +K I      S
Sbjct: 149 HGVVRPPGCEQRSIVRNADEVTQMLERSGVDVLLCGHHHVAYVDVAGTARKFIVCQSGTS 208

Query: 254 ASQK-VHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
           AS++     + + +YN+  IE      T+   +      +   + 
Sbjct: 209 ASRRIREGTRGKNAYNVLIIEDS----TIHISQRGYVEATGRFEP 249


>gi|73670623|ref|YP_306638.1| 3',5'-cyclic-nucleotide phosphodiesterase [Methanosarcina barkeri
           str. Fusaro]
 gi|72397785|gb|AAZ72058.1| 3',5'-cyclic-nucleotide phosphodiesterase [Methanosarcina barkeri
           str. Fusaro]
          Length = 222

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 47/246 (19%), Positives = 86/246 (34%), Gaps = 31/246 (12%)

Query: 56  LINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKE 115
           +++ I     + V ITGD+     + E      ++  I   + I  VPGNHD+  +G   
Sbjct: 1   MVDGINQLEPNLVVITGDLTENGFSAEYDGVKRFIDRIECKNKIL-VPGNHDSKNAGYVH 59

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHAT 175
                   Y                 R   N+ ++G  ++    P    G+ G+E     
Sbjct: 60  FEDLFTDRYF---------------SRNFENVTVVGADSS---QPDLDEGHLGRENYGWI 101

Query: 176 SKLLRKANKKGFFRIIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
            +     N    F++  MHH   P+         +       +++     +L+L GH H+
Sbjct: 102 KEAFSGEN----FKVFAMHHHLVPIPLAGRENTVLVDAGDVLELLNRCKVNLVLCGHCHI 157

Query: 234 NSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY--WTLEGKRYTLSPD 291
             +  + N    + VV   +        K +  YNL   +K+N    W +   R     D
Sbjct: 158 PWVWNLNN----MLVVNAGTFCSSKTRGKTKQCYNLIQADKENPAGDWKVRVSRVFSKGD 213

Query: 292 SLSIQK 297
              + +
Sbjct: 214 RELVTE 219


>gi|83718557|ref|YP_443347.1| Ser/Thr protein phosphatase family protein [Burkholderia
           thailandensis E264]
 gi|167620480|ref|ZP_02389111.1| Ser/Thr protein phosphatase family protein [Burkholderia
           thailandensis Bt4]
 gi|257139593|ref|ZP_05587855.1| Ser/Thr protein phosphatase family protein [Burkholderia
           thailandensis E264]
 gi|83652382|gb|ABC36445.1| Ser/Thr protein phosphatase family protein [Burkholderia
           thailandensis E264]
          Length = 274

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 87/288 (30%), Gaps = 50/288 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LAHISD+H+    +                   ++  +       +  +       D V 
Sbjct: 3   LAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNALEPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +     A         
Sbjct: 47  VTGDLTDFGDDEEYAHLKSLLAPLAMPY--YLIVGNHDDRAALRRAFPARA--------- 95

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + +I   + I   P ++ G     +    +  L  A  +    
Sbjct: 96  -ELQSGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLAGQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQR----FQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP        + M            ++      + +L GH H            
Sbjct: 150 IVALHHPPFACGIGHMDAMRLAPHASSRLDALLRRFPNVERVLCGHVHRTMFARF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
                 + + + +V  +      + F +E            +  +PD+
Sbjct: 206 GTVASAVPAPAHQVTFDLRDDGPSSFSMEPPAFAV------HRYAPDA 247


>gi|53711726|ref|YP_097718.1| serine/threonine protein kinase related protein [Bacteroides
           fragilis YCH46]
 gi|52214591|dbj|BAD47184.1| serine/threonine protein kinase related protein [Bacteroides
           fragilis YCH46]
          Length = 621

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 80/298 (26%), Gaps = 57/298 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHV 68
           F  A ++DIHL+                             E     +  I     VD V
Sbjct: 28  FRFAQLTDIHLNP----------------------NNPKPTEDLKRSVEQINATPGVDFV 65

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+        +      L  +   +   ++PGNH+   S +   +           
Sbjct: 66  LVTGDLTEEGDRTTMLVVKSILDQLKVKY--YVIPGNHETKWSDSGCTAFSEIF------ 117

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      +         +G ++        A G+   +      + + K  K    
Sbjct: 118 -------GGERFKFEHKGFLFLGFNSGPLM--RMAYGHVVPQDITWMKQEMDKVGKDKP- 167

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
            +I++ H P+ D       +         +        + GH H N          ++  
Sbjct: 168 -VILVTHYPMQDGD-----VDNWYDVTDAVRPYNIRTFIGGHYHRNRFLSYDGIPGIL-- 219

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDT 306
                    +      + Y++F I   +    +  ++    P         +  +Y+ 
Sbjct: 220 -----TRSNLRDKNGSSGYSIFDITPDSI---ITYEQRIDEPMKRWTALSLTKSYYNR 269


>gi|251792042|ref|YP_003006762.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Aggregatibacter aphrophilus NJ8700]
 gi|247533429|gb|ACS96675.1| Icc [Aggregatibacter aphrophilus NJ8700]
          Length = 274

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/298 (13%), Positives = 89/298 (29%), Gaps = 48/298 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VD 66
           +F +  I+D HL    +   L                   ++   + ++ +I       D
Sbjct: 13  VFRIVQITDPHLFKDTNGELLG----------------INTQASFSQVLTEIQQQQYAYD 56

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V  TGD+V  + +         ++++     +  +PGNHD                   
Sbjct: 57  LVLATGDLVQDSSDEGYLHFCESVKALEK--MVFWIPGNHDFQPKM-------------- 100

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
            D   +       ++ + +   ++   + I+  P    G   + Q       L++  ++ 
Sbjct: 101 FDLLTTDNISAKKHILLGDRWQILLLDSQISGVPH---GQLSEYQLDWLLAKLKEYPQRY 157

Query: 187 FFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKL 245
              ++  H           + +        ++        ILHGH H      +  E   
Sbjct: 158 SLVVLHHHILSTHSAWLDQHNLRNAHELAYILAPFSNVKGILHGHIHQ----QVDGEWHG 213

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             V+   S   +   +      N F ++     W  E + +        +++     F
Sbjct: 214 YKVMATPSTGIQFKPDS-----NTFALDTVQPGWR-EIELHADGHIETRVKRIQHKTF 265


>gi|149913385|ref|ZP_01901918.1| Ser/Thr protein phosphatase family protein, putative [Roseobacter
           sp. AzwK-3b]
 gi|149812505|gb|EDM72334.1| Ser/Thr protein phosphatase family protein, putative [Roseobacter
           sp. AzwK-3b]
          Length = 265

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/281 (14%), Positives = 75/281 (26%), Gaps = 47/281 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV-DH 67
           M  L  ISD+H+               G +           +   + +   +      + 
Sbjct: 1   MARLLQISDLHIVAP------------GALASGRLDTPGLLRGAIDTIAARLDAIGPIEA 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           + +TGDI +         +   L  +G P  + +VPGNHD                    
Sbjct: 49  LLVTGDISDDGSAESYDLARSELDRLGLP--LLVVPGNHDCRD----------TLRSAFG 96

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
           D        L  +        +IG  T +        G    E     +  L  +     
Sbjct: 97  DLPTMPPTGLIDWHFDMGGTTVIGLDTLVEGQ---GGGRLRPESFSVLANALDASG--NR 151

Query: 188 FRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADL-ILHGHTHLNSLHWIKNEKK 244
             ++ +HHPP+       + +          ++    A + I+ GH H            
Sbjct: 152 PVLVALHHPPLRTGIRFMDAIGLENSDELAAVLERRTAPVRIVAGHVH----GVHHGALG 207

Query: 245 LIPVVGIASASQKVHSNKP----------QASYNLFYIEKK 275
              VV   S       ++              + +  I   
Sbjct: 208 PHTVVTAPSTCSAFALDRREDAPIGFMTGPTGFAVIDIGPD 248


>gi|110835357|ref|YP_694216.1| icc protein [Alcanivorax borkumensis SK2]
 gi|110648468|emb|CAL17944.1| icc protein, putative [Alcanivorax borkumensis SK2]
          Length = 268

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/278 (13%), Positives = 68/278 (24%), Gaps = 49/278 (17%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DH 67
             +  +SD HL   P    L                        + ++  I       D 
Sbjct: 8   LRVVQLSDCHLFADPEGKLLGLNTQFS----------------LDKVLELIRKEQPNPDL 51

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           +  TGD+               L     P  +  + GNHD                    
Sbjct: 52  ILATGDLSQDASYESYQRLDRTLSGFDVP--VYWLEGNHDKPAPML-------------- 95

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
               +  +K+ P +    N  ++   +   T P    G             LR A     
Sbjct: 96  QALGAHREKMSPCVLNVGNWTIVMLDS---TIPGEVPGELFDGDLSFLDSALRDATGDHL 152

Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLI 246
              +  H  P+  T      +    +F ++I        I+ GH H             +
Sbjct: 153 MVCLHHHPVPMECTWLDAQVVGSADKFFQVIDRHERVRAIIWGHVHQEYDKHRNG----V 208

Query: 247 PVVGIASASQKVHS-------NKPQASYNLFYIEKKNE 277
            ++ + S   +          +     Y    +    +
Sbjct: 209 RMMAVPSTCVQFKPKSEDFAVDDASPGYRWLDLHPNGQ 246


>gi|227523788|ref|ZP_03953837.1| metallophosphoesterase [Lactobacillus hilgardii ATCC 8290]
 gi|227089103|gb|EEI24415.1| metallophosphoesterase [Lactobacillus hilgardii ATCC 8290]
          Length = 291

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/282 (16%), Positives = 79/282 (28%), Gaps = 41/282 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDHV 68
            +  ISD HL+ +                   N +    +E    + +DI     + D +
Sbjct: 7   KIVQISDTHLTPAG--------------AKPANHQHLDPEEKLRTVFDDIYNTNVDPDLI 52

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNP--HDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            I+GD+++           H L          I ++ GNHD                +  
Sbjct: 53  VISGDLIHEGDAEAYADFHHMLDQEQERLMAPIKVILGNHD------------RTDQFYK 100

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                      + Y      +      T          GY  Q Q H     L++  + G
Sbjct: 101 GFLGKKRVATRYYYHESLEGLECYFLDTKCGD---IEQGYLDQTQLHWLKNQLQEYQRPG 157

Query: 187 FFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
              II MHHP                      +I H     I  GH H  + + +     
Sbjct: 158 ---IIFMHHPLYGPPLQQMRYSILQNGDDLLNVIDHTHVKAIFSGHVHFANSYVVDGILN 214

Query: 245 LI---PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
           ++       I  A+   H      +YN+  ++  +       
Sbjct: 215 VVADSTAYHINCANPHEHFVTDGTAYNVITVDGDDIGVEQRL 256


>gi|265765104|ref|ZP_06093379.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|263254488|gb|EEZ25922.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
          Length = 621

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/298 (12%), Positives = 80/298 (26%), Gaps = 57/298 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHV 68
           F  A ++DIHL+                             E     +  I     +D V
Sbjct: 28  FRFAQLTDIHLNP----------------------NNPKPTEDLKRSVEQINATPGIDFV 65

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+        +      L  +   +   ++PGNH+   S +   +           
Sbjct: 66  LVTGDLTEEGDRTTMLVVKSILDQLKVKY--YVIPGNHETKWSDSGCTAFSEIF------ 117

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      +         +G ++        A G+   +      + + K  K    
Sbjct: 118 -------GGERFKFEHKGFLFLGFNSGPLM--RMAYGHVVPQDITWMKQEMDKVGKDKP- 167

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
            +I++ H P+ D       +         +        + GH H N          ++  
Sbjct: 168 -VILVTHYPMQDGD-----VDNWYDVTDAVRPYNIRTFIGGHYHRNRFLSYDGIPGIL-- 219

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDT 306
                    +      + Y++F I   +    +  ++    P         +  +Y+ 
Sbjct: 220 -----TRSNLRDKNGSSGYSIFDITPDSI---ITYEQRIDEPMKRWTALSLTKSYYNR 269


>gi|90422780|ref|YP_531150.1| metallophosphoesterase [Rhodopseudomonas palustris BisB18]
 gi|90104794|gb|ABD86831.1| metallophosphoesterase [Rhodopseudomonas palustris BisB18]
          Length = 275

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/240 (14%), Positives = 64/240 (26%), Gaps = 41/240 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +A ISD+H+                         +  +       +  +       D V 
Sbjct: 7   IAQISDLHIKAEGQLA----------------YGRVDTAAALARCVATLNALTPRPDLVV 50

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+ +     E       L  +  P     VPGNHD+              + + +  
Sbjct: 51  ISGDLADTPTPEEYDHLKRLLAPLQIP--FVAVPGNHDSR-------------ELMRAAF 95

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                            + ++   +++   P    G             L  + ++    
Sbjct: 96  AGLPDHGALNQTLQVEGLQIVALDSSLHGKP---EGELEAATLQWLDATLAASAQRPA-- 150

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HHPP        +R           +I       L+  GH H   L         I
Sbjct: 151 LVFLHHPPFKAGIWHMDRQNLRNADALAAVIGRYPQVRLVAAGHVHRAVLTTFAGVAATI 210


>gi|315633835|ref|ZP_07889124.1| 3',5'-cyclic-nucleotide phosphodiesterase [Aggregatibacter segnis
           ATCC 33393]
 gi|315477085|gb|EFU67828.1| 3',5'-cyclic-nucleotide phosphodiesterase [Aggregatibacter segnis
           ATCC 33393]
          Length = 275

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/301 (11%), Positives = 90/301 (29%), Gaps = 47/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN- 64
              +F +  I+D HL    +   L                   ++   + ++++I     
Sbjct: 10  QQDVFRIVQITDPHLFKDTNGELLG----------------INTQASFSQVLSEIQQQQY 53

Query: 65  -VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D V  TGD+V    +         ++++ N   +  +PGNHD                
Sbjct: 54  DYDLVLATGDLVQDNSDEGYLRFRQDVKALNNKM-VFWIPGNHDFQPKM----------- 101

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
               +           ++ + +   ++   + +   P    G    E+       L++  
Sbjct: 102 ---FEILKEETVSAKKHILLGDKWQILLLDSQVQGVPH---GQLEAEELDWLKLKLQEYP 155

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNE 242
           ++    ++  H           + +       +++        +L+GH H      + +E
Sbjct: 156 ERYSLVVLHHHLLSTGSAWLDQHNLRNANELAEVLAPFKHVKALLYGHIHQ----QVDSE 211

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                V+   S   +  ++      N F ++     W  E   +        +++     
Sbjct: 212 WLGYQVMATPSTCIQFKADS-----NTFALDVAQPGWR-EIDLHADGHIETRVKRIQQAS 265

Query: 303 F 303
           F
Sbjct: 266 F 266


>gi|167836151|ref|ZP_02463034.1| Ser/Thr protein phosphatase family protein [Burkholderia
           thailandensis MSMB43]
          Length = 274

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/237 (16%), Positives = 71/237 (29%), Gaps = 40/237 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LAHISD+H+    +                   ++  +       +  +       D V 
Sbjct: 3   LAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNALEPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +               
Sbjct: 47  VTGDLTDFGDDDEYAHLKSLLAPLAMPY--YLIVGNHDDRAALRRA----------FPWR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                     Y      + +I   + I   P ++ G     +    +  L  A  +    
Sbjct: 95  AELQSGAFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLAGQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
           I+ +HHPP        + M        R   ++      + +L GH H         
Sbjct: 150 IVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRFPNVERVLCGHVHRTMFARFGG 206


>gi|126175771|ref|YP_001051920.1| calcineurin phosphoesterase C-terminal domain-containing protein
           [Shewanella baltica OS155]
 gi|152999323|ref|YP_001365004.1| calcineurin phosphoesterase domain-containing protein [Shewanella
           baltica OS185]
 gi|160873938|ref|YP_001553254.1| calcineurin phosphoesterase domain-containing protein [Shewanella
           baltica OS195]
 gi|217971999|ref|YP_002356750.1| Calcineurin phosphoesterase domain-containing protein [Shewanella
           baltica OS223]
 gi|304411166|ref|ZP_07392781.1| Calcineurin phosphoesterase domain protein [Shewanella baltica
           OS183]
 gi|307306461|ref|ZP_07586204.1| Calcineurin phosphoesterase domain protein [Shewanella baltica
           BA175]
 gi|125998976|gb|ABN63051.1| Calcineurin phosphoesterase C-terminal domain protein [Shewanella
           baltica OS155]
 gi|151363941|gb|ABS06941.1| Calcineurin phosphoesterase domain protein [Shewanella baltica
           OS185]
 gi|160859460|gb|ABX47994.1| Calcineurin phosphoesterase domain protein [Shewanella baltica
           OS195]
 gi|217497134|gb|ACK45327.1| Calcineurin phosphoesterase domain protein [Shewanella baltica
           OS223]
 gi|304350359|gb|EFM14762.1| Calcineurin phosphoesterase domain protein [Shewanella baltica
           OS183]
 gi|306910752|gb|EFN41180.1| Calcineurin phosphoesterase domain protein [Shewanella baltica
           BA175]
 gi|315266170|gb|ADT93023.1| Calcineurin phosphoesterase domain protein [Shewanella baltica
           OS678]
          Length = 279

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/279 (12%), Positives = 67/279 (24%), Gaps = 42/279 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
                 +  ++D HL   P    L               +                    
Sbjct: 12  EGESVRIVQVTDPHLFADPEAQLLGVNTGKSFDAVLNTIRAVDYPAHL------------ 59

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
             +  TGD+               +  +G P     +PGNHD                Y+
Sbjct: 60  --MLATGDLSQDYSAESYQQFVKAVTPVGLPC--HYLPGNHDDPRIM-----------YL 104

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                   G++      +  N  ++   + +   P    G   + Q     + +    + 
Sbjct: 105 HMQGEQIFGQQRI----LAGNWQILMLDSTVRGKPG---GNMAETQFELIDEAIAAHPEC 157

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
               ++  +   V  T    + M     F   +        +L GH H            
Sbjct: 158 HTLLVMHHNPIVVNCTWLDQHCMDNGAEFIARVAKYPQVKGLLWGHVHQCIDTHHNGPHG 217

Query: 245 LIPVVGIASASQKVHSNKP-------QASYNLFYIEKKN 276
            + ++   S   +     P       Q  Y L  ++   
Sbjct: 218 SMQLMATPSTCIQFKPLSPYFALDSVQPGYRLLELKADG 256


>gi|327538838|gb|EGF25484.1| metallophosphoesterase [Rhodopirellula baltica WH47]
          Length = 289

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/267 (11%), Positives = 72/267 (26%), Gaps = 27/267 (10%)

Query: 54  NLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGA 113
             L+      + D V ++GD+       +   +  +++ + +     ++PGNHD  +   
Sbjct: 6   EALLRTAPSIDPDVVVVSGDLTQRAKPEQFQQAAEFIKQLPD-VPRIVIPGNHDVPLYRI 64

Query: 114 KEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAH 173
            E+     + Y                +    +   +G  +        +NG     Q  
Sbjct: 65  MERLTDPHRYYRQYI------SNELNTVLQTPDALFVGLDSTAP-RSAISNGRIHPSQLD 117

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHL 233
                           ++  HH            M   +R   +    G +LIL GH H 
Sbjct: 118 FCRDAFGSVPDGLAKIVVAHHHFAPAPDYLHDQTMPKAKRAINLFVKLGVELILGGHLHR 177

Query: 234 NS------LHWIKNEKKLIPVVGIASASQKVHSNK--PQASYNLFYIE-----------K 274
                    +        I +V   + + +    +   + S+N   +             
Sbjct: 178 AFIGNTLDFYPGAGRAHGIVIVQCGTTTSRRGRGREKEKNSFNEIDVTEQTIIVTHHIFD 237

Query: 275 KNEYWTLEGKRYTLSPDSLSIQKDYSD 301
                     R+  +     ++     
Sbjct: 238 DQTGQFAPLSRHEFARGGRRLETASLR 264


>gi|60679962|ref|YP_210106.1| putative PQQ-binding exported phosphoesterase [Bacteroides fragilis
           NCTC 9343]
 gi|253564208|ref|ZP_04841665.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|60491396|emb|CAH06145.1| putative PQQ-binding exported phosphoesterase [Bacteroides fragilis
           NCTC 9343]
 gi|251947984|gb|EES88266.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|301161499|emb|CBW21039.1| putative PQQ-binding exported phosphoesterase [Bacteroides fragilis
           638R]
          Length = 621

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 80/298 (26%), Gaps = 57/298 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH-NVDHV 68
           F  A ++DIHL+                             E     +  I     VD V
Sbjct: 28  FRFAQLTDIHLNP----------------------NNPKPTEDLKRSVEQINATPGVDFV 65

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            +TGD+        +      L  +   +   ++PGNH+   S +   +           
Sbjct: 66  LVTGDLTEEGDRTTMLVVKSILDRLKVKY--YVIPGNHETKWSDSGCTAFSEIF------ 117

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      +         +G ++        A G+   +      + + K  K    
Sbjct: 118 -------GGERFKFEHKGFLFLGFNSGPLM--RMAYGHVVPQDITWMKQEMDKVGKDKP- 167

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
            +I++ H P+ D       +         +        + GH H N          ++  
Sbjct: 168 -VILVTHYPMQDGD-----VDNWYDVTDAVRPYNIRTFIGGHYHRNRFLSYDGIPGIL-- 219

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFYDT 306
                    +      + Y++F I   +    +  ++    P         +  +Y+ 
Sbjct: 220 -----TRSNLRDKNGSSGYSIFDITPDSI---ITYEQRIDEPMKRWTALSLTKSYYNR 269


>gi|117621551|ref|YP_858211.1| Icc protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117562958|gb|ABK39906.1| Icc protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 272

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/307 (13%), Positives = 81/307 (26%), Gaps = 51/307 (16%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           + +     +  L  I+D HL  S     L+             R       V   +    
Sbjct: 5   LPQAQDGSV-RLLQITDTHLFASAEGRLLA------------VRTAESLAAVLERV--QA 49

Query: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
             H  D +  TGD+               +  +  P  I  +PGNHD             
Sbjct: 50  NDHPFDLILATGDLSQDHSPESYQRFASMMAPLARP--IYWLPGNHD------------- 94

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
               +T     +   +    +       +I   T +   P    G  G  Q  A  + LR
Sbjct: 95  DGPLMTEYLHAAGISEAKQLVGEH--WQVILLDTQVRGKPH---GVLGDHQLAALDQALR 149

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWI 239
           +  ++     +     PV       + +        ++        IL GH H       
Sbjct: 150 QHPERHALIALHHQAVPVGCAWLDQHNLKNADDLFAVLARHPQQKTILFGHVHQ----EF 205

Query: 240 KNEKKLIPVVGIASASQKVHS-------NKPQASYNLFYIEKKNE----YWTLEGKRYTL 288
               + + ++   S   +          ++    +    +          W L   ++  
Sbjct: 206 DEVHRGVRLIASPSTCIQFKPLSDGFALDESGPGWRYLTLYPDGRIASQVWRLPVGQFVP 265

Query: 289 SPDSLSI 295
            P++   
Sbjct: 266 DPNATGY 272


>gi|331700814|ref|YP_004397773.1| metallophosphoesterase [Lactobacillus buchneri NRRL B-30929]
 gi|329128157|gb|AEB72710.1| metallophosphoesterase [Lactobacillus buchneri NRRL B-30929]
          Length = 305

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/280 (13%), Positives = 75/280 (26%), Gaps = 42/280 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
           + +  ISD HL+                     N ++         + +DI     + D 
Sbjct: 23  YRIVQISDTHLTPQ--------------NAQPANNQQIDPMLKLMQVFHDIEATQVHPDM 68

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGN--PHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
           + I+GD+++     +       +          I ++ GNHD   +          +   
Sbjct: 69  IVISGDLIHEGKAVDYRQFKKLVDREQAQFGVPIQVLLGNHDRTSAFYTGYLDKPVQP-- 126

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                       + Y    N        T          GY  ++Q     + L    + 
Sbjct: 127 -----------RYYYSLSDNGWDFYFLDTKCGD---LEPGYLDEQQLRWLKEKL---GES 169

Query: 186 GFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN-- 241
               +I MHHP +                + Q ++       I  GH +  ++       
Sbjct: 170 NRPAVIFMHHPLLGAPLENMKYSILQNGDQLQSILKGSQVKAIFTGHVYFANMFIKNGIL 229

Query: 242 -EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
                     I  ++ K H       YN+  +  +     
Sbjct: 230 NVSADSTAYHINCSNSKRHLISEGTGYNVITLSDQQTSVE 269


>gi|152978518|ref|YP_001344147.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Actinobacillus succinogenes 130Z]
 gi|150840241|gb|ABR74212.1| Calcineurin phosphoesterase domain protein [Actinobacillus
           succinogenes 130Z]
          Length = 276

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 40/292 (13%), Positives = 84/292 (28%), Gaps = 50/292 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHV 68
            +  I+D HL        L                   +    N ++ +I       D V
Sbjct: 15  RILQITDPHLFKDAGSELLG----------------INTCASFNQVLTEIQASPFEADFV 58

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+V  + +         ++ +G P  +  +PGNHD                     
Sbjct: 59  LATGDLVQDSSDEGYLRFCEMVQPLGKP--VFWLPGNHDFQPKMN------------ELL 104

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                       +       ++   + +   P    G   + Q       L+    +  +
Sbjct: 105 NKNHGNICAEKQILAGEQWQVLLLDSQVFGVPH---GNLTEYQLDWLQNKLKAQADR--Y 159

Query: 189 RIIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKL 245
            +I++HH  +   S+    + +       +++        I+HGH H             
Sbjct: 160 VLIVLHHHLLSTHSAWLDQHNLRNANELAQILAMSDNVKGIVHGHIHQTVDDLWNG---- 215

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
             V+   S   +   +      N F ++ +   W  E   +T       +++
Sbjct: 216 YRVMSTPSTCIQFKPDT-----NHFALDTQQPGWR-EIILHTDGSIETYVRR 261


>gi|53803878|ref|YP_114515.1| cyclic AMP phosphodiesterase [Methylococcus capsulatus str. Bath]
 gi|53757639|gb|AAU91930.1| cyclic AMP phosphodiesterase [Methylococcus capsulatus str. Bath]
          Length = 259

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/275 (15%), Positives = 76/275 (27%), Gaps = 52/275 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           L  ++D H+                            S      +I+       D V  T
Sbjct: 9   LLQLTDSHILPDAESRFYGS----------------DSAASLGAVIDHANQRRFDLVLFT 52

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+      +          ++  P     +PGNHD                   +    
Sbjct: 53  GDLAQEPVPQSYRRLAGICAAL--PAPCHWLPGNHDEPA---------------LARHVL 95

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
            +   L   +  R    ++   +   T P SA G     Q     + L +        ++
Sbjct: 96  ESTPLLHQPVIRRGRWLIVCLDS---TVPGSAGGSLSTGQFDLLERTLSRHPS--LHTLV 150

Query: 192 MMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPV 248
            +HH PV   S+  + M       F  ++        ++HGHTH  +   I+       V
Sbjct: 151 ALHHHPVPSGSAWMDTMILDNAGEFFAVLRRHPQVKAVVHGHTHQVADVEIEG----TRV 206

Query: 249 VGIASASQKVHS-------NKPQASYNLFYIEKKN 276
           +G  S   +          +  +  Y    +    
Sbjct: 207 LGTPSTCIQFRPASQTFALDAERPGYRWLELGPDG 241


>gi|70734047|ref|YP_257687.1| cyclic AMP phosphodiesterase [Pseudomonas fluorescens Pf-5]
 gi|68348346|gb|AAY95952.1| cyclic AMP phosphodiesterase [Pseudomonas fluorescens Pf-5]
          Length = 271

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 45/278 (16%), Positives = 79/278 (28%), Gaps = 55/278 (19%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   + +    +I+ +L      D + 
Sbjct: 15  LVQLSDSHLFAETDGTLLG----------------MNTADSLQRVIDLVLAQQPRIDLML 58

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+                R I  P     +PGNHD                      
Sbjct: 59  ATGDLSQDGTLESYQRFRQLTRQIAAPGR--WLPGNHDEPQVM----------------E 100

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             ++G  L   +    N  +    +A+   P S  GY   EQ    ++ L +A ++    
Sbjct: 101 QAASGSDLLDPVVDIGNWRITLLDSAV---PGSVPGYLQDEQLQLLTRSLSEAPERH--H 155

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HH PV    +    +     Q    +I        +L GH H      I   +  +
Sbjct: 156 LVCLHHHPVSIDCAWMEPIGLRNAQALFAVIDAFPQVRAVLWGHVHQ----EIDRLRGDV 211

Query: 247 PVVGIASASQKVHS-------NKPQASYNLFYIEKKNE 277
            ++   S   +           +    Y    +     
Sbjct: 212 RLLASPSTCIQFEPLSDDFKVEEQVPGYRWLRLLPDGR 249


>gi|319795890|ref|YP_004157530.1| metallophosphoesterase [Variovorax paradoxus EPS]
 gi|315598353|gb|ADU39419.1| metallophosphoesterase [Variovorax paradoxus EPS]
          Length = 264

 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 43/261 (16%), Positives = 81/261 (31%), Gaps = 38/261 (14%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +A ISD H+  +   ++                    S  +    I  +       D V 
Sbjct: 3   IAQISDPHVRPAGQLYQ----------------GVVDSNRMFEEAIAHLHALDRRPDLVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+V+   + E   +   L  +  P+   ++PGNHD                   +D 
Sbjct: 47  LTGDLVDEGRSEEYAEARRLLAKLSIPY--LVIPGNHDHR----------ENFRTAFADH 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                     Y    + + ++   + I   P   +G+   E      + L     +    
Sbjct: 95  AYLPATGALHYCIDTHPVRIVALDSCI---PGLHHGHVDAEGLAWLQRTLE--ADREKPT 149

Query: 190 IIMMHHPPVLDTSSLY--NRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++M+HHPP           R       + ++   G  + +L GH H   L          
Sbjct: 150 LLMLHHPPFTSGIPYMDSYRYIDTAPLEAIVRSVGNIERVLCGHVHRTMLKRWAGTVVCS 209

Query: 247 PVVGIASASQKVHSNKPQASY 267
                   + ++  +   ASY
Sbjct: 210 CPSSTTEIALQLAPDAAPASY 230


>gi|301155951|emb|CBW15421.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Haemophilus
           parainfluenzae T3T1]
          Length = 274

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 41/304 (13%), Positives = 89/304 (29%), Gaps = 52/304 (17%)

Query: 1   MTKRYT----TIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLL 56
           M  R+     + +  L  I+D HL    S   L                   + E  + +
Sbjct: 1   MNNRFEYEPASEVVKLLQITDPHLFRDTSKDLLG----------------INTHESFSQV 44

Query: 57  INDILLH--NVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAK 114
           + +I L     D V  TGD+V  + +         ++ +     +  +PGNHD       
Sbjct: 45  LKEIQLEPFEYDVVLATGDLVQDSSDEGYLRFVEMVKPLNK--SVFWLPGNHDFQPKMV- 101

Query: 115 EKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHA 174
                        +    +      +L +  +  +I   + ++  P    G     Q   
Sbjct: 102 -------------EHLSQSPINASKHLLLGKHWQVILLDSQVSGVPH---GELSAYQLDW 145

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHL 233
               L +   +    ++  H  P        + +     F  ++        IL+GH H 
Sbjct: 146 LKTKLAENPARHSLVVLHHHLLPTNSAWLDQHNLRNAHGFSAVLAQFNNVKGILYGHIHQ 205

Query: 234 NSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSL 293
                +    +    +   +   +   +      N F ++     W  E + +       
Sbjct: 206 ----QVDGYWQGYQTMATPATCIQFKPDS-----NHFALDTLQPGWR-EIELHPDGRIET 255

Query: 294 SIQK 297
            +++
Sbjct: 256 RVKR 259


>gi|330816117|ref|YP_004359822.1| Ser/Thr protein phosphatase family protein [Burkholderia gladioli
           BSR3]
 gi|327368510|gb|AEA59866.1| Ser/Thr protein phosphatase family protein [Burkholderia gladioli
           BSR3]
          Length = 274

 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/270 (15%), Positives = 84/270 (31%), Gaps = 44/270 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+    +                   ++  +       +  +       D V 
Sbjct: 3   LAQISDLHIKRPGALA----------------YRRVDTAASLARTVARLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD                 + ++ 
Sbjct: 47  VTGDLTDFGHDDEYQHLKRLLAPLEIPY--YLLIGNHDERG----------ALRRVFAER 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
               G +   Y      + +I   + I      + G   Q +    ++ L  A   G   
Sbjct: 95  AELQGGEFVQYALDLGPLRVIALDSQITGQ---SAGTLCQARLDWLARELEAAA--GRPT 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMI-----WHEGADLILHGHTHLNSLHWIKNEKK 244
           ++ +HHPP     +  +R        + +      H   + +L GH H            
Sbjct: 150 VVALHHPPFASGIAHMDRQRLDPEAARRLDALLRAHPNVERVLCGHVHRTMFARF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEK 274
                 + + + +V  +      + F IE 
Sbjct: 206 GTLASAVPAPAHQVAFDLRTDGPSAFAIEP 235


>gi|167587551|ref|ZP_02379939.1| metallophosphoesterase [Burkholderia ubonensis Bu]
          Length = 274

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/292 (14%), Positives = 88/292 (30%), Gaps = 50/292 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LAHISD+H+                        ++  +       I  +       D V 
Sbjct: 3   LAHISDLHIKRPGQLA----------------YRRVDTAAALARCIARLNALEPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +            +D 
Sbjct: 47  VTGDLTDFGNDDEYRHLRDLLAPLEIPY--YLMVGNHDDRAALRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + ++   + +   P ++ G     +    +  L  A  +    
Sbjct: 95  PEWQDGEFVQYALDVGAVRVLALDSQV---PGTSAGDLCDARLAWLAGQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH-----EGADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP        + +         +          + +L GH H            
Sbjct: 150 IVALHHPPFASGIGHMDALRLAPAAAAKLDALLRGYPNVERVLCGHVHRTMFARF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQ 296
                 + + + +V  +    + + F +E            +  +PD+  I 
Sbjct: 206 GTIASAVPAPAHQVAFDLRDNAPSAFRLEPPAFAV------HRHTPDAGVIT 251


>gi|329667348|gb|AEB93296.1| phosphohydrolase [Lactobacillus johnsonii DPC 6026]
          Length = 410

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/293 (14%), Positives = 84/293 (28%), Gaps = 39/293 (13%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           ISD HL           +    +      +  Y+ +   +  +          + +TGD+
Sbjct: 13  ISDTHLIAD--SLHDHGQAFSQMQKTSQGKDLYYQETALSAFVRMAQKKKPATIIVTGDV 70

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
                           + +     + ++PGNHD Y      +     K Y     +    
Sbjct: 71  TFNGERVSAEKFAEIFKPLEE-TQLLVLPGNHDIY--DGWAREFRGKKQYYAGQISPRMW 127

Query: 135 KKLF----------------PYLRIRNNIALIGCSTAIATPPFSA-----NGYFGQEQAH 173
           + +F                  +++  +  LI   +       +       G+ G+EQ  
Sbjct: 128 RNIFKTSYKNAVSVDDESLAYSVQLNPDYLLILADSNDYGKEEATTAPATAGFLGREQRR 187

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGHT 231
                L+ A++     I  MHH       +      +   +  +K++      L+  GH 
Sbjct: 188 WIKAQLQYASENNLQVIFCMHHNLYAHNPAVNKGYVVDDYRELRKLLAQYNVKLVFSGHI 247

Query: 232 HLNSLHWIKNEKKLIPV--VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           H      I   +   P   V  AS             Y +  +  K   +T  
Sbjct: 248 H---AQNIMLPQDPCPATEVVTASFCS------NDQGYGVVKVSPKEVSYTCH 291


>gi|242241015|ref|YP_002989196.1| calcineurin phosphoesterase [Dickeya dadantii Ech703]
 gi|242133072|gb|ACS87374.1| Calcineurin phosphoesterase domain protein [Dickeya dadantii
           Ech703]
          Length = 275

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 41/291 (14%), Positives = 78/291 (26%), Gaps = 51/291 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                      V + +       + D ++ 
Sbjct: 16  RILQITDTHLFAGEQGTLLGVDTYRSYY------------AVLDAI--AAQRLDFDLITA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+     +         +R    P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHTHEAYQHFAGGIRRFQVPC--VWLPGNHDFQPAMV--------------DAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G     ++ + ++  +I   + +   P    G     Q     + L  + + G   +
Sbjct: 106 EKAGIAPSKHVLLGDDWQVILLDSQVFGVPH---GELSDYQLEWLERRL--SAQPGRHTL 160

Query: 191 IMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           +M+HH P     S  ++           ++        +L GH H               
Sbjct: 161 LMLHHHPQPSGCSWLDQHSLRNAHSLDALLSRFPQVKTVLCGHIHQEMDIDWNGR----R 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD 298
           ++   S   +   +        F I+     W        L PD     + 
Sbjct: 217 LLATPSTCVQFKPHCTN-----FTIDNVAPGWRY----LDLLPDGSVETRV 258


>gi|149189957|ref|ZP_01868236.1| Ser/Thr protein phosphatase family protein [Vibrio shilonii AK1]
 gi|148836272|gb|EDL53230.1| Ser/Thr protein phosphatase family protein [Vibrio shilonii AK1]
          Length = 271

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 44/273 (16%), Positives = 86/273 (31%), Gaps = 43/273 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  +A ++D+H+                        +K  +       +  I       D
Sbjct: 1   ML-IAQLTDLHIKQDGKPA----------------YRKVDTLRCLQNAVQHINHLNPRPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
           +V ITGD+ +F   +E       L  +  P  +  VPGNHD                   
Sbjct: 44  YVVITGDLGDFGTEQEYQIIRQELEKLQLPLRV--VPGNHDHRD----------NLRVGL 91

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                    +   ++  ++   L+G  +++   P+   G+   +        L + + K 
Sbjct: 92  QQLVDFDHPEFCNFVVEQDEQVLLGLDSSVIGKPY---GFLSSQTLEWLQSQLARLSNKS 148

Query: 187 FFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEK 243
              +I +HHPP+       +           +++        +  GH H           
Sbjct: 149 --VLIFLHHPPMHVGLGHMDVQNLTNADSLYEVLSQFDNVRGLCAGHLHRPITATW---- 202

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           + IPV    S S  V  +    + + F +E + 
Sbjct: 203 RSIPVWVGPSHSHSVTLDLDPNAPSSFSLEPRA 235


>gi|186476263|ref|YP_001857733.1| metallophosphoesterase [Burkholderia phymatum STM815]
 gi|184192722|gb|ACC70687.1| metallophosphoesterase [Burkholderia phymatum STM815]
          Length = 275

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/237 (14%), Positives = 71/237 (29%), Gaps = 39/237 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +A ISD+H+    +                   ++  +       ++ +         + 
Sbjct: 3   IAQISDLHIKGPGALA----------------YRRVDTAPYLKRCVDRLNQLDPRPAALV 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+V+     +       L  +  P+   ++ GNHD              +       
Sbjct: 47  ITGDLVDQGTPDQYEHLKALLAPLAIPY--YLLAGNHDDRTH---------LRAAFPDRE 95

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
              TG     Y      + LI   + +   P  + G     +     + L KA  +    
Sbjct: 96  ELHTGGDFIQYAIDIGPLRLIALDSLV---PGQSAGLLCDARLAWLEQQLDKA--RHQPV 150

Query: 190 IIMMHHPPVLDTSSLYNRMFGI----QRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
           I+ +HHPP +      + +        +   +I      + ++ GH H         
Sbjct: 151 IVALHHPPFVSGIGHMDELRLEPASADKMAAIIARHPNVERVICGHVHRPMFVRFGG 207


>gi|197286193|ref|YP_002152065.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Proteus
           mirabilis HI4320]
 gi|194683680|emb|CAR44634.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Proteus
           mirabilis HI4320]
          Length = 279

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/275 (13%), Positives = 79/275 (28%), Gaps = 51/275 (18%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHV 68
            +  I+D HL                  N         +    + +++ I      +D +
Sbjct: 16  RILQITDTHL----------------FANVDDTLLGINTYRSYHAVLDAIKQQGLSIDLI 59

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+V              +  +  P     +PGNHD   +                D
Sbjct: 60  VATGDLVQDQSFAAYQHFADGIARL--PSPCVWLPGNHDYQPAMI--------------D 103

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G      + I  +  L+   + I   P    G     Q    ++ L    ++   
Sbjct: 104 ALNQAGILSAKQVLIGEHWQLLLLDSQIQGVPH---GELSDCQLDWLTRCLESHKERDT- 159

Query: 189 RIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
            +I++HH P+    +  ++       +  + +       ++L GH H             
Sbjct: 160 -VILLHHHPMPSGCTWLDQHSLRNSHQLAERVKDHPQIKMMLCGHIHQEMDEMWNG---- 214

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
           I ++   S   +   +        F ++  +  W 
Sbjct: 215 IRLLATPSTCIQFRPHCTN-----FSLDTVSPGWR 244


>gi|227357312|ref|ZP_03841669.1| phosphohydrolase [Proteus mirabilis ATCC 29906]
 gi|227162575|gb|EEI47564.1| phosphohydrolase [Proteus mirabilis ATCC 29906]
          Length = 279

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/275 (13%), Positives = 79/275 (28%), Gaps = 51/275 (18%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHV 68
            +  I+D HL                  N         +    + +++ I      +D +
Sbjct: 16  RILQITDTHL----------------FANVDDTLLGINTYRSYHAVLDAIKQQGLSIDLI 59

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+V              +  +  P     +PGNHD   +                D
Sbjct: 60  VATGDLVQDQSFAAYQHFADGIARL--PSPCVWLPGNHDYQPAMI--------------D 103

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G      + I  +  L+   + I   P    G     Q    ++ L    ++   
Sbjct: 104 ALNQAGILSAKQVLIGEHWQLLLLDSQIQGVPH---GELSDCQLDWLTRCLESHKERDT- 159

Query: 189 RIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKL 245
            +I++HH P+    +  ++       +  + +       ++L GH H             
Sbjct: 160 -VILLHHHPMPSGCTWLDQHSLRNSHQLAERVKDHPQIKMMLCGHIHQEMDEMWNG---- 214

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
           I ++   S   +   +        F ++  +  W 
Sbjct: 215 IRLLATPSTCIQFRPHCTN-----FSLDTVSPGWR 244


>gi|254252746|ref|ZP_04946064.1| hypothetical protein BDAG_01985 [Burkholderia dolosa AUO158]
 gi|124895355|gb|EAY69235.1| hypothetical protein BDAG_01985 [Burkholderia dolosa AUO158]
          Length = 275

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 88/288 (30%), Gaps = 49/288 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       +  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCVAKLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD            A +       
Sbjct: 47  VTGDLTDFGHDDEYRHLRALLAPLEIPY--YLMVGNHDDRA---------ALRRAFADRP 95

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
               G     Y      + ++   + +   P ++ G   + +    +  L  A  +G   
Sbjct: 96  ELHGGGAFVQYALDVGAVRVLALDSQV---PGTSGGDLCEARLAWLAGELDAA--RGRPT 150

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIW-----HEGADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +      + +         +      H   + +L GH H            
Sbjct: 151 IVALHHPPFVSGIGHMDALRLAPAAAAKLDALLRGHPNVERVLCGHVHRTMFTRF----G 206

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDS 292
                 + + + +V  +    + + F +E            +  +PD+
Sbjct: 207 GTLASAVPAPAHQVAFDLRADAPSAFRLEPPAFAV------HAYAPDT 248


>gi|291618369|ref|YP_003521111.1| Icc [Pantoea ananatis LMG 20103]
 gi|291153399|gb|ADD77983.1| Icc [Pantoea ananatis LMG 20103]
          Length = 276

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/270 (17%), Positives = 78/270 (28%), Gaps = 42/270 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +A ISD+H+                        KK  +       I  +       D V 
Sbjct: 8   IAQISDLHIKAHGRLS----------------YKKVDTYNALLRAIATLNGLTPRPDAVV 51

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           ITGD+V+F    E  T    L ++  P    ++ GNHD                    D 
Sbjct: 52  ITGDLVDFGTAEEYQTLRQALATLALP--FYLMAGNHDDR----------QALRAAFPDH 99

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                     + R    + L+   +++   P+   G   ++Q       L  +       
Sbjct: 100 PYLQQGPTLNWQREVKGVQLLALDSSVPQQPW---GELDEQQLDWLDAALTASPDSPA-- 154

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQK---MIWHEGADLILHGHTHLNSLHWIKNEKKLI 246
           ++M+HHPP +      +R            +  H   + +L GH H              
Sbjct: 155 LVMLHHPPFVCGIDHMDRQRLRAPAALAAIVSRHPQVERVLCGHVHRAIQTRFAG----T 210

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKN 276
                   S +V  +        F +E   
Sbjct: 211 LACIAPGVSHQVALDLQPDGPANFMLEPAG 240


>gi|322371756|ref|ZP_08046299.1| metallophosphoesterase [Haladaptatus paucihalophilus DX253]
 gi|320548641|gb|EFW90312.1| metallophosphoesterase [Haladaptatus paucihalophilus DX253]
          Length = 341

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/281 (16%), Positives = 83/281 (29%), Gaps = 47/281 (16%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +A +SD H+S                      +  + +++    +I D     VD V 
Sbjct: 46  TTVAVVSDAHVSTEKRGT---------------WKVFHRTRDRFETVIADANAREVDAVV 90

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
             GD+       +  T    L  +  PH    VPGNHD        KS  + +    S  
Sbjct: 91  FAGDLTEDGSVADFETVRSLLSDLDAPH--VAVPGNHDVP------KSFDSHETPPLSSF 142

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTA---IATPPFSANGYFGQEQAHATSKLLRKANKKG 186
             +     FP+      + +IG ++A     T     +G    +Q       L     K 
Sbjct: 143 ESAFTPDGFPFHERVGGVDVIGLNSASTPDGTLSDCHDGRISADQLAWLDDTL----PKT 198

Query: 187 FFRIIMMHHPP-------VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWI 239
              I++ HH            +      +        ++      L + GH H+ ++   
Sbjct: 199 DAPIVVSHHNLPGLCDETDAHSWRSSFPIRNATDVADVLSEHDVPLHVSGHLHVPAIAET 258

Query: 240 KNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
           +     +  +   S            +Y LF I        
Sbjct: 259 RG----VRELVAPSLCSFPQ------AYLLFEIGPLGTAVR 289


>gi|209696080|ref|YP_002264010.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Aliivibrio
           salmonicida LFI1238]
 gi|208010033|emb|CAQ80356.1| Calcineurin-like phosphoesterase [Aliivibrio salmonicida LFI1238]
          Length = 274

 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/290 (15%), Positives = 87/290 (30%), Gaps = 47/290 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            L  I+D HL   P    L    +    +     ++                 + D +  
Sbjct: 15  RLLQITDTHLFALPEGALLGVSTLKSFQSVVEQVQQQSP--------------HFDAILA 60

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGDI      +        +  +  P     +PGNHD   S                   
Sbjct: 61  TGDISQDHTVQSYQHFVEGIEPLKKPC--YWLPGNHDYKPSM--------------GGVL 104

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            S   K   +L I  +  ++   + +   P    G    EQ       L + +++    +
Sbjct: 105 PSPQIKDCEHLLIGEHWQVVILDSQVVGVPH---GALSTEQLQLLDSALSQHSERHSLIL 161

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P        +++   + F +++        IL GH H      + N    I ++
Sbjct: 162 LHHHPLPAGSAWLDQHQLKDNEVFWEVLAKHRNVSGILCGHIHQEMDCIVNN----IRLM 217

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
              S   +   +      N F ++ K   W +      L P+   + + Y
Sbjct: 218 ATPSTCVQFLPDS-----NDFALDSKAPGWRI----LDLLPNGEIVTQVY 258


>gi|237798256|ref|ZP_04586717.1| Ser/Thr protein phosphatase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331021108|gb|EGI01165.1| Ser/Thr protein phosphatase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 268

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/297 (12%), Positives = 73/297 (24%), Gaps = 54/297 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  +SD HL        L                   +++    ++  +L      D V 
Sbjct: 12  LVQLSDSHLFAEADGALLGMS----------------TRDSLEKVVERVLAEQPQIDLVV 55

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            +GDI                  I  P       GNHD                      
Sbjct: 56  ASGDISQDGSVESYEAFRQISGQIAAPARWFA--GNHDELPQM----------------E 97

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             +    L   +       +    +A+   P S  G+    Q     K L  A  +    
Sbjct: 98  HVAQSDGLLDPVIDIGQWRITLLDSAV---PGSVPGFLAAGQLQLLEKSLSDAPDRH--H 152

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HH PV         +          ++        +L GH H          +  +
Sbjct: 153 LVCLHHHPVAIGCEWMAPIGLRNADALFAVLDRFAQVKAVLWGHVHQ----EFDEMRNGV 208

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            ++   S   +            F ++     +    + +       ++ +     F
Sbjct: 209 RLLASPSTCIQFAPGSVD-----FKVDTSAPGYR-WLRLHDDGRLETAVSRVTGMAF 259


>gi|254188310|ref|ZP_04894821.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|157935989|gb|EDO91659.1| Ser/Thr protein phosphatase family protein [Burkholderia
           pseudomallei Pasteur 52237]
          Length = 274

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/237 (16%), Positives = 72/237 (30%), Gaps = 40/237 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LAHISD+H+    +                   ++  +       +  +       D V 
Sbjct: 3   LAHISDLHIKRPGALA----------------YRRVDTAAHLARCVARLNALEPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +               
Sbjct: 47  VTGDLTDFGDDDEYAHLKALLAPLAMPY--YLLVGNHDDRAALRRAFPAR---------- 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + +I   + I   P ++ G     +    +  L  A  +    
Sbjct: 95  VELQSGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLADQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
           I+ +HHPP        + M        R   ++      + +L GH H         
Sbjct: 150 IVALHHPPFACGIGHMDAMRLAPDASSRLDALLRRHPNVERVLCGHVHRTMFARFGG 206


>gi|308188125|ref|YP_003932256.1| hypothetical protein Pvag_2647 [Pantoea vagans C9-1]
 gi|308058635|gb|ADO10807.1| Uncharacterized protein [Pantoea vagans C9-1]
          Length = 275

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/296 (11%), Positives = 78/296 (26%), Gaps = 48/296 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                      V + +I      + D +  
Sbjct: 16  RILQITDTHLFAGKHESLLGVNTWSSYD------------AVLDAIIAQ--QRDYDLIIA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +     +      +      
Sbjct: 62  TGDLAQDHSVEAYQHFAEGISRL--PRPCVWLPGNHDFQPAMVDTLAAAHINAHKQ---- 115

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
                     + +     ++   + +   P    G     Q       L +  ++    +
Sbjct: 116 ----------VLVGEQWQIVLLDSQVYGVPH---GMLSDYQLEWLDNALSRFPQRHT--L 160

Query: 191 IMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
           +++HH P+    +  ++       +   ++     A  ++ GH H               
Sbjct: 161 VLLHHHPLASGCTWLDQHSLRNSHQLDAVLQRYPLARTLVCGHIHQELDLEWHGR----R 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           V+   S   +   +        F I+     W      +        + +  +D F
Sbjct: 217 VLATPSTCVQFKPHCTS-----FTIDTVAPGWR-WFTLHPDGGLETEVNRLDTDAF 266


>gi|37222192|gb|AAP70394.1| Uvs099 [uncultured bacterium]
          Length = 238

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/242 (14%), Positives = 72/242 (29%), Gaps = 39/242 (16%)

Query: 48  FSKEVANLLINDILLHNV--DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGN 105
            +++    +I  +       D +  +GD+                R +  P     +PGN
Sbjct: 2   NTRQSLQKVIELVREQQPQIDLIIASGDLSQDGTLESYQQFRELTRQLDAPAR--WIPGN 59

Query: 106 HDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANG 165
           HD     A                  +    L   +    N  +    +A+   P S  G
Sbjct: 60  HDEPQVMA----------------EAAVQSALLEPVVDIGNWRITLLDSAV---PGSVPG 100

Query: 166 YFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG- 222
           Y   +Q    ++ L +A ++  + ++  HH PV    +    +     + F +++     
Sbjct: 101 YLQDDQLQLLARSLSEAPQR--YHLVCFHHHPVSIGCAWMEPIGLRNPEAFFEVLDRFPQ 158

Query: 223 ADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHS-------NKPQASYNLFYIEKK 275
              +L GH H      I   +  + ++   S   +           +    Y    +   
Sbjct: 159 VRAVLWGHVHQ----EIDQWRDDVRLIASPSTCIQFEPGSEDFKVGEQAPGYRWLRLLPD 214

Query: 276 NE 277
             
Sbjct: 215 GR 216


>gi|78213293|ref|YP_382072.1| ICC (3',5'-cyclic-nucleotide phosphodiesterase) protein
           [Synechococcus sp. CC9605]
 gi|78197752|gb|ABB35517.1| possible ICC (3',5'-cyclic-nucleotide phosphodiesterase) protein
           [Synechococcus sp. CC9605]
          Length = 253

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/288 (13%), Positives = 78/288 (27%), Gaps = 47/288 (16%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             +  +SD HL                +       +   +       +      N D V 
Sbjct: 1   MRILQLSDPHL----------------VAADQGLVRGRPALAHFERALQLGGALNPDLVL 44

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+               L        ++++PGNHD                 +  D 
Sbjct: 45  VTGDLCQDESWGGYARLRRALSQH-VRCSVALLPGNHDHP---------------LLLDA 88

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                    P   +   + ++  S+       SA G  G  Q     + LR + +     
Sbjct: 89  VLGRRWTTAPADLLVQGVRVLLLSSH---QVGSAAGALGSLQLQWLEQRLRCSERLDLPL 145

Query: 190 IIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGA-DLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HHPP+    +  + +        + ++    A   +L GH H +           +
Sbjct: 146 VVALHHPPIAIGDAGMDAIRLLDQACLEALLRPHRALRAVLFGHIHQHWQGSWSTRPD-V 204

Query: 247 PVVGIASASQKVH-------SNKPQASYNLFYIEKKNEYWTLEGKRYT 287
            ++G  S                      L  +            R++
Sbjct: 205 LLLGCPSTLCSFKAVQPCPLGRADDPGGRLVELTADGAIQH-RVLRWS 251


>gi|194746209|ref|XP_001955573.1| GF18837 [Drosophila ananassae]
 gi|190628610|gb|EDV44134.1| GF18837 [Drosophila ananassae]
          Length = 687

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 52/340 (15%), Positives = 93/340 (27%), Gaps = 51/340 (15%)

Query: 2   TKRYTTIMFVLAHISDIHLSYSP---------------SFFELSPKRIIGLVNWHFNRKK 46
           T RY+     + H SDIH                     + + +         W   R  
Sbjct: 211 TDRYSETDLKICHFSDIHYDPLYLPGSLATCAEPMCCQRYKDTAEGTSDAAGYWGDYRGC 270

Query: 47  YFSKEVANLLINDILL-HNVDHVSITGDIVNFTCN--------REIFTSTHWLRSIGNPH 97
                     + +++  H  D+V  TGD+V+              +      L+      
Sbjct: 271 DLPWHSFESALENVVANHKCDYVYQTGDVVDHMGWATSVEKNSEVLSKVNDRLKQAFGDV 330

Query: 98  DISIVPGNHDAYIS---------------GAKEKSLHAWKDYITSDTTCSTGKKLFPYLR 142
            I    GNH+ +                    E   + W  ++  +T  +  K  +  + 
Sbjct: 331 PIYPCIGNHEPHPFNLFSPEGVPDAVSTKWLYEHLYNDWSKWLPEETKDTILKGGYYTVS 390

Query: 143 IRNNIALIGCSTAI---ATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVL 199
            +    +I  ++            +G     Q       L  A K G F  ++  H P  
Sbjct: 391 PKKGFRIISINSNDCSTDNFWLYHSGSDKIPQLQWFHDTLLAAEKAGEFVHVI-THIPSG 449

Query: 200 DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVH 259
             S          R            I  G TH + +    ++K     V     +    
Sbjct: 450 VGSCWSVWAREFNRCITRFS-ATISGIFTGDTHKDEMFVHYSDKGHATAVAWTGGALTTR 508

Query: 260 SNKPQASYNLFYIEKK------NEYWTLEGKRYTLSPDSL 293
           SNK    Y ++ +  +      +  W        L+PD  
Sbjct: 509 SNKNPN-YRIYDVNPESFVVTNHHTWLFNLTAANLNPDEE 547


>gi|308050991|ref|YP_003914557.1| calcineurin phosphoesterase [Ferrimonas balearica DSM 9799]
 gi|307633181|gb|ADN77483.1| Calcineurin phosphoesterase domain protein [Ferrimonas balearica
           DSM 9799]
          Length = 275

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/285 (13%), Positives = 75/285 (26%), Gaps = 49/285 (17%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           +T +    +  LA ISD HL                  N           +  + ++  +
Sbjct: 8   LTPKDENGVIRLAQISDPHL----------------FANKAAGFLGINPWQSLSAVVEQL 51

Query: 61  LLHNV-DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLH 119
                 D + +TGDI               +  +  P     +PGNHDA    +      
Sbjct: 52  AEEAPLDLLLVTGDISQDHSATAYLHFADAVAPLALPT--YALPGNHDAPKLMS------ 103

Query: 120 AWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLL 179
                     T       +    +     ++   + +   P    G+   ++      +L
Sbjct: 104 ---------ETLRDTSVQYGRRILAGGWQILLLDSTVLGLP---AGHLALDELRWLHGVL 151

Query: 180 RKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHW 238
                      +  H  P        + +     F  ++        +L GH H     W
Sbjct: 152 NSTESCPTLVALHHHPKPTGCAWLDQHGLDNGVEFLSLLSRFPQVKAVLWGHVHQEMDLW 211

Query: 239 IKNEKKLIPVVGIASASQKVHSNKP-------QASYNLFYIEKKN 276
            +     I ++ + S S +             Q  Y +  +    
Sbjct: 212 HE----HIRLLAVPSTSIQFLPKNDGFALDLAQPGYRMLNLHPDG 252


>gi|16766483|ref|NP_462098.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|62181697|ref|YP_218114.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161616172|ref|YP_001590137.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167551904|ref|ZP_02345657.1| protein icc [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167990267|ref|ZP_02571367.1| protein icc [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168231782|ref|ZP_02656840.1| protein icc [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168238138|ref|ZP_02663196.1| protein icc [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168243009|ref|ZP_02667941.1| protein icc [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168262859|ref|ZP_02684832.1| protein icc [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168463609|ref|ZP_02697526.1| protein icc [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168819754|ref|ZP_02831754.1| protein icc [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194445585|ref|YP_002042450.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194447552|ref|YP_002047180.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194735638|ref|YP_002116138.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197251366|ref|YP_002148110.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197264530|ref|ZP_03164604.1| protein icc [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|200387173|ref|ZP_03213785.1| protein icc [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204928376|ref|ZP_03219576.1| protein icc [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|224584984|ref|YP_002638783.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|238909984|ref|ZP_04653821.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
 gi|16421739|gb|AAL22057.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|62129330|gb|AAX67033.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161365536|gb|ABX69304.1| hypothetical protein SPAB_03974 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404248|gb|ACF64470.1| protein icc [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194405856|gb|ACF66075.1| protein icc [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194711140|gb|ACF90361.1| protein icc [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195633561|gb|EDX51975.1| protein icc [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197215069|gb|ACH52466.1| protein icc [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197242785|gb|EDY25405.1| protein icc [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197288971|gb|EDY28342.1| protein icc [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|199604271|gb|EDZ02816.1| protein icc [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204322698|gb|EDZ07895.1| protein icc [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205323316|gb|EDZ11155.1| protein icc [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205331275|gb|EDZ18039.1| protein icc [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205333904|gb|EDZ20668.1| protein icc [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205337766|gb|EDZ24530.1| protein icc [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205343528|gb|EDZ30292.1| protein icc [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205348326|gb|EDZ34957.1| protein icc [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|224469512|gb|ACN47342.1| hypothetical protein SPC_3257 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261248313|emb|CBG26150.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995374|gb|ACY90259.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301159737|emb|CBW19256.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312914208|dbj|BAJ38182.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|320087635|emb|CBY97399.1| Uncharacterized protein syc0937_d [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|321225863|gb|EFX50917.1| 3',5'-cyclic-nucleotide phosphodiesterase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322613586|gb|EFY10527.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322621178|gb|EFY18036.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322624241|gb|EFY21075.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322628021|gb|EFY24810.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322633138|gb|EFY29880.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322636284|gb|EFY32992.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322643537|gb|EFY40098.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322647446|gb|EFY43935.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648631|gb|EFY45078.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322653683|gb|EFY50009.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657791|gb|EFY54059.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322663892|gb|EFY60091.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322669095|gb|EFY65246.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322672910|gb|EFY69017.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322678099|gb|EFY74162.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322681275|gb|EFY77308.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322687794|gb|EFY83761.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|322716183|gb|EFZ07754.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
 gi|323131544|gb|ADX18974.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|323195606|gb|EFZ80783.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323199712|gb|EFZ84802.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323202539|gb|EFZ87579.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323207972|gb|EFZ92918.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323212476|gb|EFZ97293.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323215042|gb|EFZ99790.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323222772|gb|EGA07137.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323224146|gb|EGA08439.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323230470|gb|EGA14588.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323235178|gb|EGA19264.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323239218|gb|EGA23268.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323244424|gb|EGA28430.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323247040|gb|EGA31006.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323253478|gb|EGA37307.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323256216|gb|EGA39952.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323262608|gb|EGA46164.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323267296|gb|EGA50780.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323269301|gb|EGA52756.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
 gi|332990049|gb|AEF09032.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. UK-1]
          Length = 275

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/296 (11%), Positives = 70/296 (23%), Gaps = 48/296 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN--VDHV 68
            +  I+D HL        L                          ++  I       D +
Sbjct: 16  RILQITDTHLFAEKHETLLGVNTWESY----------------QAVLEAIRAQQYEYDLI 59

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGD+               + S   P     +PGNHD   +                 
Sbjct: 60  VATGDLAQDQSAAAYQHFAEGIASFRAPC--VWLPGNHDFQPAM--------------YS 103

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                G      + I     ++   + +   P    G   + Q     + L  A ++   
Sbjct: 104 ALQEAGISPAKRVLIGEQWQILLLDSQVFGVPH---GELSEFQLEWLERKLADAPERQTL 160

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  H  P   +    + +        ++ +      +L GH H               
Sbjct: 161 LLLHHHPLPAGCSWLDQHSLRNAGELDSVLANFPRVKYLLCGHIHQELDLDWNGR----R 216

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
           ++   S   +   +        F ++     W    +          + +     F
Sbjct: 217 LLASPSTCVQFKPHCAN-----FTLDTIAPGWR-TLELRANGVLETEVHRLQDTRF 266


>gi|319761882|ref|YP_004125819.1| metallophosphoesterase [Alicycliphilus denitrificans BC]
 gi|330826266|ref|YP_004389569.1| metallophosphoesterase [Alicycliphilus denitrificans K601]
 gi|317116443|gb|ADU98931.1| metallophosphoesterase [Alicycliphilus denitrificans BC]
 gi|329311638|gb|AEB86053.1| metallophosphoesterase [Alicycliphilus denitrificans K601]
          Length = 279

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 48/253 (18%), Positives = 85/253 (33%), Gaps = 41/253 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           L  I+D+H+            R  G + +       + +   + ++   L    D V IT
Sbjct: 9   LVQITDLHI------------REPGRLAYGRIDTAPYLRRTVDSVLA--LRQKPDAVVIT 54

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+ +F    E       L  +G+   + ++PGNHD      +  + HA+          
Sbjct: 55  GDLSDFGREAEYAHLAGLLAPLGD-LPVYLLPGNHDERAQLRRSFARHAY---------L 104

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
             G +   Y      + LI   T     P  ++G    ++     + L     +    +I
Sbjct: 105 QGGGEFVQYSVRVGPLRLIALDTV---EPGQSHGTLCAQRLAWLERELAACRDE--PVVI 159

Query: 192 MMHHPPVLDTSSLYNRM---FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLIP 247
            MHHPP        +R+    G  +F+ ++      + I+ GH H               
Sbjct: 160 AMHHPPFRTLIGHMDRIGLLEGAAQFEAIVARHANVERIICGHLHRAIDVRFGG------ 213

Query: 248 VVGIASASQKVHS 260
              IAS       
Sbjct: 214 --TIASTCPAPGH 224


>gi|294616825|ref|ZP_06696565.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           E1636]
 gi|291590312|gb|EFF22081.1| Ser/Thr protein phosphatase family protein [Enterococcus faecium
           E1636]
          Length = 267

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/233 (16%), Positives = 70/233 (30%), Gaps = 28/233 (12%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
               H+SDIH   +      + +    + N          +     L+ ++ L   D + 
Sbjct: 1   MRFLHLSDIHFRENYQTNLFTAELFPTIKN---------PQLALEKLLQELSLTVYDFIL 51

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+V+     +       L             GNHD                +    +
Sbjct: 52  LTGDLVHEGGISDYQVLRKMLDQYFPTTPYYFCRGNHDRRSV------------FFEGMS 99

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             S     + +   +N + +I   +A  T      G     Q     + L    +KG   
Sbjct: 100 VESNETGEYIHCTNQNGLRIISLDSAQDTQ---HEGKISIGQMIQLQEWLGTPAEKGT-- 154

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
           I+++HHP               + F ++I       I  GH H  S      +
Sbjct: 155 ILLVHHPL--SWEDPSIVTEVPEGFAELIAESDILGIFVGHIHQGSSAEFAGK 205


>gi|260775394|ref|ZP_05884291.1| 3',5'-cyclic-nucleotide phosphodiesterase [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260608575|gb|EEX34740.1| 3',5'-cyclic-nucleotide phosphodiesterase [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 272

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/290 (13%), Positives = 84/290 (28%), Gaps = 48/290 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHV 68
            L  I+D HL                      +     + +  N +++ I+  +   D V
Sbjct: 13  RLLQITDTHL----------------FEATDGSLLSVNTADSFNAVVDAIVEESPAYDAV 56

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
             TGDI               +  +        +PGNHD   S                 
Sbjct: 57  LATGDISQDHSEVSYQRFEQGIVPLKKKC--FWLPGNHDFKPSMNSV------------- 101

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              S   +   ++ + +   +I   + +   P    G    +Q +   + L +  ++   
Sbjct: 102 -IPSQQIQQIDHVLLGDTWQMIMLDSQVVGVPH---GRLSDKQLNLLEEKLSQYPERYTL 157

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIP 247
            ++  H   V       + +     F +++        +L GH H +        +  + 
Sbjct: 158 ILLHHHPLLVGSVWLDQHTLKDSDDFWQVVDQHNNVKAVLCGHVHQDMNVM----RNDVR 213

Query: 248 VVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQK 297
           V+   S   +   N        F ++ ++  W  E            +++
Sbjct: 214 VMATPSTCVQFKPNSDD-----FALDYQSPGWR-ELLLRDNGEVETQVKR 257


>gi|172060167|ref|YP_001807819.1| metallophosphoesterase [Burkholderia ambifaria MC40-6]
 gi|171992684|gb|ACB63603.1| metallophosphoesterase [Burkholderia ambifaria MC40-6]
          Length = 274

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/278 (13%), Positives = 83/278 (29%), Gaps = 44/278 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       I  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCIAKLNALLPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD      +            +D 
Sbjct: 47  VTGDLTDFGHDDEYRHLRDLLAPLEIPY--YLMVGNHDDRAGLRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + ++   + +   P +++G     +    +  L  A  +    
Sbjct: 95  PELQDGEFVQYALDVGAVRVLALDSQV---PGASHGDLCDARLAWLAARLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWH-----EGADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +      + +         +          + +L GH H            
Sbjct: 150 IVALHHPPFVSGIGHMDALRLAPAAAAKLDALLRGYSNVERVLCGHVHRTMFTRF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
                 + + + +V  +    + + F +E       + 
Sbjct: 206 GTLASAVPAPAHQVAFDLRADAPSAFRLEPPAFAVHVH 243


>gi|300311856|ref|YP_003775948.1| 3',5'-cyclic-nucleotide phosphodiesterase [Herbaspirillum
           seropedicae SmR1]
 gi|300074641|gb|ADJ64040.1| 3',5'-cyclic-nucleotide phosphodiesterase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 279

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 52/302 (17%), Positives = 96/302 (31%), Gaps = 44/302 (14%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  + H+SD+H   +                            +   LI  I     D V
Sbjct: 1   MRRVIHLSDLHFGRT-------------------------DPAIIEPLIAQIHELQPDLV 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+     + +   +  +L ++  P    +VPGNHD  +     + L   + Y    
Sbjct: 36  VVSGDLTQRARSSQFRQARQFLDAL--PTPQLVVPGNHDVPLFNVAARLLQPLRKYKRHI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
           T           L + + IA++G +TA +      +G     Q     + L         
Sbjct: 94  TPDLQP------LYVDDEIAVVGINTARSLT--IQDGRVNDRQIELARRELAAVGDHLVK 145

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHG----HTHLNSLHWIKNEKK 244
            I+  H   +      +  +       +     GADL+L G     + ++S    +    
Sbjct: 146 IIVTHHPFDLPPGPQHHGLVGQALPAMRAFALCGADLLLAGHVHASSAVSSAARYRIAGY 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
              VV   +A+      +   S+N+  IE       +   R     +  +   D S  F 
Sbjct: 206 SALVVQAGTATSTRGRGE-ANSFNVLQIEAH----QIVVHRLGWRAEERAFGLDASQTFV 260

Query: 305 DT 306
             
Sbjct: 261 QR 262


>gi|107022305|ref|YP_620632.1| metallophosphoesterase [Burkholderia cenocepacia AU 1054]
 gi|116689252|ref|YP_834875.1| metallophosphoesterase [Burkholderia cenocepacia HI2424]
 gi|105892494|gb|ABF75659.1| metallophosphoesterase [Burkholderia cenocepacia AU 1054]
 gi|116647341|gb|ABK07982.1| metallophosphoesterase [Burkholderia cenocepacia HI2424]
          Length = 274

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/270 (14%), Positives = 85/270 (31%), Gaps = 44/270 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       +  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCVAKLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L ++  P+   ++ GNHD      +            +D 
Sbjct: 47  VTGDLTDFGHDEEYGNLRGLLAALEIPY--YLMIGNHDDRAGLRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + ++   + +   P +++G     +    +  L  A  +    
Sbjct: 95  AELQDGEFVQYALDVGAVRVLALDSQV---PGASHGDLCDARLAWLAAQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIW-----HEGADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +      +++         +      H   + +L GH H            
Sbjct: 150 IVALHHPPFVSGIGHMDKLRLAPAAAAKLDALLRGHPNVERVLCGHVHRTMFTRF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEK 274
                 + S + +V  +    + + F +E 
Sbjct: 206 GTLAAAVPSPAHQVAFDLRTDAPSAFRLEP 235


>gi|237751001|ref|ZP_04581481.1| serine/threonine protein phosphatase [Helicobacter bilis ATCC
           43879]
 gi|229373446|gb|EEO23837.1| serine/threonine protein phosphatase [Helicobacter bilis ATCC
           43879]
          Length = 445

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 45/291 (15%), Positives = 86/291 (29%), Gaps = 35/291 (12%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
            A +SD H+    +   +  +     +N +  +    S E+    ++DI       V I+
Sbjct: 49  FAVLSDTHI--YDTNLGVDGEAFKEYLN-NDRKMLVQSVEILESALSDIASKKPQFVLIS 105

Query: 72  GDIVNFTCNREIFTSTHWLRSIGN-PHDISIVPGNHDAYISGAK---------------E 115
           GD+               L ++        +VPGNHD   S A+               E
Sbjct: 106 GDLTKDGEISSHELLQKRLYALKAQGIQTYVVPGNHDINNSHARSFHGATTKQVKSAQKE 165

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSA-----NGYFGQE 170
                + D+  +         L   +     + + G  +              +G F  +
Sbjct: 166 DFARIYADFGYNQAIKKDPDSLSYIIEPVEGLWIFGLDSTRFRENNMKKDPIVDGKFYPQ 225

Query: 171 QAHATSKLLRKANKKGFFRIIMMHHPPVLDTSS-----LYNRMFGIQRFQKMIWHEGADL 225
                   L +AN++G   I   HH  +   +          +   Q   KM       +
Sbjct: 226 TLQWIEANLIEANRQGKAVIAFFHHGILEHYTGNATFYPEYLIENFQAIAKMFAFYNVRM 285

Query: 226 ILHGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           +  GH H N +   +   K++  +   S             Y    ++   
Sbjct: 286 VFTGHFHANDISMQEFNGKVLYDIETGSLVSAPSP------YRFVTLKDNK 330


>gi|114769077|ref|ZP_01446703.1| Ser/Thr protein phosphatase family protein [alpha proteobacterium
           HTCC2255]
 gi|114549994|gb|EAU52875.1| Ser/Thr protein phosphatase family protein [alpha proteobacterium
           HTCC2255]
          Length = 265

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 43/266 (16%), Positives = 79/266 (29%), Gaps = 45/266 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH- 67
           M  +  ISD H+                            +      LI  I    V H 
Sbjct: 1   MTTILQISDTHILPEGPLVS----------------NVLDTASSLEKLIIRINQLRVKHN 44

Query: 68  ----VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
               + ++GDI     +         +  +  P  + ++PGNHDA  +  +         
Sbjct: 45  DIECILVSGDISEDGSSDSYQRFKSIMSLLELP--VYVIPGNHDARENMREAFMA----- 97

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                    T      + +   +I LIG  T +        GY   E      K L    
Sbjct: 98  -----ENIFTKTGPLNWHKKIGHINLIGLDTLVEGQ---GGGYLMPESLEYLEKTLNNIK 149

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADL-ILHGHTHLNSLHWIK 240
            +    ++ +HHPP        + +       F+ +I +   +L ++ GH H   +  + 
Sbjct: 150 SEPT--MLALHHPPFETGIQFMDSIGLENTNEFKNIISNFTGELRVVCGHIHCMMVANLN 207

Query: 241 NEKKLIPVVGIASASQKVHSNKPQAS 266
           N       +   S       +   ++
Sbjct: 208 NHI----AISSPSPCSSFEYDTRSSA 229


>gi|157148597|ref|YP_001455916.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Citrobacter
           koseri ATCC BAA-895]
 gi|157085802|gb|ABV15480.1| hypothetical protein CKO_04424 [Citrobacter koseri ATCC BAA-895]
          Length = 275

 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/294 (12%), Positives = 73/294 (24%), Gaps = 44/294 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                    + V + +      H  D +  
Sbjct: 16  RILQITDTHLFAEKHETLLGVNTWESY------------QAVLDAI--HAGQHEYDLIVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               + S   P     +PGNHD   +                   
Sbjct: 62  TGDLAQDQTAAAYQHFAEGIASFRAPC--VWLPGNHDFQPAM--------------YSAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G      + I +   ++   + +   P    G     Q     + L  A ++    +
Sbjct: 106 QEAGISPAKRVFIGDQWQILLLDSQVFGVPH---GELSDFQLEWLERKLADAPERHTLLL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   +    + +        ++ +      +L GH H               ++
Sbjct: 163 LHHHPLPSGCSWLDQHSLRNAAELDSVLANYPRVKYLLCGHIHQELDLDWNGR----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
              S   +   +        F ++     W    + Y        + +     F
Sbjct: 219 ATPSTCVQFKPHCAN-----FTLDTIGPGWR-TLELYAEGSLETQVHRLPGTQF 266


>gi|120600196|ref|YP_964770.1| calcineurin phosphoesterase C-terminal domain-containing protein
           [Shewanella sp. W3-18-1]
 gi|146291876|ref|YP_001182300.1| calcineurin phosphoesterase C-terminal domain-containing protein
           [Shewanella putrefaciens CN-32]
 gi|120560289|gb|ABM26216.1| Calcineurin phosphoesterase C-terminal domain protein [Shewanella
           sp. W3-18-1]
 gi|145563566|gb|ABP74501.1| Calcineurin phosphoesterase C-terminal domain protein [Shewanella
           putrefaciens CN-32]
 gi|319425111|gb|ADV53185.1| Calcineurin phosphoesterase domain protein [Shewanella putrefaciens
           200]
          Length = 279

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/281 (12%), Positives = 77/281 (27%), Gaps = 46/281 (16%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
                 +  ++D HL   P    L               +                    
Sbjct: 12  EGESVRIVQVTDPHLFADPEAQLLGVNTSKSFAAVLNTIRAVDYPAH------------- 58

Query: 66  DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125
             +  TGD+               +  +G P     +PGNHD                Y+
Sbjct: 59  -IMLATGDLSQDYSAESYQQFVRAVTPVGLPC--HYLPGNHDDPRIM-----------YL 104

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                   G++      +     ++   + +   P    G+  Q Q     + +    + 
Sbjct: 105 HMQGEQIFGQQRI----LAGKWQILMLDSTVRGKPG---GHMAQSQFELIEQAIAAHPE- 156

Query: 186 GFFRIIMMHHPPVLDTSSL---YNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNE 242
             + +++MHH P+L   +    +    G +  +++  +     +L GH H       +  
Sbjct: 157 -CYTLLVMHHNPILVNCTWLDQHCMDNGAEFLERVAMYPQVKGLLWGHVHQRIDTHYEGP 215

Query: 243 KKLIPVVGIASASQKVHSNKP-------QASYNLFYIEKKN 276
              + ++   S   +     P       Q  Y L  ++   
Sbjct: 216 HGALQLMATPSTCIQFKPLSPYFALDGLQPGYRLLELKADG 256


>gi|167854492|ref|ZP_02477273.1| protein Icc-like protein [Haemophilus parasuis 29755]
 gi|167854247|gb|EDS25480.1| protein Icc-like protein [Haemophilus parasuis 29755]
          Length = 275

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/301 (11%), Positives = 89/301 (29%), Gaps = 47/301 (15%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
           ++ +  +  I+D HL                  +         + +    ++N I+  + 
Sbjct: 10  SSPIIRILQITDSHL----------------FASDTCELLGVNTTQSFQAVLNMIMKESF 53

Query: 66  --DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
             D +  TGD+V              ++ +  P  +  V GNHD              + 
Sbjct: 54  EYDLILATGDLVQDHNREAYHRFAKMVKPLVKP--LFWVAGNHD-------------LQP 98

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
            + +  +  +  K   ++ + ++  +I   + I   P    G     +     + L    
Sbjct: 99  QMRNALSIYSQIKPEKHILVGDHWQIILLDSHIQDSP---KGRLESSELAFLKRKLEVHP 155

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNE 242
           ++    ++  +  P        + +  +      +        I+HGH H          
Sbjct: 156 ERYSLIVLHHNILPTNSAWLDQHSLSNVNDLLATLKAFPKVKAIVHGHIHQEVDAQWNG- 214

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302
                ++   S   +   +      N F ++   + W  E            +++  ++ 
Sbjct: 215 ---YRILSTPSTCIQFKPHC-----NDFTLDAIPQGWR-ELCLNIDGSIDTVVKRLDNNN 265

Query: 303 F 303
           F
Sbjct: 266 F 266


>gi|270263151|ref|ZP_06191421.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Serratia
           odorifera 4Rx13]
 gi|270042839|gb|EFA15933.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Serratia
           odorifera 4Rx13]
          Length = 275

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/290 (12%), Positives = 79/290 (27%), Gaps = 47/290 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL    +   L                      V + ++      + D V  
Sbjct: 16  RILQITDTHLFAGENETLLGINTYRSY------------HAVLDAIMAQ--QRDFDLVVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+               +  +  P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHSLAAYRHFAEGIARL--PAPCVWLPGNHDFQPAMV--------------DAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
            + G      + +  N  ++   + +   P    G     Q     + L+   ++    +
Sbjct: 106 AAAGIAPSKQVLLGENWQVLLLDSQVFGVPH---GELSDYQLEWMERCLQAHPERYTLLL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++      + ++ GH H +     +       ++
Sbjct: 163 LHHHPLPSGCTWLDQHSLRNPHMLGAVLLRYPNVNTVVCGHIHQDLDLEWQGR----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
              S   +   +        F I+  +  W        L PD     + +
Sbjct: 219 ASPSTCVQFKPHCTN-----FTIDDVSPGWRY----LDLLPDGRVETQVF 259


>gi|119962173|ref|YP_946480.1| 3'',5''-cyclic-nucleotide phosphodiesterase [Arthrobacter aurescens
           TC1]
 gi|119949032|gb|ABM07943.1| putative 3'',5''-cyclic-nucleotide phosphodiesterase [Arthrobacter
           aurescens TC1]
          Length = 327

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 44/278 (15%), Positives = 80/278 (28%), Gaps = 49/278 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDHVS 69
           L H+SD+HL   P                        S      +   I         + 
Sbjct: 15  LLHLSDLHLVGGPGTLH----------------GSVDSAARLQEICEQIVASRIRPAAII 58

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGN--PHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +        +    +  + +          GNHD   +         ++     
Sbjct: 59  FTGDLADKGELEAYESLREMIEPLCDSLGAKAIWAMGNHDNRAN---------FRSAFAD 109

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
            +  S  +         N + +I   T   T P   +G   + Q    +  L      G 
Sbjct: 110 ASEASKPQDPVDRSYFVNGLRIITLDT---TVPGHHHGELSESQLDWLASELATPAPDGT 166

Query: 188 FRIIMMHHPPVL--DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ +HHPPV      ++   + G      ++ +     IL GH H ++          
Sbjct: 167 --ILALHHPPVPCVQDLAVLVELRGQAALAAVVRNTDVRTILGGHLHYSTTASFAG---- 220

Query: 246 IPVVGIASASQK---------VHSNKPQASYNLFYIEK 274
           IPV   ++                     SYN+ ++ +
Sbjct: 221 IPVSVASATCYTQDLAVRAGGQRGRDGAQSYNMIHVYE 258


>gi|13488517|ref|NP_109524.1| 3',5'-cyclic-nucleotide phosphodiesterase CpdA-like protein
           [Mesorhizobium loti MAFF303099]
 gi|14028271|dbj|BAB54863.1| 3',5'-cyclic-nucleotide phosphodiesterase CpdA homolog
           [Mesorhizobium loti MAFF303099]
          Length = 269

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 51/300 (17%), Positives = 100/300 (33%), Gaps = 46/300 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M  L H+SD+H   + S                         ++ + +  ++   + D +
Sbjct: 1   MKTLVHLSDLHFGKTES-------------------------QLVDAIAAEVRAVDSDLL 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GD+       E   +  +L S+  P    +VPGNHD  +     +++     Y    
Sbjct: 36  VVSGDLTQRARKDEFLQARAFLDSL--PGPRIVVPGNHDVPLWNVFARAMTPLSRYRRYI 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              +            + +A++G +TA +      +G     Q  A ++     +     
Sbjct: 94  EADTDP------FYADSEVAVVGINTARSLT--IKDGRINVRQLKAATEKFAHMSDD-IT 144

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRF-QKMIWHEGADLILHGHTHLN----SLHWIKNEK 243
           RI++ HHP         + + G            G D+IL GH HL+    S      + 
Sbjct: 145 RIVVTHHPFEGRDLESDDGIVGRADLAMHAFSRSGVDIILSGHQHLHRAGSSARRYLIDG 204

Query: 244 KLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
               ++   +A           S+N+  IE    +  +  +     P     +   S  F
Sbjct: 205 YAALLIQAGTAVSSRLRRA-ANSFNIIRIE----HPRISVECRAWQPSQSGFETSASYSF 259


>gi|317483936|ref|ZP_07942873.1| calcineurin-like phosphoesterase [Bilophila wadsworthia 3_1_6]
 gi|316924810|gb|EFV45959.1| calcineurin-like phosphoesterase [Bilophila wadsworthia 3_1_6]
          Length = 274

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/235 (16%), Positives = 71/235 (30%), Gaps = 34/235 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDH 67
             + H+SD HL                        +   + E   ++ + +       D 
Sbjct: 1   MRILHLSDFHLRGDGGLS----------------FRVVDTLECLRVVADHLKTLVQKPDA 44

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           + ITGD+ +             L  +  P  +  VPGNHD      +        D    
Sbjct: 45  LVITGDLADSGDAHAYSLLHEALAPLSLP--VYAVPGNHDRRDRMRELLGNWCPAD---- 98

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
               ++      Y      + L+   T     P S +G+  +  A    + L  A + G 
Sbjct: 99  ----ASVAPYLCYAVEDGPVRLVMLDTM---QPGSHSGHCPEAVAGWLERTL--AARPGV 149

Query: 188 FRIIMMHHPPVLDTSSLYN-RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
             ++ MHHPP +      +     + R   ++       +  GH H   +     
Sbjct: 150 PTLLFMHHPPFVTGMGAMDEPFENVGRLADILCRSPWVRLCCGHMHRPIVTQWAG 204


>gi|300691483|ref|YP_003752478.1| metallophosphoesterase [Ralstonia solanacearum PSI07]
 gi|299078543|emb|CBJ51198.1| putative metallophosphoesterase [Ralstonia solanacearum PSI07]
          Length = 282

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 79/257 (30%), Gaps = 42/257 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
              ++D+H+                        ++  +    +  +  IL      D + 
Sbjct: 3   FLQLTDLHIKPPGRLA----------------YRRVDTAAYLSRCVAHILAQPVRPDAIV 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSI-GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +TGD+V+     E       L  +      +  V GNHD     A++ +  A+ D++ + 
Sbjct: 47  LTGDLVDAGAPDEYAHLRALLAPLDAAGIRMLPVLGNHD-----ARDAAREAFADWLCAS 101

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              +     F Y      + LI   T     P    G  G  +       L  A  +   
Sbjct: 102 PAEAQDPHAFQYWTDLGEVRLIVLDTLDTGHPG---GRLGVPRLDWLHDALAAATAR--P 156

Query: 189 RIIMMHHPPVLDTSSLYNRM----FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
            +I MHHPP        +        I  F +++   G  + IL GH H +         
Sbjct: 157 VVIAMHHPPFATGIGHMDVQSLAVEDIPAFAQIVRAAGNVERILCGHLHRSIDVRFAG-- 214

Query: 244 KLIPVVGIASASQKVHS 260
                  +AS       
Sbjct: 215 ------TVASTCPSPAH 225


>gi|300771604|ref|ZP_07081479.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300761593|gb|EFK58414.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 627

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/291 (12%), Positives = 81/291 (27%), Gaps = 56/291 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-VDHV 68
           F  AH++D H+  +    +                            + D+     +D V
Sbjct: 32  FRFAHVTDTHVGGATGADD------------------------LRRTVKDLNAQQQLDFV 67

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI  F  + E+  +   L S+  P    ++PGNHD   S     +           
Sbjct: 68  ILSGDITEFGADAELRLAKQILDSLQLP--WYVIPGNHDGNWSENGANTFRKVF------ 119

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      +         +G ++        + G   +E       + +        
Sbjct: 120 -------GGETFFFRHKGYMFMGTNSGPNM--RMSPGQIPRENLVWMDSVFKANPDTQTP 170

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
            +I ++H P   + +              +      L   GH H N  +  +    ++  
Sbjct: 171 -LIYINHYPQDSSLN------NWFEAINRVKKRNVQLAFCGHGHANVKYNWEGIPGIM-- 221

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
                    + +      YN+  I      + ++     L     +++   
Sbjct: 222 -----GRSNLRAKDSIGGYNIVTIGDGKAVYQVKKPGQALESAWATVELKD 267


>gi|170732554|ref|YP_001764501.1| metallophosphoesterase [Burkholderia cenocepacia MC0-3]
 gi|169815796|gb|ACA90379.1| metallophosphoesterase [Burkholderia cenocepacia MC0-3]
          Length = 274

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/270 (14%), Positives = 85/270 (31%), Gaps = 44/270 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       +  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCVEKLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L ++  P+   ++ GNHD      +            +D 
Sbjct: 47  VTGDLTDFGHDEEYGNLRGLLAALEIPY--YLMIGNHDDRAGLRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + ++   + +   P +++G     +    +  L  A  +    
Sbjct: 95  AELQDGEFVQYALDVGAVRVLALDSQV---PGASHGDLCDVRLAWLAAQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIW-----HEGADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +      +++         +      H   + +L GH H            
Sbjct: 150 IVALHHPPFVSGIGHMDKLRLAPAAAAKLDALLRGHPNVERVLCGHVHRTMFTRF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEK 274
                 + S + +V  +    + + F +E 
Sbjct: 206 GTLAAAVPSPAHQVAFDLRTDAPSAFRLEP 235


>gi|329893840|ref|ZP_08269911.1| icc protein [gamma proteobacterium IMCC3088]
 gi|328923439|gb|EGG30754.1| icc protein [gamma proteobacterium IMCC3088]
          Length = 280

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 41/292 (14%), Positives = 76/292 (26%), Gaps = 50/292 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           +  I+D HL   P+   LS      L+    +  K                   D +  T
Sbjct: 20  VLQITDTHLGVEPNTPLLSMDTDDSLLAVLDSAGKVLPA--------------PDLLLAT 65

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+ +       F    + RS+        + GNHD                  T     
Sbjct: 66  GDLSDQGALNAYFRLRDYTRSVCQHQ--FWLLGNHDHAE---------------TLRQAT 108

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
              K L           ++  ++ I        G  G  Q     + L+     G   ++
Sbjct: 109 DDNKDLIRNDIRVGAWQIVMLNSQIPGQVG---GRLGPRQLALLEEALQAGADAGLNTLV 165

Query: 192 MMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEGA-DLILHGHTHLNSLHWIKNEKKLIPV 248
            +HH P    S+      +        +I        +L GH H      +   +K + +
Sbjct: 166 CLHHQPEPVGSAWIDSQAVVDADEMFAVIEQYPNAKAVLWGHVHQ----EVDYLRKSVRM 221

Query: 249 VGIASASQKVHSNKP-------QASYNLFYIEKKN--EYWTLEGKRYTLSPD 291
           +   S   +   +            +    +                + + D
Sbjct: 222 LATPSTCIQFARHSDDFKVDDLPPGFRHLQLLPDGSINTQVYRVTDRSFTVD 273


>gi|197335079|ref|YP_002157025.1| 3',5'-cyclic-nucleotide phosphodiesterase [Vibrio fischeri MJ11]
 gi|197316569|gb|ACH66016.1| 3',5'-cyclic-nucleotide phosphodiesterase [Vibrio fischeri MJ11]
          Length = 274

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/278 (13%), Positives = 77/278 (27%), Gaps = 47/278 (16%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
            +    L  I+D HL        L                   +++    ++  +L    
Sbjct: 10  ESDSIRLLQITDTHLFAPEDGALLG----------------VPTRKSFQSVVEQVLQRTP 53

Query: 66  DH--VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
           D   +  TGDI               +  +  P     +PGNHD   S            
Sbjct: 54  DFDAILATGDISQDHTVESYQHFVKGITPLKKPC--FWLPGNHDYKPSM----------- 100

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                   S       +L I  +  +I   + +   P    G    EQ       L +  
Sbjct: 101 ---GGVLPSPQISACEHLLIGQHWQVIILDSQVVGVPH---GALSDEQLTLLDNALSQHP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        +++    +F  ++      + I+ GH H      +   
Sbjct: 155 QRHSLVLLHHHPLPAGSAWLDQHQLKESDQFWSVLAKHRNVNGIVCGHIHQELDRIVNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
              + ++   S   +   +        F ++ +   W 
Sbjct: 214 ---VRLLATPSTCVQFLPDSDD-----FALDSQAPGWR 243


>gi|152964042|ref|YP_001359826.1| metallophosphoesterase [Kineococcus radiotolerans SRS30216]
 gi|151358559|gb|ABS01562.1| metallophosphoesterase [Kineococcus radiotolerans SRS30216]
          Length = 274

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/295 (9%), Positives = 65/295 (22%), Gaps = 50/295 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV-DH 67
           M  +  +SD HL  + +                       +       +  +      D 
Sbjct: 1   MTRVLQLSDTHLMAAGALH----------------NGLVDTTAALVHALEALRDVGPLDA 44

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIV--PGNHDAYISGAKEKSLHAWKDYI 125
           V ++GD+ +         +   +           V   GNHD                  
Sbjct: 45  VVVSGDVSDDGTVASYEAARDLVGGFAAERGAVAVFAMGNHDVA---------------- 88

Query: 126 TSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKK 185
                          +     + ++   +++   P    G    EQ     ++L     +
Sbjct: 89  ---GPFEQVLGPTRSVHDVAGVRIVVLDSSV---PGRGYGELPAEQLSWAREVLADPAPR 142

Query: 186 GFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
           G   ++     P         R+         +       +L GH H      + +    
Sbjct: 143 GSVVVVHHSPLPAPTVLHEGLRLQRPAELLDALAGTDVRAVLSGHYHHPFAATLPS---G 199

Query: 246 IPVVGIASASQKVHSNKPQASYNLFY------IEKKNEYWTLEGKRYTLSPDSLS 294
           +      + + +           +        ++              +  D   
Sbjct: 200 LAAFVAPAVANRCDVLVAPGRERILRGSGALLVDLDERGVRATVLTVPVPGDGEE 254


>gi|71737938|ref|YP_272844.1| Ser/Thr protein phosphatase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71558491|gb|AAZ37702.1| Ser/Thr protein phosphatase [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 268

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 37/292 (12%), Positives = 74/292 (25%), Gaps = 54/292 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  ISD HL        L                   +++    +++ +L      D V 
Sbjct: 12  LVQISDSHLFAEADGALLGMS----------------TRDSLEKVVDLVLAEQPQVDLVV 55

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            +GDI                  I  P       GNHD                      
Sbjct: 56  ASGDISQDGSVESYEAFRRISTQIAAPARWFA--GNHDELPQM----------------E 97

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             +  + L   +       +    +A+   P S  G+    Q     + L +A  +    
Sbjct: 98  HVAQAEGLLEPIINIGRWRVTLLDSAV---PGSVPGFLAAGQLQLLEQSLSEAPDRH--H 152

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HH PV         +          ++        +L GH H             +
Sbjct: 153 LVCLHHHPVAIGCEWMTPIGLRNADALFAVLDRFPQVRAVLWGHVHQEFDQMRNG----V 208

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKD 298
            ++   S   +            F ++     +    + +       ++ + 
Sbjct: 209 RLLASPSTCIQFAPGSAD-----FKVDTTAPGYR-WLRLHDDGRLETAVSRV 254


>gi|91228378|ref|ZP_01262305.1| cyclic AMP phosphodiesterase [Vibrio alginolyticus 12G01]
 gi|91188077|gb|EAS74382.1| cyclic AMP phosphodiesterase [Vibrio alginolyticus 12G01]
          Length = 268

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 48/304 (15%), Positives = 95/304 (31%), Gaps = 48/304 (15%)

Query: 3   KRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL 62
            + ++    L  I+D HL  +     LS K +                +  N ++ D+L 
Sbjct: 1   MQSSSDSIKLLQITDTHLFAADEGSLLSVKTV----------------DSFNAVVADVLR 44

Query: 63  HNV--DHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
            NV  D++  TGDI             + +  +        +PGNHD   +         
Sbjct: 45  RNVAFDYILATGDISQDHSAESYQRFANGIEPLEKDC--FWLPGNHDYKPNM-------- 94

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180
                      S   K   ++ +  +  LI   + +   P    G    +Q     + L 
Sbjct: 95  ------GSVLPSPQIKAAEHVLLGEHWQLILLDSQVVGVPH---GRLSDQQLTLLEEKLA 145

Query: 181 KANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWI 239
           +  ++    ++  H   V       + +   + F +++        IL GH H +     
Sbjct: 146 EHPERHTLVLLHHHPLLVGSAWLDQHTLKDAEAFWQVVERFDNVKGILCGHVHQDMNVLY 205

Query: 240 KNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
           K     I V+   S   +   N        F ++  +  W  E + +     +  + +  
Sbjct: 206 KG----IRVMATPSTCVQFKPNSDD-----FALDTTSPGWR-ELQLHACGDITTQVGRLP 255

Query: 300 SDIF 303
              F
Sbjct: 256 DGQF 259


>gi|225419905|ref|ZP_03762208.1| hypothetical protein CLOSTASPAR_06246 [Clostridium asparagiforme
           DSM 15981]
 gi|225041413|gb|EEG51659.1| hypothetical protein CLOSTASPAR_06246 [Clostridium asparagiforme
           DSM 15981]
          Length = 512

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/290 (13%), Positives = 81/290 (27%), Gaps = 32/290 (11%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            L   +D+H     +  +   K     V     +   +  E+    +++++      + +
Sbjct: 108 RLVLATDLHY--QSAAADDGGKAFQEFVEHSDGKVVRYLTELLEAFLDEVIAERPSALVL 165

Query: 71  TGDIVNFTCNREIFT-STHWLRSIGNPHDISIVPGNHDAYISGA--------------KE 115
           +GDI            +    R       + I+PGNHD     A                
Sbjct: 166 SGDITMNGEKINHQELAQRLKRVQDAGIQVLIIPGNHDINNYDASVFFGDDRTPAETVDA 225

Query: 116 KSLHAWKDYITSDTTCSTGKKLFPYLRIRN-NIALIGCSTAIATPPFSANGYFGQEQAHA 174
           +  +        D   S  +    Y    +    ++   +A   P     G   +     
Sbjct: 226 REFYEIYREYGYDQAFSRDENSLSYAYALDERNWMLMLDSAQYDPVNRVEGRLKESTLAW 285

Query: 175 TSKLLRKANKKGFFRIIMMHHPPVLDTSSL--YNRMFGIQRFQKMIWHEGADLILHGHTH 232
              +L +A ++G F + + HH  +  +        M        +       L   GH H
Sbjct: 286 MDGILAQAQEQGVFVLPVAHHNLLYQSRMYTTQCAMENNTEVIDLFQKYRLPLFFSGHLH 345

Query: 233 LNSLHWIKNEKK------LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
           +  +   K E         I  +   + S       P   Y     ++  
Sbjct: 346 VQRIRKHKAEPGVPDKEYGILEIVTDALSI------PPCQYGFLEWKEDG 389


>gi|87310797|ref|ZP_01092924.1| hypothetical protein DSM3645_07211 [Blastopirellula marina DSM
           3645]
 gi|87286554|gb|EAQ78461.1| hypothetical protein DSM3645_07211 [Blastopirellula marina DSM
           3645]
          Length = 291

 Score =  100 bits (248), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/304 (13%), Positives = 76/304 (25%), Gaps = 51/304 (16%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F  AH++DIH+    S  E   K +  +                       L    + + 
Sbjct: 14  FRFAHLTDIHVQPELSAGEGFRKCLASVN---------------------ALEKRPEVIV 52

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGN------PHDISIVPGNHDAYISGAKEKSLHAWKD 123
             GD+V          +       G+              GNHD +    ++       +
Sbjct: 53  TGGDMVMDIFAHNRQRADQLFSLYGDVVKGETDIPFRSCIGNHDVFGWSHRQDVKPEDAE 112

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
           +         G +   Y   +              P      Y  +EQ     K L +  
Sbjct: 113 FGKGLVCEKLGLEKTYYAFDQGGWRFYILDDIQMAPNNRYQAYLEEEQFEWLKKDLEEKP 172

Query: 184 KKGFFRIIMMHHPPVLDTSSLYN--------------RMFGIQRFQKMIWHEGADLILHG 229
            +    ++   H P+   S+  N                    +   +       L L G
Sbjct: 173 AETPAVVV--SHIPIYTVSTFDNGREEDLAYRVGFSAMCREAAKLGNLFSKHNVKLALSG 230

Query: 230 HTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQA---SYNLFYIEKKNEYWTLEGKRY 286
           H H+      +     +  +   + S        +     + L  +      +  E   Y
Sbjct: 231 HHHILERIEFQG----VTYICGGAVSGGWWRGPHRGVQEGFGLVDLNPNG-TFDYEYVDY 285

Query: 287 TLSP 290
             +P
Sbjct: 286 GWTP 289


>gi|307729155|ref|YP_003906379.1| metallophosphoesterase [Burkholderia sp. CCGE1003]
 gi|307583690|gb|ADN57088.1| metallophosphoesterase [Burkholderia sp. CCGE1003]
          Length = 275

 Score =  100 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/240 (16%), Positives = 72/240 (30%), Gaps = 40/240 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M  LA ISD+H+    +                   ++  +       I  +       D
Sbjct: 1   ML-LAQISDLHIKRPGALA----------------YRRVDTAAYLTRCIAALNALDPRPD 43

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+V+    ++       L  +  P+   ++ GNHD            A +    
Sbjct: 44  AVIVTGDLVDQGEAQQYEHLKALLAPLDIPY--LLLVGNHDDRA---------ALRAVFP 92

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                 +G +   Y      + LI   + +   P  + G     +    S  L  A   G
Sbjct: 93  ERAELHSGGEFVHYAVDVGPLRLIALDSMV---PGQSAGTLCDARLAWLSAQLDAAG--G 147

Query: 187 FFRIIMMHHPPVLDTSSLYN----RMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKN 241
              ++ +HHPP        +          R   +I      + ++ GH H         
Sbjct: 148 KPTVVALHHPPFACGVGHMDKLRLDPRAADRLAALIARYPNVERVICGHVHRPMFVRFGG 207


>gi|298484938|ref|ZP_07003036.1| 3',5'-cyclic-nucleotide phosphodiesterase [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|298160492|gb|EFI01515.1| 3',5'-cyclic-nucleotide phosphodiesterase [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
          Length = 268

 Score =  100 bits (247), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 38/297 (12%), Positives = 75/297 (25%), Gaps = 54/297 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV--DHVS 69
           L  ISD HL        L                   +++    +++ +L      D V 
Sbjct: 12  LVQISDSHLFAEADGALLGMS----------------TRDSLEKVVDLVLAEQPQVDLVV 55

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            +GDI                  I  P       GNHD                      
Sbjct: 56  ASGDISQDGSVESYEAFRRISTQIAAPARWFA--GNHDELPQM----------------E 97

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             +  + L   +       +    +A+   P S  G+    Q     + L +A  +    
Sbjct: 98  HVAQAEGLLEPIINIGRWRVTLLDSAV---PGSVPGFLAAGQLQLLEQSLSEAPDRH--H 152

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HH PV         +          ++        +L GH H             +
Sbjct: 153 LVCLHHHPVAIGCEWMAPIGLRNADALFAVLDRFPQVRAVLWGHVHQEFDQMRNG----V 208

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
            ++   S   +            F ++     +    + +       ++ +     F
Sbjct: 209 RLLASPSTCIQFAPGSAD-----FKVDTTAPGYR-WLRLHDDGRLETAVSRVVGMEF 259


>gi|254500762|ref|ZP_05112913.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
 gi|222436833|gb|EEE43512.1| Ser/Thr protein phosphatase family protein [Labrenzia alexandrii
           DFL-11]
          Length = 278

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 49/254 (19%), Positives = 82/254 (32%), Gaps = 41/254 (16%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVD 66
           M ++AHI+D+HL                        +   +  +A   I  +       D
Sbjct: 1   MALIAHITDLHLRPRGLAC----------------YRVSDTNMLAERAILALNGLTPRPD 44

Query: 67  HVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            V +TGD+ + +  RE   +   L  +  P  + ++PGNHD      +E S         
Sbjct: 45  AVVLTGDLTDKSDPREYALARQILSRLAMP--VFMIPGNHDGSADMRREMSGFP------ 96

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                        Y     ++ LI   T I   P   NG  G  Q +  S  L   +   
Sbjct: 97  --GMDGDVDGKLCYTAEIGDVRLIALDTNIPGKP---NGELGTPQLNWLSDRL---SDDN 148

Query: 187 FFRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEK 243
              +I +HHPP L      + +         ++I        +L GH H   +     + 
Sbjct: 149 RPTLIALHHPPALSGIQHMDAIGLNDANALAEVIGPHKHIQRLLCGHLHRPIIAEFAGKI 208

Query: 244 KLIPVVGIASASQK 257
             +      S   +
Sbjct: 209 MTL----APSTGHQ 218


>gi|126666737|ref|ZP_01737714.1| predicted phosphohydrolase [Marinobacter sp. ELB17]
 gi|126628782|gb|EAZ99402.1| predicted phosphohydrolase [Marinobacter sp. ELB17]
          Length = 271

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/291 (12%), Positives = 79/291 (27%), Gaps = 55/291 (18%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDH 67
             +  ++D HL        L                   +++    +I+D+       D 
Sbjct: 13  LRVLQLTDPHLKADRDGKLLG----------------MNTRDSLAAVIDDVLKRCGQPDL 56

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V  TGD+               L       D   +PGNHD           +  +     
Sbjct: 57  VLATGDLAQDGSVDAYEALAQALARFD--CDSIWIPGNHDNTDWLWPVAQRYRAERKHLK 114

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                                ++   +++   P   +G   +++       L        
Sbjct: 115 Q----------------GGWQILMLDSSV---PRKVHGELTRQELEWLDATL--TANPRL 153

Query: 188 FRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             +I +HH PV   ++    +       F ++I       ++  GH H      +  ++ 
Sbjct: 154 PALIALHHHPVDIAANWMADIGLHNRDAFWEIINRHPQVRVVTWGHIHQ----EVDRQEN 209

Query: 245 LIPVVGIASASQKVHSN-------KPQASYNLFYIEKKNEYWTLEGKRYTL 288
            + ++G  S   +  +        +    Y  F +     + T   +    
Sbjct: 210 GVRLLGTPSTCIQFTAGAREFSVEERPPGYRWFELGSDGGFTTKVHRALDF 260


>gi|90407084|ref|ZP_01215273.1| cyclic AMP phosphodiesterase [Psychromonas sp. CNPT3]
 gi|90311806|gb|EAS39902.1| cyclic AMP phosphodiesterase [Psychromonas sp. CNPT3]
          Length = 275

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 46/296 (15%), Positives = 80/296 (27%), Gaps = 45/296 (15%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
             L  I+D HL        L  K                 K V  L + D        V 
Sbjct: 16  LSLLQITDSHLFADVDHQLLGVKTAQSF------------KAVVELALKDAPACQ--GVL 61

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+      +  F+  H ++ +  P     +PGNHD                 +  + 
Sbjct: 62  ATGDLTQDHSEQSYFSFGHEIKKLNLPC--YWLPGNHDVQSVML---------PSLLEEG 110

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
             +       Y        +I   + I   P  A+G+   EQ     + L +   K    
Sbjct: 111 LAAIKLLQSEY------WQIILLDSQI---PSMAHGHLSIEQLVFLKEALTQNPDKYTLI 161

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLIPV 248
            +  H  PV       + +   Q    +I        +L GH H      +      +  
Sbjct: 162 CVHHHVLPVGSAWLDQHILKNHQALLDIIAPFKKVRAVLSGHVHQAQEICLNG----VTF 217

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIFY 304
               S   +   N        F ++     +               +++    +F+
Sbjct: 218 FTSPSTCVQFKPNCDD-----FTLDDTAPGYRY-LSLRKDGSIETRVERIQQGLFH 267


>gi|257871442|ref|ZP_05651095.1| 3',5'-cyclic-nucleotide phosphodiesterase [Enterococcus gallinarum
           EG2]
 gi|257805606|gb|EEV34428.1| 3',5'-cyclic-nucleotide phosphodiesterase [Enterococcus gallinarum
           EG2]
          Length = 268

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 45/272 (16%), Positives = 89/272 (32%), Gaps = 36/272 (13%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71
           L HISDIH        +   + ++  +           +              +D V I+
Sbjct: 3   LLHISDIHFRRQYPDCQEGYQGMLAAMQNPLIPLTECLRHAQQRA-------TIDLVVIS 55

Query: 72  GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131
           GD+       +       L  +    +I +  GNHD               ++       
Sbjct: 56  GDLTEDGDVEDYRYLKEQLHRLLGDVEIIVTLGNHDI------------KSNFHIGWCGT 103

Query: 132 STGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRII 191
           +  +  +  ++  +++A++    +       ++G   ++Q H   + L +        I+
Sbjct: 104 AASESPYNQVKCYSDMAIVAFDNSRYGA---SDGVVDEQQFHWLQQTLAELKN---LPIV 157

Query: 192 MMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGI 251
           ++ H  +L   S      G  R   ++       IL+GHTH +    I+     IP   +
Sbjct: 158 LVTHHHLLAHQSTTPVWPGTDRLLDLLSSYNIRCILNGHTHHSFTGEIQG----IPYYTV 213

Query: 252 ASASQKVHSNKP-------QASYNLFYIEKKN 276
           AS S               +  YNL+  E   
Sbjct: 214 ASMSFVGEDEGQGIVRFEERYGYNLYRFESGK 245


>gi|17546514|ref|NP_519916.1| hypothetical protein RSc1795 [Ralstonia solanacearum GMI1000]
 gi|17428812|emb|CAD15497.1| putative phosphohydrolase or metallophosphoesterase protein
           [Ralstonia solanacearum GMI1000]
          Length = 282

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 45/257 (17%), Positives = 76/257 (29%), Gaps = 42/257 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
              ++D+H+                        ++  +    +  +  IL      D + 
Sbjct: 3   FLQLTDLHIKPPGRLA----------------YRRVDTAAYLSRCVAHILAQPARPDAIV 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSI-GNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
           +TGD+V+     E       L  +      +  V GNHDA  +        A+ D++   
Sbjct: 47  LTGDLVDAGAPDEYAHLRALLAPLDAAGIRMLPVLGNHDARAAAH-----EAFADWLAPI 101

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
              +   + F Y      + LI   T     P    G  G  +       L  A +    
Sbjct: 102 PAEARDPQAFQYWTDIGEVRLIVLDTLDTGAPG---GRLGVPRLDWLHDAL--AAEPARP 156

Query: 189 RIIMMHHPPVLDTSSLYNRM----FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEK 243
            +I MHHPP        +        I  F +++   G  + IL GH H           
Sbjct: 157 VVIAMHHPPFATGIGHMDVQSLAAEDIPAFAQIVRAAGNVERILCGHLHRAIDVRFAG-- 214

Query: 244 KLIPVVGIASASQKVHS 260
                  +AS       
Sbjct: 215 ------TVASTCPSPAH 225


>gi|91978260|ref|YP_570919.1| metallophosphoesterase [Rhodopseudomonas palustris BisB5]
 gi|91684716|gb|ABE41018.1| metallophosphoesterase [Rhodopseudomonas palustris BisB5]
          Length = 278

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/247 (15%), Positives = 75/247 (30%), Gaps = 43/247 (17%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +A ISD+H+                         K  + +     +  +       D V 
Sbjct: 8   IAQISDLHIKAPGDLA----------------YGKVDTAQALERCVATLNAFAPRPDLVV 51

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+ +    +E       L  +  P    +VPGNHD+                     
Sbjct: 52  ISGDLADTPTEQEYAHLARLLAPLQLP--FVVVPGNHDSRELMRTCF-----------PQ 98

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                +     L+   +I ++   +++   P    G    E       +L  ++++    
Sbjct: 99  PLFPAEGALNQLQPVGDIDIVLLDSSVHGQPH---GELDAETLQWLDAVLSSSDQRPA-- 153

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HHPP        +R        F  ++       L+  GH H  +L         +
Sbjct: 154 LLFLHHPPFRAGIWHMDRQNLRNAAEFATIVERYPWVRLVGAGHVHRATLALFAG----V 209

Query: 247 PVVGIAS 253
           P     +
Sbjct: 210 PATICPA 216


>gi|316935347|ref|YP_004110329.1| metallophosphoesterase [Rhodopseudomonas palustris DX-1]
 gi|315603061|gb|ADU45596.1| metallophosphoesterase [Rhodopseudomonas palustris DX-1]
          Length = 278

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 37/240 (15%), Positives = 67/240 (27%), Gaps = 39/240 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +A ISD+H+                         K  +       +  +       D V 
Sbjct: 8   IAQISDLHIKAPGELA----------------YGKVDTAAALTRCVAALNALAPRPDLVV 51

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           I+GD+V+    +E       L  +  P     VPGNHD+                     
Sbjct: 52  ISGDLVDTPTEQEYAHLMRLLAPLEIP--FVAVPGNHDSRELMRTAF-----------PQ 98

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
               G+     L     + ++   +++   P    G    +       +L  +       
Sbjct: 99  PAFPGEGPLNQLHPVAGLDVVLLDSSVPGQPH---GELDADTLQWLEAVL--SASDQRPA 153

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           ++ +HHPP        +R        F  ++       L+  GH H  +          I
Sbjct: 154 LLFLHHPPFRTGIWHMDRQNLRNSAEFALLVERYPWVRLVASGHVHRATATAFAGTVATI 213


>gi|59712837|ref|YP_205613.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Vibrio
           fischeri ES114]
 gi|59480938|gb|AAW86725.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase [Vibrio
           fischeri ES114]
          Length = 274

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/278 (14%), Positives = 78/278 (28%), Gaps = 47/278 (16%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNV 65
            +    L  I+D HL        L                   +++    ++  +L    
Sbjct: 10  ESDSIRLLQITDTHLFAPEDGALLG----------------VPTRKSFQSVVEQVLQRTP 53

Query: 66  DH--VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKD 123
           D   +  TGDI               +  +  P     +PGNHD   S            
Sbjct: 54  DFDAILATGDISQDHTVESYQHFVKGIIPLKKPC--FWLPGNHDYKPSM----------- 100

Query: 124 YITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183
                   S       +L I  +  +I   + +   P    G    EQ       L +  
Sbjct: 101 ---GGVLPSPQISACEHLLIGQHWQVIILDSQVVGVPH---GALSDEQLTLLDNALSQHP 154

Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNE 242
           ++    ++  H  P        +++   ++F  ++      + I+ GH H      +   
Sbjct: 155 QRHSLVLLHHHPLPAGSAWLDQHQLKESEQFWSVLAKHHNVNGIVCGHIHQELDRVVNG- 213

Query: 243 KKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWT 280
              I ++   S   +   +        F ++ +   W 
Sbjct: 214 ---IRLLATPSTCVQFLPDSDD-----FALDSQAPGWR 243


>gi|294146719|ref|YP_003559385.1| putative metallophosphoesterase [Sphingobium japonicum UT26S]
 gi|292677136|dbj|BAI98653.1| putative metallophosphoesterase [Sphingobium japonicum UT26S]
          Length = 281

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 46/294 (15%), Positives = 82/294 (27%), Gaps = 45/294 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVS 69
           +A ++DIHL + P                       F+++  + ++  +    +  D + 
Sbjct: 3   IAQVTDIHLGFDPE------------------NPAEFNRKRLDQVLRALNDGPNRPDLLL 44

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+ +           +       P  +    GNHD     A                
Sbjct: 45  ATGDLTDRGDPDSYRRLANAFGQCDFP--VWPCMGNHDDRAHFAAH------------FP 90

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                     Y+  ++   +I   T     P    G F + +A   +  L +        
Sbjct: 91  HIPQNDGFVHYVIAQDGRRIIMLDTL---EPGRHGGAFCERRAQWLAARLDE--DDVTPT 145

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIW----HEGADLILHGHTHLNSLHWIKNEKKL 245
           +I+MHHPPV       N         +             IL GH H + +   K     
Sbjct: 146 LIVMHHPPVEVGIDWMNTHPEEPWVGRFAATIAGRPNLHAILCGHIHRSVVAPWKGTTIA 205

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
           I        +  +    P A  N   I      +     R+T +      +   
Sbjct: 206 ICSSTAPQLALDMRPMDPDAPDNRPMIVADPPAYA--LHRWTGNGLITHFETAD 257


>gi|288960520|ref|YP_003450860.1| metallophosphoesterase [Azospirillum sp. B510]
 gi|288912828|dbj|BAI74316.1| metallophosphoesterase [Azospirillum sp. B510]
          Length = 272

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 46/269 (17%), Positives = 75/269 (27%), Gaps = 43/269 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           +  I+D H+                        ++  +       +  +L      D + 
Sbjct: 3   IVQITDTHIKPHGRLA----------------YRRVDTAPFLERAVAALLALDPRPDVIL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+V+     E       LR +  P  +  VPGNHD     A                
Sbjct: 47  ATGDLVDAGHAEEYERLLGLLRPLDIP--LFAVPGNHDERAGLA---------RAFPDLA 95

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
               G + F Y      I LI   T +   P S  G    E+       L +  ++    
Sbjct: 96  ARVGGGRFFHYTVEDWPIRLIAMDTVL---PGSGAGEVCAERLDWLDARLAEQPERPT-- 150

Query: 190 IIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLI 246
           II  HHPP        +R+   G      ++      + +L GH H              
Sbjct: 151 IIFQHHPPFDTGIGHMDRLGLSGSAEMAAVVRRHPQVERVLCGHLHRPIQVRWAGTIAST 210

Query: 247 PVVGIASASQKVHSNKP------QASYNL 269
                   +  +  + P         Y +
Sbjct: 211 APSTAHQVALDLRDDAPSAFVMEPPGYQI 239


>gi|167569518|ref|ZP_02362392.1| Ser/Thr protein phosphatase family protein [Burkholderia
           oklahomensis C6786]
          Length = 274

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 41/286 (14%), Positives = 80/286 (27%), Gaps = 46/286 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LAHISD+H+                        K+  +       +  +       D V 
Sbjct: 3   LAHISDLHIKRPG----------------MLAYKRVDTAAHFARCVARLNALEPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L  +  P+   ++ GNHD   +  +     A         
Sbjct: 47  VTGDLTDFGDDEEYAHLKSLLAPLEIPY--YLLVGNHDDRAALRRAFPARAELR------ 98

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +   Y      + +I   + I   P ++ G     +    +  L  A  +    
Sbjct: 99  ----AGEFVQYALDLGPLRVIALDSQI---PGASGGTLCDARLAWLAGQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQ----RFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP        + M        R   ++      + +L GH H            
Sbjct: 150 IVALHHPPFACGIGHMDAMRLDPDASGRLDALLRRFPNVERVLCGHVHRTMFARFGGTIA 209

Query: 245 LIPVVGIASASQKVHSNKP------QASYNLFYIEKKNEYWTLEGK 284
                     +  +  + P        ++ +          +    
Sbjct: 210 SAVPAPAHQVTFDLRDDGPSSFSMEPPAFAVHRYTPDGGLASHHVY 255


>gi|307297195|ref|ZP_07577007.1| metallophosphoesterase [Sphingobium chlorophenolicum L-1]
 gi|306877366|gb|EFN08598.1| metallophosphoesterase [Sphingobium chlorophenolicum L-1]
          Length = 284

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 47/294 (15%), Positives = 79/294 (26%), Gaps = 45/294 (15%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILL--HNVDHVS 69
           +A ++DIHL + P                       F+++  + ++  +    +  D + 
Sbjct: 3   IAQVTDIHLGFDPD------------------NPAEFNRKRLDQVLRALNDGPNRPDLLL 44

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGD+ +           +       P  +    GNHD     A                
Sbjct: 45  ATGDLTDRGDADSYRRLANAFSQCDFP--VWPCMGNHDDRAQFA------------QYFP 90

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                     Y+    +  +I   T     P    G F + +A   S  L +        
Sbjct: 91  HIPQEDSFVQYVIPLEDRRIIMLDTL---EPDRHGGAFCERRAAWLSARLDE--DSTTPT 145

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIW----HEGADLILHGHTHLNSLHWIKNEKKL 245
           +I+MHHPPV       N        Q+             IL GH H       +     
Sbjct: 146 LIVMHHPPVEVGIDWMNTHPEEAWVQRFTAAIAGRPNIQAILCGHIHRAITAPWQGTTIA 205

Query: 246 IPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
           I        +  +    P+A  N   I      +     R+T            
Sbjct: 206 ICSSTAPQLALDMRPMDPEAPDNRPMIVADPPAYA--LHRWTDHGLITHFATAD 257


>gi|254245818|ref|ZP_04939139.1| hypothetical protein BCPG_00537 [Burkholderia cenocepacia PC184]
 gi|124870594|gb|EAY62310.1| hypothetical protein BCPG_00537 [Burkholderia cenocepacia PC184]
          Length = 274

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 40/270 (14%), Positives = 86/270 (31%), Gaps = 44/270 (16%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDHVS 69
           LA ISD+H+                        ++  +       +  +       D V 
Sbjct: 3   LAQISDLHIKRPGQLA----------------YRRVDTAAALARCVEKLNALVPRPDAVL 46

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
           +TGD+ +F  + E       L ++  P+   ++ GNHD      +            +D 
Sbjct: 47  VTGDLTDFGHDEEYGNLRGLLAALEIPY--YLMIGNHDDRAGLRRA----------FADR 94

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
                 +L  Y      + ++   + +   P +++G     +    +  L  A  +    
Sbjct: 95  AELQDGELMQYALDVGAVRVLALDSQV---PGASHGDLCDVRLAWLAAQLDAARDR--PV 149

Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIW-----HEGADLILHGHTHLNSLHWIKNEKK 244
           I+ +HHPP +      +++         +      H   + +L GH H            
Sbjct: 150 IVALHHPPFVSGIGHMDKLRLAPAAAAKLDALLRGHPNVERVLCGHVHRTMFTRF----G 205

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEK 274
                 + S + +V  +    + + F +E 
Sbjct: 206 GTLAAAVPSPAHQVAFDLRTDAPSAFRLEP 235


>gi|227535894|ref|ZP_03965943.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227244382|gb|EEI94397.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 621

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 36/291 (12%), Positives = 80/291 (27%), Gaps = 56/291 (19%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN-VDHV 68
           F  AH++D H+  +    +                            + D+     +D V
Sbjct: 26  FRFAHVTDTHVGGATGADD------------------------LRRTVKDLNAQQQLDFV 61

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ++GDI  F  + E+  +   L S+  P    ++PGNHD   S     +           
Sbjct: 62  ILSGDITEFGADAELKLAKQILDSLQLP--WYVIPGNHDGNWSENGANTFRTVF------ 113

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                      +         +G ++        + G   +E       + +        
Sbjct: 114 -------GGETFFFRHKGYMFMGTNSGPNM--RMSPGQIPRENLVWMDSVFKANPDTQTP 164

Query: 189 RIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
            +I ++H P   + +              +      L   GH H N  +  +    ++  
Sbjct: 165 -LIYINHYPQDSSLN------NWFEAIDRVKKRNVQLAFCGHGHANVKYNWEGIPGIM-- 215

Query: 249 VGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
                    + +      YN+  I      + ++           +++   
Sbjct: 216 -----GRSNLRAKDSIGGYNIVTIGDGKAVYQVKKPGQAPESAWATVELKD 261


>gi|167764229|ref|ZP_02436356.1| hypothetical protein BACSTE_02614 [Bacteroides stercoris ATCC
           43183]
 gi|167698345|gb|EDS14924.1| hypothetical protein BACSTE_02614 [Bacteroides stercoris ATCC
           43183]
          Length = 609

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 41/305 (13%), Positives = 85/305 (27%), Gaps = 58/305 (19%)

Query: 6   TTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHN- 64
              +F  A ++DIHLS                             E     I  I   + 
Sbjct: 5   QQAVFRFAQLTDIHLSP----------------------NNPNPTEDLLRSIAQINATDS 42

Query: 65  VDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDY 124
           +D V +TGDI        +      L  +   +   +V GNH+   S +   +       
Sbjct: 43  IDFVLVTGDIAEEGDRTTMEKVKSCLDLLKVKY--YVVLGNHETKWSDSGCTAFGEIF-- 98

Query: 125 ITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANK 184
                          +         +G ++        A G+   +     ++ + + N 
Sbjct: 99  -----------GGERFEFEHKGFLFLGFNSGPLM--RMAYGHVVPQDIRWMTETMDRYNA 145

Query: 185 ---KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241
              +    +I++ H P+ +       +         +      L + GH H N       
Sbjct: 146 GNSRPDKPVILVTHYPMTEGD-----VDNWYEVTDAVRPYNIRLFIGGHYHRNRDLRYDG 200

Query: 242 EKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSD 301
              ++           +     +  Y ++ I + +    +  +R    P         +D
Sbjct: 201 IPGILM-------RSNLRDKDEKPGYGIYEITEDSIL--VYTQRIG-EPKRQWAAFSLTD 250

Query: 302 IFYDT 306
            +YD 
Sbjct: 251 SYYDR 255


>gi|116629661|ref|YP_814833.1| phosphohydrolase [Lactobacillus gasseri ATCC 33323]
 gi|116095243|gb|ABJ60395.1| Predicted phosphohydrolase [Lactobacillus gasseri ATCC 33323]
          Length = 410

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 44/291 (15%), Positives = 89/291 (30%), Gaps = 35/291 (12%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           ISD HL           +    +      +  Y+ +   +  +          + +TGD+
Sbjct: 13  ISDTHLIAD--SLHDDGQAFSQMQKTSQGKDLYYQETALSAFVRMAEEKKPAAIIVTGDV 70

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
                           + +     + ++PGNHD Y      +  H  K Y     +    
Sbjct: 71  TFNGERVSAERFAEIFKPL-TKTKLLVLPGNHDIY--DGWAREFHGKKQYYAGQISPRMW 127

Query: 135 KKLF----------------PYLRIRNNIALIGCSTAIATPPFSANG-----YFGQEQAH 173
           + +F                  +++  +  LI   +       SA       + G+EQ  
Sbjct: 128 RNIFRTSYETAVSVDSSSLAYSVQLNPDYLLILADSNDYGKEESATAPATAVFLGKEQRK 187

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSS--LYNRMFGIQRFQKMIWHEGADLILHGHT 231
              + L+ A++     I  MHH       +      +   +  +K++      L+  GH 
Sbjct: 188 WIKEQLQYASQHNLRVIFCMHHNLYAHNPAVNKGYVVDDYRELRKLLAQYNVKLVFSGHI 247

Query: 232 HLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLE 282
           H      I   +   P + + +AS   +       Y +  +  K   +T  
Sbjct: 248 H---AQNIMPPQNSCPAMEVVTASFCSNDQV----YGVVKVSPKEISYTCH 291


>gi|15678206|ref|NP_275321.1| Icc related protein [Methanothermobacter thermautotrophicus str.
           Delta H]
 gi|2621221|gb|AAB84684.1| Icc related protein [Methanothermobacter thermautotrophicus str.
           Delta H]
          Length = 196

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 85/228 (37%), Gaps = 45/228 (19%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M ++AHISD+H+                           F +++    I  I     D  
Sbjct: 1   MVLIAHISDLHVGAP-----------------------NFKEDILLEAIRQINKLKPDAT 37

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            ITGD+ +     E   +  +L  +  PH    VPGNHDA   G   ++      Y    
Sbjct: 38  VITGDLTDNGYYLEFLQAAEYLSDLKGPH--IFVPGNHDARHVGN--ETFEDVFRYRRG- 92

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFF 188
                         + + + +IG  ++    P    G  G+ Q       L +A+ +G  
Sbjct: 93  ------------TFVMDGLTIIGLDSS---EPDLDYGKIGRSQQIWMEDELDRASSRGHI 137

Query: 189 RIIMMHH--PPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLN 234
           R+I +HH   PV  T    N +       + I  +GADL++ GH H+ 
Sbjct: 138 RVIALHHHIIPVPKTGRERNVLADAGDILQSIISKGADLVISGHKHVP 185


>gi|227511582|ref|ZP_03941631.1| 3',5'-cyclic-nucleotide phosphodiesterase [Lactobacillus buchneri
           ATCC 11577]
 gi|227085227|gb|EEI20539.1| 3',5'-cyclic-nucleotide phosphodiesterase [Lactobacillus buchneri
           ATCC 11577]
          Length = 291

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 46/282 (16%), Positives = 78/282 (27%), Gaps = 41/282 (14%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDHV 68
            +  ISD HL+ +                   N +    +E    + +DI     + D +
Sbjct: 7   KIVQISDTHLTPAG--------------AKPANHQHLDPEEKLRTVFDDIYNTNVDPDLI 52

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNP--HDISIVPGNHDAYISGAKEKSLHAWKDYIT 126
            I+GD+++           H L          I ++ GNHD                +  
Sbjct: 53  VISGDLIHEGDAEVYADFHHMLDQEQERLMAPIKVILGNHD------------RTDQFYK 100

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                        Y      +      T          GY  Q Q H     L++  + G
Sbjct: 101 GFLGKKRVATRCYYHESLEGLECYFLDTKCGD---IEQGYLDQTQLHWLKNQLQEYQRPG 157

Query: 187 FFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
              II MHHP                      +I H     I  GH H  + + +     
Sbjct: 158 ---IIFMHHPLYGPPLQQMRYSILQNGDDLLNVIDHTHVKAIFSGHVHFANSYVVDGILN 214

Query: 245 LI---PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEG 283
           ++       I  A+   H      +YN+  ++  +       
Sbjct: 215 VVADSTAYHINCANPHEHFVTDGTAYNVITVDGDDIGVEQRL 256


>gi|292655116|ref|YP_003535013.1| Ser/Thr protein phosphatase family protein family [Haloferax
           volcanii DS2]
 gi|291371064|gb|ADE03291.1| Ser/Thr protein phosphatase family protein family [Haloferax
           volcanii DS2]
          Length = 345

 Score =  100 bits (247), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 42/292 (14%), Positives = 86/292 (29%), Gaps = 48/292 (16%)

Query: 1   MTKRYTTIMFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI 60
           + +  +     LA +SD H++ + S    +  R               S+      ++ I
Sbjct: 29  LGRPVSETPTRLAVVSDPHVTPTGSGTWKAYHR---------------SETRLRTAVSTI 73

Query: 61  LLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHA 120
              +VD   + GD+       E       LR +  P     VPGNHD         +   
Sbjct: 74  SDLDVDATVLLGDLTRDGRPEEYDVVDELLRDL--PGPRVAVPGNHDVPKRWDDYDAPTP 131

Query: 121 WKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPP----FSANGYFGQEQAHATS 176
                  +          P++R    + ++G  +A   P      +  G     Q     
Sbjct: 132 T------EFAARYADGSLPFVRRVGGVDVVGLDSASGGPDLALTDTHEGAVPDAQLRWLE 185

Query: 177 KLLRKANKKGFFRIIMMHHPPVLD-------TSSLYNRMFGIQRFQKMIWHEGADLILHG 229
            +L  A       I++ HH              + + ++        ++      L+L G
Sbjct: 186 TVLADA----TTPIVVFHHNVFHPRRHTDQFPDADFYQLRNADELAAVLARHDVPLVLSG 241

Query: 230 HTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTL 281
           H H  +          +  +   +            S+ +  ++++     L
Sbjct: 242 HIHWPATAVRAG----VRELIAPATCSFPQ------SFVVVDVDRRGTTVRL 283


>gi|88797037|ref|ZP_01112627.1| hypothetical protein MED297_19427 [Reinekea sp. MED297]
 gi|88779906|gb|EAR11091.1| hypothetical protein MED297_19427 [Reinekea sp. MED297]
          Length = 263

 Score = 99.7 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 52/297 (17%), Positives = 93/297 (31%), Gaps = 50/297 (16%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69
           F L  I+D HL  +     L       L            + + + ++N++    VD V 
Sbjct: 5   FTLVQITDPHLHATSDGTLLGMNTENSL------------RLIVDRVVNEV--PEVDLVI 50

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129
            TGDI   +  +        +R I  P     +PGNHD+  + A                
Sbjct: 51  ATGDIAQDSSVQAYRNFLELIRPISAPMR--WIPGNHDSRENMA---------------- 92

Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189
           T     +    +    +  +I   + +    +   G    +Q     K L K   +    
Sbjct: 93  TAGKDLQHAEPVYELGDWVIILLDSIVPGRVY---GNLDPDQLELLQKTLDKYQDRH--V 147

Query: 190 IIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHE-GADLILHGHTHLNSLHWIKNEKKLI 246
           +I  HH PV   S   +++     + FQ ++ H      ++ GH H +S   I      I
Sbjct: 148 LIGFHHHPVPMKSRWIDQIGVRNRESFQALVNHYDNIRAVVCGHVHQDSDQVING----I 203

Query: 247 PVVGIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDIF 303
             +   S   +            F I+     +      +       +I +     F
Sbjct: 204 RYISTPSTCVQFLPKSQD-----FGIDSLGPAYR-TLTLHPDGQLDTTISRIDGVDF 254


>gi|270005031|gb|EFA01479.1| hypothetical protein TcasGA2_TC007030 [Tribolium castaneum]
          Length = 602

 Score = 99.7 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 45/316 (14%), Positives = 89/316 (28%), Gaps = 44/316 (13%)

Query: 2   TKRYTTIMFVLAHISDIHLSYSPSFFELS---------------PKRIIGLVNWHFNRKK 46
            K      F +  +SDIH   + +    +                        W   R  
Sbjct: 176 PKPSGPDSFTILQLSDIHYDPNYTPNGNAVCGEPVCCQPDQGEPSGPENACGYWTDYRLG 235

Query: 47  YFSKEVANLLINDILLHNVDHVSITGDIVNFTCNR-----EIFTSTHWLRSIGNPH--DI 99
                +    I       VD+V  TGDI+                T       + +   +
Sbjct: 236 DSPWYLIEETIRQTKTQQVDYVYYTGDIIVHRTWETSIESNTEAITKLYSYFKDSYDVPV 295

Query: 100 SIVPGNHDAYISGAKEK----------------SLHAWKDYITSDTTCSTGKKLFPYLRI 143
             + GNH+++                       +   W + I  D + +  K  +  +  
Sbjct: 296 YPIFGNHESHPLNVWPNDKILDDKLSIKWLFELAAKHWSELIGEDVSKTVLKGGYYTVSP 355

Query: 144 RNNIALIGCSTA--IATPPFSANGYFGQE-QAHATSKLLRKANKKGFFRIIMMHHPPVLD 200
           R    +IG ++        +          Q    S  L+KA        I+  H P   
Sbjct: 356 RPGFRIIGMNSNVAYTDNWWLMYDDVDPYGQLQWLSDTLKKAEDNNESVHIL-THVPTGC 414

Query: 201 TSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIA-SASQKVH 259
           + SL       ++  +   +       +GHTH +      N       +G A + +    
Sbjct: 415 SYSLKVWNREYRKILERFAN-TITGHFNGHTHRDEFLVYYNSSNPTQAIGAAFNGASVTP 473

Query: 260 SNKPQASYNLFYIEKK 275
            +    S+  +++++ 
Sbjct: 474 YDLSNPSFKYYHVDET 489


>gi|254294395|ref|YP_003060418.1| metallophosphoesterase [Hirschia baltica ATCC 49814]
 gi|254042926|gb|ACT59721.1| metallophosphoesterase [Hirschia baltica ATCC 49814]
          Length = 258

 Score = 99.7 bits (246), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 50/270 (18%), Positives = 87/270 (32%), Gaps = 43/270 (15%)

Query: 9   MFVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHV 68
           M VL H++D+HL                                  +   +I   N D +
Sbjct: 1   MTVLVHMADLHLGTE-------------------------DVRAMEIASREIKQLNPDAI 35

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSD 128
            + GD+       E   ++ WL     P   +IVPGNHD  +     + +  +  +    
Sbjct: 36  IVAGDLTQSGKKSEFILASEWLSQFLIPK--TIVPGNHDTPLINMFSRVVRPFGRFDRLF 93

Query: 129 TTCSTGKKLFPYLRIRNNIALIGCSTAIATPPF--SANGYFGQEQAHATSKLLRKANKKG 186
                           ++  + G +TA         A G    E  +    L + A    
Sbjct: 94  AR--------HSNLQIDDTHIAGLNTARGWQVRSNWAEGSVNSEDLNEILDLQKVA--DQ 143

Query: 187 FFRIIMMHHP--PVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244
              II  HHP  P+         + G +  +K+    G  L+L+GH H  + H  ++   
Sbjct: 144 KLNIIACHHPFLPIPHVPMRTRTIRGRKSSEKIAARNGRSLMLYGHVHTPAAHRFEHGDG 203

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEK 274
                G+   +    +     S+N+  I  
Sbjct: 204 H--YYGVTCGTLSTRTRNAPPSFNIINISD 231


>gi|312961461|ref|ZP_07775963.1| Ser/Thr protein phosphatase family protein [Pseudomonas fluorescens
           WH6]
 gi|311284258|gb|EFQ62837.1| Ser/Thr protein phosphatase family protein [Pseudomonas fluorescens
           WH6]
          Length = 277

 Score = 99.7 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 47/272 (17%), Positives = 86/272 (31%), Gaps = 40/272 (14%)

Query: 10  FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLH--NVDH 67
           FV+A ISD+HL                            +       ++ +       D 
Sbjct: 5   FVVAQISDLHLKAGQRLT----------------YGVVDTLGALRRAVDHLNASHPRPDI 48

Query: 68  VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
           V ++GD+V+F    E       L  +  P    +VPGNHD           HA+      
Sbjct: 49  VVVSGDLVDFGRPDEYAVLHPELSRLHMPC--YLVPGNHDTRGPLLAAFGDHAYLPR--- 103

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +      ++   + + LIG  +   T P    G     Q     + L  A +   
Sbjct: 104 -----SADGPLDWVVDEHPLRLIGLDS---TIPGGHGGQLLDSQLRWLDEQL--ALRPDA 153

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKK 244
             ++++HHPP +      +R         ++++      + +L GH H            
Sbjct: 154 PTLLILHHPPFISGIGHMDREPFINAAALEQVVARHPQVERLLCGHLHRPMQRRFGGSLS 213

Query: 245 LIPVVGIASASQKVHSNKPQASYNLFYIEKKN 276
            +        S ++  +   A+   F +E   
Sbjct: 214 CV----CPGTSHQIVLDLQDAAPAHFNLEPAG 241


>gi|326334294|ref|ZP_08200512.1| icc protein [Nocardioidaceae bacterium Broad-1]
 gi|325947903|gb|EGD40025.1| icc protein [Nocardioidaceae bacterium Broad-1]
          Length = 316

 Score = 99.7 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/258 (15%), Positives = 76/258 (29%), Gaps = 45/258 (17%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDIL--LHNVDHV 68
            +AH+SD HL                         K          ++ +         +
Sbjct: 12  TIAHLSDTHL----------------YAGDRRIFGKVDPTPGFERALDRLRGMTVPPQAI 55

Query: 69  SITGDIVNFTCNREIFTSTHWLRSIGNPHD--ISIVPGNHDAYISGAKEKSLHAWKDYIT 126
             TGD+ +             +  +       I  V GNHD               +  +
Sbjct: 56  VFTGDLADLGERDAYVRLRKQVEPVAADLGAEIIWVMGNHDER-------------EVYS 102

Query: 127 SDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKG 186
                         +   + + +I   T   T P   +G   Q Q    S++L +    G
Sbjct: 103 EVLFGEASDAPRDRVYDIHGLRIISLDT---TVPGWHHGDITQAQLDWLSEVLAEPAPHG 159

Query: 187 FFRIIMMHHPPVL---DTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEK 243
              ++ MHHPP+    + +S+   + G  R   ++       +L GH H ++        
Sbjct: 160 T--LLAMHHPPIPLPLNEASVIIELDGQDRLAPVLEGTDVRAVLAGHLHYSTSTTFAG-- 215

Query: 244 KLIPVVGIASASQKVHSN 261
             IPV   +++       
Sbjct: 216 --IPVSVASASCYTAAPA 231


>gi|295424846|ref|ZP_06817561.1| PTS family maltose/glucose porter, IIABC component [Lactobacillus
           amylolyticus DSM 11664]
 gi|295065412|gb|EFG56305.1| PTS family maltose/glucose porter, IIABC component [Lactobacillus
           amylolyticus DSM 11664]
          Length = 410

 Score = 99.7 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 40/290 (13%), Positives = 84/290 (28%), Gaps = 39/290 (13%)

Query: 15  ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74
           ISD HL         + +    +      +  Y+ + V    +          + +TGDI
Sbjct: 13  ISDTHLIADV--LHDNGQAFSRMQKTSQGKDLYYQETVLKSFVKMANEKQPAAIVVTGDI 70

Query: 75  VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134
                           + +     + +VPGNHD +      +     K +     +    
Sbjct: 71  TFNGERTSAERFAQIFKGL-TKTKLLVVPGNHDIF--DGWAREFRGKKQFYAGQISPMFW 127

Query: 135 KKLF----------------PYLRIRNNIALIGCSTAIATPPF-----SANGYFGQEQAH 173
           K +F                  +++  N  L+   +               G   +++  
Sbjct: 128 KSIFDKSYRASEDEDSNSLAYSVQLNPNYLLVLADSNYYGKEETTTAPFTKGAINRDELK 187

Query: 174 ATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRM--FGIQRFQKMIWHEGADLILHGHT 231
              K  +KA+++    I+ MHH        +            +++       L   GH 
Sbjct: 188 WLEKQFKKASQQHLRPILFMHHNLYAHNPVVNQNYVLDNAAEVRRLCARYNVKLAFSGHI 247

Query: 232 HLNSLHWIKNEKKLIPV--VGIASASQKVHSNKPQASYNLFYIEKKNEYW 279
           H      I   +++ P   V  +S             Y +  + +K+  +
Sbjct: 248 H---AQNILGPQEMTPTTEVVTSSFCST------DQGYGVVRLHQKHITY 288


>gi|261819680|ref|YP_003257786.1| cyclic 3',5'-adenosine monophosphate phosphodiesterase
           [Pectobacterium wasabiae WPP163]
 gi|261603693|gb|ACX86179.1| Calcineurin phosphoesterase domain protein [Pectobacterium wasabiae
           WPP163]
          Length = 275

 Score = 99.7 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/290 (14%), Positives = 76/290 (26%), Gaps = 47/290 (16%)

Query: 11  VLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSI 70
            +  I+D HL        L                      V N +        VD +  
Sbjct: 16  RILQITDTHLFAGEHETLLGINTYRSY------------HAVLNAI--KARQEAVDLIVA 61

Query: 71  TGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130
           TGD+      +     +  +  I  P     +PGNHD   +                D  
Sbjct: 62  TGDLAQDHTLQAYHHFSSGIAQI--PAPCVWLPGNHDFQPAMV--------------DAL 105

Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190
              G     ++ + +   +I   + +   P    G   + Q     + L+    +    +
Sbjct: 106 ADAGIAPSKHVLLGDKWQIILLDSQVFGVPH---GELSEYQLEWLERSLQGQPDRFTLLL 162

Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEG-ADLILHGHTHLNSLHWIKNEKKLIPVV 249
           +  H  P   T    + +        ++      + +L GH H               ++
Sbjct: 163 LHHHPHPSGCTWLDQHSLRNAHNLSAVLDRYPKVNTVLCGHIHQEMDFDWHGR----RLL 218

Query: 250 GIASASQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDY 299
              S   +   +        F I+     W        L PD     + Y
Sbjct: 219 ATPSTCVQFKPHCTN-----FTIDDVAPGWRY----LDLLPDGRLETEVY 259


>gi|54026843|ref|YP_121085.1| putative phosphoesterase [Nocardia farcinica IFM 10152]
 gi|54018351|dbj|BAD59721.1| putative phosphoesterase [Nocardia farcinica IFM 10152]
          Length = 321

 Score = 99.7 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 43/279 (15%), Positives = 78/279 (27%), Gaps = 52/279 (18%)

Query: 12  LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDI--LLHNVDHVS 69
           L H SD HL                            ++   + L+            + 
Sbjct: 20  LFHFSDTHLVAGDG----------------DLYGDVDAERRLSQLLEHATASRIRPTAIV 63

Query: 70  ITGDIVNFTCNREIFTSTHWLRSIGN--PHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127
            TGD+ +             +          +  V GNHD   +                
Sbjct: 64  FTGDLADRGEPGAYDKLRALVEPFAEDLGAPVVWVMGNHDDRGT------------LRRH 111

Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGF 187
                +  + F  + + + + L+   T++   P    G    EQ     ++L +    G 
Sbjct: 112 LLDERSSGQPFDRVHMIDGLRLVVLDTSV---PGHHYGEISDEQLAWLREVLAEPAPFGS 168

Query: 188 FRIIMMHHPPVLDTSSLYNRMF--GIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKL 245
             I+ MHHPPV     L   +     +R   ++       IL GH H ++          
Sbjct: 169 --ILAMHHPPVPCVLDLAVTVELRDQRRLADVLDGTDVRAILAGHVHFSTYATFAG---- 222

Query: 246 IPVVGIASASQKV---------HSNKPQASYNLFYIEKK 275
           IPV   +S+                    ++N  ++   
Sbjct: 223 IPVSVASSSCYTQDLAVAEGGIRGRDGAQAFNFVHVYPD 261


>gi|254516013|ref|ZP_05128073.1| Ser/Thr protein phosphatase [gamma proteobacterium NOR5-3]
 gi|219675735|gb|EED32101.1| Ser/Thr protein phosphatase [gamma proteobacterium NOR5-3]
          Length = 278

 Score = 99.7 bits (246), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/285 (11%), Positives = 72/285 (25%), Gaps = 54/285 (18%)

Query: 4   RYTTIMFVLAHISDIHLSYSPSFFELSPKRIIG