RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764495|ref|YP_003065022.2| putative phosphoesterase protein [Candidatus Liberibacter asiaticus str. psy62] (309 letters) >gnl|CDD|31599 COG1409, Icc, Predicted phosphohydrolases [General function prediction only]. Length = 301 Score = 94.3 bits (233), Expect = 4e-20 Identities = 48/248 (19%), Positives = 88/248 (35%), Gaps = 20/248 (8%) Query: 32 KRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLR 91 RI + + H S+E+ L+ I D + +TGD+ N E L Sbjct: 1 MRIAHISDLHLGALGVDSEELLEALLAAIEQLKPDLLVVTGDLTNDGEPEEYRRLKELLA 60 Query: 92 SIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIG 151 + P + +VPGNHDA + + S + Y CS R+ + + Sbjct: 61 RLELPAPVIVVPGNHDARVVNGEAFSDQFFNRYAVLVGACS-----SGGWRVIGLDSSVP 115 Query: 152 CSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNR---- 207 G G EQ + L A ++ ++++HH P+ + +R Sbjct: 116 G---------VPLGRLGAEQLDWLEEALAAAPERAKDTVVVLHHHPLPSPGTGVDRVALR 166 Query: 208 MFGIQRFQKMIWHEGADLILHGHTHL--NSLHWIKNEKKLIPVVGIASASQKVHSNKPQA 265 G + L+L GH HL +++ + + +VG A+ Sbjct: 167 DAGELLDVLIAHGNDVRLVLSGHIHLAAQTVYQLNGTRLSDLLVGAGPATCSQVFRGSAT 226 Query: 266 SYNLFYIE 273 ++N ++ Sbjct: 227 AFNTLDLD 234 >gnl|CDD|143917 pfam00149, Metallophos, Calcineurin-like phosphoesterase. This family includes a diverse range of phosphoesterases, including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases as well as nucleases such as bacterial SbcD or yeast MRE11. The most conserved regions in this superfamily centre around the metal chelating residues. Length = 186 Score = 54.0 bits (129), Expect = 5e-08 Identities = 38/224 (16%), Positives = 67/224 (29%), Gaps = 41/224 (18%) Query: 10 FVLAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVS 69 + I D+H ++ LL+ + D V Sbjct: 1 MRILVIGDLHGGLD-------------------------DLDLLLLLLELLGEPKPDLVL 35 Query: 70 ITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDT 129 GD+V+ + + + P + +V GNHD Sbjct: 36 FLGDLVDRGPPSLEVLALLFALKLKAPGPVYLVRGNHDFD---------SGNSVLGFYLE 86 Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189 L + ++G S + G E+ LL A + Sbjct: 87 CAGLPYVLGNGDVSNGTVEIVGLS-----SLYGKGGGLVWEEFLELLDLLLLAALVDG-K 140 Query: 190 IIMMHHPPVLDTSSLYNR-MFGIQRFQKMIWHEGADLILHGHTH 232 I+++H P S + +FG + + ++ G DL+L GHTH Sbjct: 141 ILLVHGPLSPSLDSGDDIYLFGEEALEDLLKDNGVDLVLRGHTH 184 >gnl|CDD|163643 cd07400, MPP_YydB, Bacillus subtilis YydB and related proteins, metallophosphatase domain. YydB (BSU40220) is an uncharacterized Bacillus subtilis protein that belongs to the following Bacillus subtilis gene cluster yydB-yydC-yydD-yydG-yydH-yydI-yydJ. YydB belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 144 Score = 52.0 bits (125), Expect = 2e-07 Identities = 20/98 (20%), Positives = 31/98 (31%), Gaps = 19/98 (19%) Query: 12 LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71 + H+SD+H L + D V IT Sbjct: 1 ILHLSDLHFGPERKPEL-----------LALLSLLDRLLAEIKAL-------DPDLVVIT 42 Query: 72 GDIVNFTCNREIFTSTHWLRSIGNP-HDISIVPGNHDA 108 GD+ E + +L ++ P + +VPGNHD Sbjct: 43 GDLTQRGLPEEFEEAREFLDALPAPLEPVLVVPGNHDV 80 Score = 45.8 bits (109), Expect = 2e-05 Identities = 20/61 (32%), Positives = 31/61 (50%) Query: 190 IIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVV 249 I+++HHP V S R+ K++ G DL+LHGH H+ + I N + V+ Sbjct: 81 IVVLHHPLVPPPGSGRERLLDAGDALKLLAEAGVDLVLHGHKHVPYVGNISNAGGGLVVI 140 Query: 250 G 250 G Sbjct: 141 G 141 >gnl|CDD|163645 cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 240 Score = 49.1 bits (118), Expect = 2e-06 Identities = 47/230 (20%), Positives = 73/230 (31%), Gaps = 48/230 (20%) Query: 12 LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71 LA ISD+HL ++G+ +A IN L D V +T Sbjct: 2 LAQISDLHL------RADGEGALLGVDTAA-----SLEAVLA--HINA-LHPRPDLVLVT 47 Query: 72 GDIVNFTCNREIFTSTHWLRSIGNPHDI--SIVPGNHDAYISGAKEKSLHAWKDYITSDT 129 GD+ + S LR + I ++PGNHD + + + Sbjct: 48 GDLTD--DGSP--ESYERLRELLAALPIPVYLLPGNHD-----DRAAMRAVFPEL----- 93 Query: 130 TCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFR 189 Y+ LI +++ G Q L +A K Sbjct: 94 --PPAPGFVQYVVDLGGWRLILLDSSVPGQHG---GELCAAQLDWLEAALAEAPDKPT-- 146 Query: 190 IIMMHHPPV------LDTSSLYNRMFGIQRFQKMI-WHEGADLILHGHTH 232 ++ +HHPP +D L N + ++ H IL GH H Sbjct: 147 LVFLHHPPFPVGIAWMDAIGLRNA----EALAAVLARHPNVRAILCGHVH 192 >gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain. Metallophosphatases (MPPs), also known as metallophosphoesterases, phosphodiesterases (PDEs), binuclear metallophosphoesterases, and dimetal-containing phosphoesterases (DMPs), represent a diverse superfamily of enzymes with a conserved domain containing an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. This superfamily includes: the phosphoprotein phosphatases (PPPs), Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 131 Score = 44.6 bits (105), Expect = 3e-05 Identities = 16/62 (25%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Query: 190 IIMMHHPPVLDTSSLYN-RMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPV 248 I++ H PP L G + +++ G DL+L GHTH+ L Sbjct: 70 ILLTHGPPYDPLDELSPDEDPGSEALLELLEKYGVDLVLSGHTHVYERREPDGGGTLYIN 129 Query: 249 VG 250 G Sbjct: 130 PG 131 Score = 33.8 bits (77), Expect = 0.065 Identities = 14/55 (25%), Positives = 21/55 (38%) Query: 53 ANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD 107 A L D V + GD+V + E + + + +VPGNHD Sbjct: 15 AVLEAALAAAEKPDFVLVLGDLVGDGPDPEEVLAAALALLLLLGIPVYVVPGNHD 69 >gnl|CDD|163628 cd07385, MPP_YkuE_C, Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain. YkuE is an uncharacterized Bacillus subtilis protein with a C-terminal metallophosphatase domain and an N-terminal twin-arginine (RR) motif. An RR-signal peptide derived from the Bacillus subtilis YkuE protein can direct Tat-dependent secretion of agarase in Streptomyces lividans. This is an indication that YkuE is transported by the Bacillus subtilis Tat (Twin-arginine translocation) pathway machinery. YkuE belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 223 Score = 40.3 bits (95), Expect = 6e-04 Identities = 49/222 (22%), Positives = 80/222 (36%), Gaps = 62/222 (27%) Query: 12 LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71 +AH+SD+HL F ++ + V IN D V +T Sbjct: 4 IAHLSDLHLG-------------------PFVSRERLERLVE--KINA---LKPDLVVLT 39 Query: 72 GDIVNFTCN-REIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTT 130 GD+V+ + + E+ L+ + P + V GNHD Y SG +E + A + Sbjct: 40 GDLVDGSVDVLELLLEL--LKKLKAPLGVYAVLGNHD-YYSGDEENWIEALE-------- 88 Query: 131 CSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRI 190 S G + +RN I A +G + K L+ ++ I Sbjct: 89 -SAGITV-----LRNESVEISVGGATIGIAGVDDGLGRRPDL---EKALKGLDEDD-PNI 138 Query: 191 IMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232 ++ H P + ++ + G DL L GHTH Sbjct: 139 LLAHQPDTAEEAAAW----------------GVDLQLSGHTH 164 >gnl|CDD|30769 COG0420, SbcD, DNA repair exonuclease [DNA replication, recombination, and repair]. Length = 390 Score = 36.3 bits (83), Expect = 0.010 Identities = 44/233 (18%), Positives = 69/233 (29%), Gaps = 36/233 (15%) Query: 12 LAHISDIHLSY----SPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDH 67 + H SD HL PS E K+ + L+ VD Sbjct: 3 ILHTSDWHLGSKQLNLPSRLEDQ-------------------KKAFDELLEIAKEEKVDF 43 Query: 68 VSITGDIVNFTCNREIFTSTHWLRSIGNPHDISI----VPGNHDAYISGAKEKSLHAWKD 123 V I GD+ + T N +L ++ D I + GNHD S ++ Sbjct: 44 VLIAGDLFD-TNNPSPRALKLFLEALRRLKDAGIPVVVIAGNHD---SPSRLSEASPLLL 99 Query: 124 YITSDTTCSTGKKLFPYLR--IRNNIALIGCSTAIATPPFSANGYFGQEQAHATSK-LLR 180 G+ + I LI NG ++ K LL Sbjct: 100 LNNLGLHGVVGRLVHEIRPPEIVAAPWLIPGPDPDVVFFLGLNGLEKEQFELLLHKGLLS 159 Query: 181 KANKKGFFRIIMMH-HPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232 + I+++H L + + + G + G D + GH H Sbjct: 160 ALDPDDDPSILVLHQSIDALTSGAERDLALGTVDLSL-LPKGGFDYVALGHIH 211 >gnl|CDD|163654 cd07411, MPP_SoxB_N, Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain. SoxB (sulfur oxidation protein B) is a periplasmic thiosulfohydrolase and an essential component of the sulfur oxidation pathway in archaea and bacteria. SoxB has a dinuclear manganese cluster and is thought to catalyze the release of sulfate from a protein-bound cysteine S-thiosulfonate. SoxB is expressed from the sox (sulfur oxidation) gene cluster, which encodes 15 other sox genes, and has two domains, an N-terminal metallophosphatase domain and a C-terminal 5'-nucleotidase domain. SoxB binds the SoxYZ complex and is thought to function as a sulfate-thiohydrolase. SoxB is closely related to the UshA, YchR, and CpdB proteins, all of which have the same two-domain architecture. The N-terminal metallophosphatase domain belongs to a large superfamily of distantly related metallophosphatases (MPPs) that includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 264 Score = 35.7 bits (83), Expect = 0.015 Identities = 26/108 (24%), Positives = 46/108 (42%), Gaps = 20/108 (18%) Query: 133 TGKKLFPYLRIRN----NIALIGCSTA---IATPPFSANGY-FGQEQAHATSKLLRKANK 184 G+++FP RI+ I +IG + IA PP G FG + +++ + Sbjct: 122 AGERVFPPYRIKEVGGVKIGVIGQTFPYVPIANPPRFTPGLTFGIREEELQEVVVKLRRE 181 Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232 +G ++++ H N + + + G D+IL GHTH Sbjct: 182 EGVDVVVLLSH----------NGLPVDVELAERV--PGIDVILSGHTH 217 >gnl|CDD|163641 cd07398, MPP_YbbF-LpxH, Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain. YbbF/LpxH is an Escherichia coli UDP-2,3-diacylglucosamine hydrolase thought to catalyze the fourth step of lipid A biosynthesis, in which a precursor UDP-2,3-diacylglucosamine is hydrolyzed to yield 2,3-diacylglucosamine 1-phosphate and UMP. YbbF belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 217 Score = 34.7 bits (80), Expect = 0.036 Identities = 34/235 (14%), Positives = 64/235 (27%), Gaps = 45/235 (19%) Query: 15 ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74 ISD+HL + + L+ + L D + + GDI Sbjct: 3 ISDLHLGDGGPAAD----------------------FLLLFLLAALALGEADALYLLGDI 40 Query: 75 VNFTCNREIFTSTHW-------LRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITS 127 + + LR + VPGNHD + + L Sbjct: 41 FDLWFGDDEVVPPAAHEVLAALLRLADRGTRVYYVPGNHDFLLGDFFAEELG-------- 92 Query: 128 DTTCSTGKKLFPYLRIRNNIALI-----GCSTAIATPPFSANGYFGQEQAHATSKLLRKA 182 +L + L+ + A G +Q ++ L + Sbjct: 93 ---LILLPDPLVHLELDGKRILLEHGDQFDTDDRAYQLLRRLGRNPYDQLLFLNRPLNRR 149 Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLH 237 + ++ + ++ +G D ++ GHTH +LH Sbjct: 150 RGIAGGLRWSSRYLKKKVKKAVAIIDVFEEAVARLARRKGVDGVICGHTHRPALH 204 >gnl|CDD|163616 cd00840, MPP_Mre11_N, Mre11 nuclease, N-terminal metallophosphatase domain. Mre11 (also known as SbcD in Escherichia coli) is a subunit of the MRX protein complex. This complex includes: Mre11, Rad50, and Xrs2/Nbs1, and plays a vital role in several nuclear processes including DNA double-strand break repair, telomere length maintenance, cell cycle checkpoint control, and meiotic recombination, in eukaryotes. During double-strand break repair, the MRX complex is required to hold the two ends of a broken chromosome together. In vitro studies show that Mre11 has 3'-5' exonuclease activity on dsDNA templates and endonuclease activity on dsDNA and ssDNA templates. In addition to the N-terminal phosphatase domain, the eukaryotic MRE11 members of this family have a C-terminal DNA binding domain (not included in this alignment model). MRE11-like proteins are found in prokaryotes and archaea was well as in eukaryotes. Mre11 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 223 Score = 33.1 bits (76), Expect = 0.090 Identities = 37/228 (16%), Positives = 69/228 (30%), Gaps = 37/228 (16%) Query: 12 LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71 H +D HL LS R R++ E ++ + VD V I Sbjct: 2 FLHTADWHLGKP--LKGLSRDR----------RREDQ-FEAFEEIVELAIEEKVDFVLIA 48 Query: 72 GDIVNFTCNREIFTSTHWLRSIGNPHDISI----VPGNHDAYISGAKEKSLHAWKDYITS 127 GD+ + + N + ++ + I + GNHD+ L A Sbjct: 49 GDLFD-SNNPSPEALELLIEALRRLKEAGIPVFIIAGNHDSPSRLGALSPLLALSGLHLV 107 Query: 128 DTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAH---ATSKLLRKANK 184 L +A+ G Y + + A ++L + Sbjct: 108 GVEEDVLTPLLLPKGG-TGVAIYGLP------------YLRRSRLRDLLADAELRPRPLD 154 Query: 185 KGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232 F I+++H + + + + ++ G D + GH H Sbjct: 155 PDDFNILLLHGG--VAGAGPSDSERAPFVPEALL-PAGFDYVALGHIH 199 >gnl|CDD|163636 cd07393, MPP_DR1119, Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain. DR1119 is an uncharacterized Deinococcus radiodurans protein with a metallophosphatase domain. The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 232 Score = 32.3 bits (74), Expect = 0.16 Identities = 52/231 (22%), Positives = 85/231 (36%), Gaps = 44/231 (19%) Query: 15 ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74 I+D+HL+ P+ P + G W K + K N D ++ D V I GDI Sbjct: 4 IADLHLNLDPT----KPMDVFGP-EW----KNHTEKIKENW---DNVVAPEDIVLIPGDI 51 Query: 75 VNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTG 134 E W+ ++ P ++ GNHD Y G+ K A ++ + Sbjct: 52 SWAMKLEEAKLDLAWIDAL--PGTKVLLKGNHD-YWWGSASKLRKALEE------SRLAL 102 Query: 135 KKLFPYLRIRNNIALIG---------CSTAIATPPFSA--NGYFGQEQAH--ATSKLLRK 181 Y I +++A+ G I F +E + K +K Sbjct: 103 LFNNAY--IDDDVAICGTRGWDNPGNPWPPINETLKVEEDEKIFERELERLELSLKAAKK 160 Query: 182 ANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232 K+ +I+M+H+PP N K+I G D+ ++GH H Sbjct: 161 REKEK-IKIVMLHYPP-------ANENGDDSPISKLIEEYGVDICVYGHLH 203 >gnl|CDD|31597 COG1407, COG1407, Predicted ICC-like phosphoesterases [General function prediction only]. Length = 235 Score = 31.9 bits (72), Expect = 0.21 Identities = 21/105 (20%), Positives = 38/105 (36%), Gaps = 13/105 (12%) Query: 15 ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74 ++D+HL Y S G+ N +Y + + L I + + I GD+ Sbjct: 25 VADLHLGYEESL------ARRGI-----NLPRYQTDRILKRLDRIIERYGPKRLIILGDL 73 Query: 75 V-NFTCN-REIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKS 117 F + R+ + + ++ I+ GNHD I Sbjct: 74 KHEFGKSLRQEKEEVREFLELLDEREVIIIRGNHDNGIEEILPGF 118 >gnl|CDD|31598 COG1408, COG1408, Predicted phosphohydrolases [General function prediction only]. Length = 284 Score = 31.9 bits (72), Expect = 0.24 Identities = 36/229 (15%), Positives = 71/229 (31%), Gaps = 61/229 (26%) Query: 12 LAHISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSIT 71 + +SD+H K +AN L D+++ +T Sbjct: 47 IVQLSDLHSL------------------PFREEKLALLIAIANEL-PDLIV-------LT 80 Query: 72 GDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYITSDTTC 131 GD V+ + +L + P + V GNHD + + + + Sbjct: 81 GDYVDGDRPPGVAALALFLAKLKAPLGVFAVLGNHDYGVDRSNVYI-----GDLLEELGR 135 Query: 132 STGKKLFPYLRIR--------NNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKAN 183 + + + ++ L G +A P + ++ L++ + Sbjct: 136 VVLRNEIAVIDLLALRIEVGGLDLYLAGVEDILAGLPLAPFTI-----GLDIAEALKQLD 190 Query: 184 KKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTH 232 + I++ H P I + + G DL+L GHTH Sbjct: 191 EDLPG--ILLSHEPD-----------IILQLRL----YGVDLVLSGHTH 222 >gnl|CDD|163634 cd07391, MPP_PF1019, Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain. This family includes bacterial and archeal proteins homologous to PF1019, an uncharacterized Pyrococcus furiosus protein. The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 172 Score = 31.5 bits (72), Expect = 0.26 Identities = 18/113 (15%), Positives = 38/113 (33%), Gaps = 13/113 (11%) Query: 15 ISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGDI 74 ++D+HL +R I L + + L+ + + + I GD+ Sbjct: 3 VADLHLGKEEEL----RRRGILLPRGQTED---TLERLDRLIEE----YGPERLIILGDL 51 Query: 75 V-NFTCNREIFTSTHW-LRSIGNPHDISIVPGNHDAYISGAKEKSLHAWKDYI 125 +F LR + D+ ++ GNHD + + + + Sbjct: 52 KHSFGGLSRQEFEEVAFLRLLAKDVDVILIRGNHDGGLPEILKDLNVEVVEGL 104 >gnl|CDD|163644 cd07401, MPP_TMEM62_N, Homo sapiens TMEM62, N-terminal metallophosphatase domain. TMEM62 (transmembrane protein 62) is an uncharacterized Homo sapiens transmembrane protein with an N-terminal metallophosphatase domain. TMEM62 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 256 Score = 30.8 bits (70), Expect = 0.47 Identities = 27/136 (19%), Positives = 44/136 (32%), Gaps = 12/136 (8%) Query: 101 IVPGNHDAYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIA--- 157 + GNHD + Y T G F + N + IG + Sbjct: 81 DIRGNHDLF--NIPSLD-SENNYYRKYSATGRDGSFSFSHTTRFGNYSFIGVDPTLFPGP 137 Query: 158 TPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQR-FQK 216 PF+ G ++ K L K+ + I H+P TS++ + F+ Sbjct: 138 KRPFNFFGSLDKKLLDRLEKELEKSTNSN-YTIWFGHYP----TSTIISPSAKSSSKFKD 192 Query: 217 MIWHEGADLILHGHTH 232 ++ L GH H Sbjct: 193 LLKKYNVTAYLCGHLH 208 >gnl|CDD|163635 cd07392, MPP_PAE1087, Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain. PAE1087 is an uncharacterized Pyrobaculum aerophilum protein with a metallophosphatase domain. The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 188 Score = 30.7 bits (70), Expect = 0.48 Identities = 42/188 (22%), Positives = 66/188 (35%), Gaps = 30/188 (15%) Query: 48 FSKEVANLLINDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD 107 K A +L + D V + GDI NF +E + L +IG P + VPGN D Sbjct: 11 VEKLEAIILKAE----EADAVIVAGDITNFG-GKEAAVEINLLLAIGVP--VLAVPGNCD 63 Query: 108 AYISGAKEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAIATPPFSANGYF 167 +TS GK + +G + TP F+ Sbjct: 64 T----------PEILGLLTSAGLNLHGKVVE-----VGGYTFVGIGGSNPTP-FNTPIEL 107 Query: 168 GQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTS--SLYNRMF-GIQRFQKMIWHEGAD 224 +E+ + +L K +I++ H P T+ + G + +K I Sbjct: 108 SEEEIVSDGRLNNLLAK----NLILVTHAPPYGTAVDRVSGGFHVGSKAIRKFIEERQPL 163 Query: 225 LILHGHTH 232 L + GH H Sbjct: 164 LCICGHIH 171 >gnl|CDD|163622 cd07379, MPP_239FB, Homo sapiens 239FB and related proteins, metallophosphatase domain. 239FB (Fetal brain protein 239) is thought to play a role in central nervous system development, but its specific role in unknown. 239FB is expressed predominantly in human fetal brain from a gene located in the chromosome 11p13 region associated with the mental retardation component of the WAGR (Wilms tumor, Aniridia, Genitourinary anomalies, Mental retardation) syndrome. Orthologous brp-like (brain protein 239-like) proteins have been identified in the invertebrate amphioxus group and in vertebrates. 239FB belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 135 Score = 30.3 bits (69), Expect = 0.80 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 8/52 (15%) Query: 59 DILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHDAYI 110 D+L+H GD+ E+ WL+S+ +PH I ++ GNHD + Sbjct: 21 DVLIH-------AGDLTERGTLEELQKFLDWLKSLPHPHKI-VIAGNHDLTL 64 >gnl|CDD|163617 cd00841, MPP_YfcE, Escherichia coli YfcE and related proteins, metallophosphatase domain. YfcE is a manganase-dependent metallophosphatase, found in bacteria and archaea, that cleaves bis-p-nitrophenyl phosphate, thymidine 5'-monophosphate-p-nitrophenyl ester, and p-nitrophenyl phosphorylcholine, but is unable to hydrolyze 2',3 ' or 3',5' cyclic nucleic phosphodiesters, and various phosphomonoesters, including p-nitrophenyl phosphate. This family also includes the Bacilus subtilis YsnB and Methanococcus jannaschii MJ0936 proteins. This domain family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 155 Score = 29.9 bits (68), Expect = 0.86 Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Query: 188 FRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLNSLHWIKN 241 RI + H + L + GAD++L+GHTH+ + I Sbjct: 76 KRIFLTHGHLYGVKNGLDRLYLAKE--------GGADVVLYGHTHIPVIEKIGG 121 >gnl|CDD|163638 cd07395, MPP_CSTP1, Homo sapiens CSTP1 and related proteins, metallophosphatase domain. CSTP1 (complete S-transactivated protein 1) is an uncharacterized Homo sapiens protein with a metallophosphatase domain, that is transactivated by the complete S protein of hepatitis B virus. CSTP1 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 262 Score = 29.2 bits (66), Expect = 1.7 Identities = 13/62 (20%), Positives = 21/62 (33%), Gaps = 6/62 (9%) Query: 179 LRKANKKGFFRIIM-MHHPPVLDTSSLYNRMFGIQRFQKMIW-----HEGADLILHGHTH 232 L A + +I+ H P L+ + F I + + G + GH H Sbjct: 157 LEIAKESDCKHVIVFQHIPWFLEDPDEEDSYFNIPKSVRKPLLDKFKKAGVKAVFSGHYH 216 Query: 233 LN 234 N Sbjct: 217 RN 218 >gnl|CDD|36592 KOG1378, KOG1378, KOG1378, Purple acid phosphatase [Carbohydrate transport and metabolism]. Length = 452 Score = 28.8 bits (64), Expect = 2.0 Identities = 13/76 (17%), Positives = 26/76 (34%), Gaps = 5/76 (6%) Query: 168 GQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQR-----FQKMIWHEG 222 G Q + L ++K +I+ H P+ +S+ + G + + Sbjct: 273 GTAQYQWLERDLASVDRKKTPWLIVQGHRPMYCSSNDAHYREGEFESMREGLEPLFVKYK 332 Query: 223 ADLILHGHTHLNSLHW 238 D++ GH H Sbjct: 333 VDVVFWGHVHRYERFC 348 >gnl|CDD|163618 cd00842, MPP_ASMase, acid sphingomyelinase and related proteins, metallophosphatase domain. Acid sphingomyelinase (ASMase) is a ubiquitously expressed phosphodiesterase which hydrolyzes sphingomyelin in acid pH conditions to form ceramide, a bioactive second messenger, as part of the sphingomyelin signaling pathway. ASMase is localized at the noncytosolic leaflet of biomembranes (for example the luminal leaflet of endosomes, lysosomes and phagosomes, and the extracellular leaflet of plasma membranes). ASMase-deficient humans develop Niemann-Pick disease. This disease is characterized by lysosomal storage of sphingomyelin in all tissues. Although ASMase-deficient mice are resistant to stress-induced apoptosis, they have greater susceptibility to bacterial infection. The latter correlates with defective phagolysosomal fusion and antibacterial killing activity in ASMase-deficient macrophages. ASMase belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: the phosphoprotein phosphatases (PPPs), Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 296 Score = 28.8 bits (65), Expect = 2.2 Identities = 44/285 (15%), Positives = 90/285 (31%), Gaps = 54/285 (18%) Query: 14 HISDIHL--SYSP-SFFELSPKRIIGLVNWHFNRKK---YF-------SKEVANLLINDI 60 HISDIH Y S + + + + + + + + I Sbjct: 3 HISDIHYDPLYKVGSEYSANCHSPLCCRDESGDISPPAGPWGDYGCDSPWRLVESALEAI 62 Query: 61 --LLHNVDHVSITGDIV--NFTCNREIFTSTHWLRSIGNPH-----DISIVP--GNHDAY 109 D + TGD+V + + ++ + D + P GNHD+Y Sbjct: 63 KKNHPKPDFILWTGDLVRHDVDEQTPETLVLISISNLTSLLKKAFPDTPVYPALGNHDSY 122 Query: 110 I-----SGAKEKSL-----HAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAI--- 156 L WK ++ + + K + + ++ + +I +T + Sbjct: 123 PVNQFPPNNSPSWLYDALAELWKSWLPEEAEETFKKGGYYSVPVKPGLRVISLNTNLYYK 182 Query: 157 ---ATPPFSANGYFGQEQ-AHATSKLLRKANKKGFFRIIMMHHPPVLDTSSL---YNRMF 209 + GQ Q + +A +K I+ H PP +++ ++ + Sbjct: 183 KNFWLLGSNETDPAGQLQWLEDELQEAEQAGEK---VWIIGHIPPGVNSYDTLENWSERY 239 Query: 210 G--IQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGIA 252 I R+ I GHTH + ++ + +A Sbjct: 240 LQIINRYSDTI-----AGQFFGHTHRDEFRVFYDDNDTGEPINVA 279 >gnl|CDD|163624 cd07381, MPP_CapA, CapA and related proteins, metallophosphatase domain. CapA is one of three membrane-associated enzymes in Bacillus anthracis that is required for synthesis of gamma-polyglutamic acid (PGA), a major component of the bacterial capsule. The YwtB and PgsA proteins of Bacillus subtilis are closely related to CapA and are also included in this alignment model. CapA belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 239 Score = 28.4 bits (64), Expect = 3.0 Identities = 15/94 (15%), Positives = 29/94 (30%), Gaps = 15/94 (15%) Query: 146 NIALIGCS---TAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHPPVLDTS 202 +A + + I + G + + +A KK I+ +H Sbjct: 132 KVAFLAYTYGTNGIPLAAGARPGGVNPLDLERIAADIAEAKKKADIVIVSLHWG------ 185 Query: 203 SLYNRMFGIQRFQKMIWHE----GADLILHGHTH 232 + Q+ + GADL++ H H Sbjct: 186 --VEYSYYPTPEQRELARALIDAGADLVIGHHPH 217 >gnl|CDD|39704 KOG4504, KOG4504, KOG4504, Cation-independent mannose-6-phosphate receptor CI-MPR [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport]. Length = 370 Score = 28.1 bits (62), Expect = 3.5 Identities = 9/63 (14%), Positives = 20/63 (31%), Gaps = 5/63 (7%) Query: 42 FNRKKYFSKEVANLLI----NDILLHNVDHVSITGDIVNFTCNREIFTSTHWLRSIGNPH 97 F + + + L N + +S +++F C E + + GN Sbjct: 152 FGQTRISVGKANKRLQLVYKNGSPCPSKSGLSYK-TLISFVCRPEAGPTNRPILYSGNLQ 210 Query: 98 DIS 100 + Sbjct: 211 TCT 213 >gnl|CDD|163647 cd07404, MPP_MS158, Microscilla MS158 and related proteins, metallophosphatase domain. MS158 is an uncharacterized Microscilla protein with a metallophosphatase domain. Microscilla proteins MS152, and MS153 are also included in this family. The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 166 Score = 27.6 bits (62), Expect = 3.9 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Query: 190 IIMMHHPP------VLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLN 234 +++ HH P SL N F +I + DL +HGHTH N Sbjct: 100 VVVTHHAPSPLSLAPQYGDSLVNAAF-AVDLDDLILADPIDLWIHGHTHFN 149 >gnl|CDD|144907 pfam01487, DHquinase_I, Type I 3-dehydroquinase. Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase.) Catalyses the cis-dehydration of 3-dehydroquinate via a covalent imine intermediate giving dehydroshikimate. Dehydroquinase functions in the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Type II 3-dehydroquinase catalyses the trans-dehydration of 3-dehydroshikimate see pfam01220. Length = 222 Score = 27.9 bits (63), Expect = 4.0 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Query: 178 LLRKANKKGFFRIIMMHH-----PPVLDTSSLYNRM 208 L A KKG +II+ +H P + SLY M Sbjct: 103 LSVIAAKKGGTKIILSYHDFEGTPSWEELLSLYEEM 138 >gnl|CDD|33306 COG3503, COG3503, Predicted membrane protein [Function unknown]. Length = 323 Score = 27.6 bits (61), Expect = 4.1 Identities = 14/70 (20%), Positives = 26/70 (37%), Gaps = 4/70 (5%) Query: 137 LFPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLRKANKKGFFRIIMMHHP 196 L P+ + L+G + A P A + LL N + + ++H P Sbjct: 183 LLPWF----GVFLLGIAFGNALRPGGPRARRRSPAALGLALLLLAFNGRHSLKPYLIHQP 238 Query: 197 PVLDTSSLYN 206 ++ L+N Sbjct: 239 VLIGLVWLFN 248 >gnl|CDD|38150 KOG2939, KOG2939, KOG2939, Uncharacterized conserved protein [Function unknown]. Length = 502 Score = 27.7 bits (61), Expect = 4.5 Identities = 8/48 (16%), Positives = 15/48 (31%) Query: 255 SQKVHSNKPQASYNLFYIEKKNEYWTLEGKRYTLSPDSLSIQKDYSDI 302 S+ S+ P + + N + G ++ YS I Sbjct: 209 SRFPSSSSPSNTIDPSGNSSGNPFELKSGHSFSAKSTHYRSDGYYSSI 256 >gnl|CDD|37195 KOG1984, KOG1984, KOG1984, Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport]. Length = 1007 Score = 27.6 bits (61), Expect = 4.8 Identities = 9/43 (20%), Positives = 19/43 (44%) Query: 138 FPYLRIRNNIALIGCSTAIATPPFSANGYFGQEQAHATSKLLR 180 P + I ++ + T PP +F Q+Q + + + +R Sbjct: 249 PPQVSIEDDSSFRSTDTRAQPPPLVTTDFFIQDQGNCSPRFMR 291 >gnl|CDD|31080 COG0737, UshA, 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism]. Length = 517 Score = 27.4 bits (60), Expect = 4.9 Identities = 52/232 (22%), Positives = 80/232 (34%), Gaps = 26/232 (11%) Query: 14 HISDIHLSYSPSFFELSPKRIIGLVNWHFNRKKYFSKEVANLLINDILLHNVDHVSITGD 73 H +D+H E G + R K++ N +LL D I G Sbjct: 31 HTNDLH-----GHLEPYDYDDDGDTDGGLARIATLVKQLRAENKNVLLLDAGDL--IQGS 83 Query: 74 IVNFTCNREIFTSTHWLRSIGNPHDISIVPGNHD-AYISGAKEKSLHAWKDYITS---DT 129 ++ + T L ++G +D + GNH+ Y A + L K + S Sbjct: 84 PLSDYLTKGEPTVD-LLNALG--YDAMTL-GNHEFDYGLEALARLLDEAKFPVLSANVYD 139 Query: 130 TCSTGKKLFPYLRIRN----NIALIGCSTAIATPPFSANGYFGQE---QAHATSKLLRKA 182 STG F I+ I +IG +T N G A K + + Sbjct: 140 KNSTGPPFFKPYAIKEVGGVKIGIIGLTTPTIPTWEKPNAIEGVTFRDPIEAAKKYIPEL 199 Query: 183 NKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLILHGHTHLN 234 +G II + H + D L + + G G DLI+ GH+H Sbjct: 200 KGEGVDVIIALSHLGIEDDLELASEVPGDVDVAV----PGIDLIIGGHSHTV 247 >gnl|CDD|32732 COG2908, COG2908, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 237 Score = 27.5 bits (61), Expect = 5.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 221 EGADLILHGHTHLNSLHWIKN 241 G D ++HGHTH ++H I Sbjct: 186 HGVDGVIHGHTHRPAIHNIPG 206 >gnl|CDD|146114 pfam03314, DUF273, Protein of unknown function, DUF273. Length = 222 Score = 27.3 bits (61), Expect = 6.2 Identities = 8/36 (22%), Positives = 13/36 (36%), Gaps = 8/36 (22%) Query: 216 KMIWHEGADLILHGHTHLNSLHWIKNEKKLIPVVGI 251 +W D +LHG W N+ + P + Sbjct: 190 SSVWSPERDFMLHG--------WKTNQLRETPNGIL 217 >gnl|CDD|163629 cd07386, MPP_DNA_pol_II_small_archeal_C, archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain. The small subunit of the archeal DNA polymerase II contains a C-terminal metallophosphatase domain. This domain is thought to be functionally active because the active site residues required for phosphoesterase activity in other members of this superfamily are intact. The archeal replicative DNA polymerases are thought to possess intrinsic phosphatase activity that hydrolyzes the pyrophosphate released during nucleotide polymerization. This domain belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 243 Score = 26.9 bits (60), Expect = 7.1 Identities = 9/15 (60%), Positives = 10/15 (66%), Gaps = 2/15 (13%) Query: 96 PHDISIV--PGNHDA 108 P I I+ PGNHDA Sbjct: 79 PSHIKIIIIPGNHDA 93 >gnl|CDD|176679 cd07256, HPCD_C_class_II, C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases. This subfamily contains the C-terminal, catalytic, domain of HPCD. HPCD catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate. The aromatic ring of 4-hydroxyphenylacetate is opened by this dioxygenase to yield the 3,4-diol product, 2-hydroxy-5-carboxymethylmuconate semialdehyde. HPCD is a homotetramer and each monomer contains two structurally homologous barrel-shaped domains at the N- and C-terminus. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism. Most extradiol dioxygenases contain Fe(II) in their active site, but HPCD can be activated by either Mn(II) or Fe(II). These enzymes belong to the type I class II family of extradiol dioxygenases. The class III 3,4-dihydroxyphenylacetate 2,3-dioxygenases belong to a different superfamily. Length = 161 Score = 26.9 bits (60), Expect = 7.7 Identities = 9/26 (34%), Positives = 12/26 (46%), Gaps = 5/26 (19%) Query: 89 WLRSIGNPHDISIVPGN-----HDAY 109 WL G HD ++ GN H A+ Sbjct: 44 WLHRKGGVHDTALTGGNGPRLHHVAF 69 >gnl|CDD|34965 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics]. Length = 1001 Score = 26.6 bits (58), Expect = 8.7 Identities = 8/35 (22%), Positives = 12/35 (34%) Query: 87 THWLRSIGNPHDISIVPGNHDAYISGAKEKSLHAW 121 H G P + ++ G K +LH W Sbjct: 20 KHLNEEDGGPDSLLVMLGKSQDVNPYQKNTALHIW 54 >gnl|CDD|144656 pfam01142, TruD, tRNA pseudouridine synthase D (TruD). TruD is responsible for synthesis of pseudouridine from uracil-13 in transfer RNAs. The structure of TruD reveals an overall V-shaped molecule which contains an RNA-binding cleft. Length = 336 Score = 26.4 bits (59), Expect = 9.9 Identities = 12/36 (33%), Positives = 15/36 (41%), Gaps = 11/36 (30%) Query: 209 FGIQRFQKMIWHEGADLILHGHTHLNSLHWIKNEKK 244 FG QRF G D G+ HL +K + K Sbjct: 158 FGEQRF-------GRD----GNNHLVGKAILKGDWK 182 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.136 0.421 Gapped Lambda K H 0.267 0.0704 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,945,297 Number of extensions: 208031 Number of successful extensions: 529 Number of sequences better than 10.0: 1 Number of HSP's gapped: 501 Number of HSP's successfully gapped: 57 Length of query: 309 Length of database: 6,263,737 Length adjustment: 94 Effective length of query: 215 Effective length of database: 4,232,491 Effective search space: 909985565 Effective search space used: 909985565 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (25.8 bits)