RPSBLAST alignment of GI: 255764495 and protein with PDBid: 2z72

>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342
 Score = 38.0 bits (87), Expect = 0.003
 Identities = 35/248 (14%), Positives = 77/248 (31%), Gaps = 26/248 (10%)

Query: 63  HNVDHVSITGDIVN-FTCNREI--FTSTHWLRSIGNPHDISIVPGNHD------AYISGA 113
               H+ +TGDI +      E+  F      ++      + ++ GNH+            
Sbjct: 104 FGEGHMVMTGDIFDRGHQVNEVLWFMYQLDQQARDAGGMVHLLMGNHEQMVLGGDLRYVH 163

Query: 114 KEKSLHAWKDYITSDTTCSTGKKLFPYLRIRNNIALIGCSTAI---ATPPFSANGYFGQE 170
           +   +         +   S   ++  +LR +N I  I     +    +  + +      +
Sbjct: 164 QRYDIATTLINRPYNKLYSADTEIGQWLRSKNTIIKINDVLYMHGGISSEWISRELTLDK 223

Query: 171 Q---AHATSKLLRKANKKGFFRIIMMHHPPVLDTSSLYNRMFGIQRFQKMIWHEGADLIL 227
                 A     +K+ K       +            ++  F       ++ H   + I+
Sbjct: 224 ANALYRANVDASKKSLKADDLLNFLFFGNGPTWYRGYFSETFTEAELDTILQHFNVNHIV 283

Query: 228 HGHTHLNSLHWIKNEKKLIPVVGIASASQKVHSNKPQASYNLFYIEKKNEY-WTLEGKRY 286
            GHT    +  + + K    V+ + S+         +       +E         +G R 
Sbjct: 284 VGHTSQERVLGLFHNK----VIAVDSSI--KVGKSGEL----LLLENNRLIRGLYDGTRE 333

Query: 287 TLSPDSLS 294
           TL  +SL+
Sbjct: 334 TLQENSLN 341