RPSBLAST alignment for GI: 255764495 and conserved domain: cd00838

>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain. Metallophosphatases (MPPs), also known as metallophosphoesterases, phosphodiesterases (PDEs), binuclear metallophosphoesterases, and dimetal-containing phosphoesterases (DMPs), represent a diverse superfamily of enzymes with a conserved domain containing an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. This superfamily includes: the phosphoprotein phosphatases (PPPs), Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 131
 Score = 44.6 bits (105), Expect = 3e-05
 Identities = 16/62 (25%), Positives = 24/62 (38%), Gaps = 1/62 (1%)

Query: 190 IIMMHHPPVLDTSSLYN-RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248
           I++ H PP      L      G +   +++   G DL+L GHTH+           L   
Sbjct: 70  ILLTHGPPYDPLDELSPDEDPGSEALLELLEKYGVDLVLSGHTHVYERREPDGGGTLYIN 129

Query: 249 VG 250
            G
Sbjct: 130 PG 131