RPSBLAST alignment for GI: 255764497 and conserved domain: COG4986

>gnl|CDD|34591 COG4986, COG4986, ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism]. Length = 523
 Score =  433 bits (1115), Expect = e-122
 Identities = 194/535 (36%), Positives = 273/535 (51%), Gaps = 14/535 (2%)

Query: 55  TLDVHSLPQYASRTTLRMLSAMVISLLFTFVYATLAAKSRRLGMVLVPILDIMQSIPILG 114
             DV  +P     T  RML A++IS+L  +  A  A KS+R   + +P+LD++QS+P+LG
Sbjct: 1   MNDVLLIPLALLATAGRMLLAILISILTGWFLAYAAIKSKRFENIYIPVLDVLQSVPVLG 60

Query: 115 FLTFTVVYFMNLYPGKVIGAELAAIFAIFTSQVWNMTFSMYQSLCNIPRDLEEVSRSFRL 174
           F    +++F+ L+PG + G ELAA F +FTS  WN+ FS YQS   +P DL EV+R++RL
Sbjct: 61  FFPIVLIFFVYLFPGPL-GVELAADFLVFTSVAWNIWFSEYQSFKTVPSDLLEVARNYRL 119

Query: 175 SGWQKFWYLGVPFSMPGLVWNMMMSMSGGWFFVVASEMIVVGDTVIPLPGIGSYI--ALA 232
           S   +   L +PF+MPG+  N+M SMS G+FF+ ASE+I VG     L GIGS +   LA
Sbjct: 120 SFLLRMARLYIPFAMPGIAANLMPSMSDGFFFITASEVITVGIHTYRLFGIGSLLDELLA 179

Query: 233 IKEQDLLAILYAMLTMLGVIFLYDQLLFRPMIVWSNKFRLERTTGIYPADSWVLYLFRKT 292
           I + +L  I  A+L M   I LYD   FRP +V    F  +         SW      ++
Sbjct: 180 IGQYNLAYIGLAILAMAIGILLYDLRRFRPYVVSKYTFDTDAPISRRGRLSWKYDTRLRS 239

Query: 293 NFLRFIGYSSWNFFSPLSNNVKKLCRTLGVIRFHFPENFLQLCSNQRVSYMLDIFWFCVV 352
              +          +PLS       R L        E       ++  S  +      ++
Sbjct: 240 VIAK----------NPLSRLAGLYRRRLLSRAEEVFEETRSGKISRYRSVAIGRLILGLL 289

Query: 353 CGVAIGIAWQSIGYIVNHFTYQDVLYVIWLGCITMFRVVVLIIIASIIWIPVGIWIGFRP 412
              A       +   +      +   V+        RVVV++ ++ +I I +G  I  RP
Sbjct: 290 VYSAPASISS-VPESLWGALVSETPAVLLYLLYDYLRVVVILALSFLISIFLGYSIALRP 348

Query: 413 HISSKIQPFAQLLAAFPANVFFPLVVSCVSYYHLNPNLWLSLLMIFGTQWYILFNVIAGA 472
            +    QP  Q LAAFPA ++FPL+ + +  + L P +WLS L   GT +YI +NVIAGA
Sbjct: 349 RVEGIGQPLIQFLAAFPAPIYFPLLFAAIKTFILTPEIWLSPLGFIGTFYYIFYNVIAGA 408

Query: 473 SAFPNDFKEVASSFHITGWRWWRYIILPGIFPYYVTGAITACGGAWNASIVSEVASWGHI 532
            A P ++ E A ++++ GW  WR IILPG FPY +TG  T  GGAWNA IV E  SWGH 
Sbjct: 409 KALPVEYFEAAKNYNLGGWAKWRRIILPGTFPYLITGLSTTIGGAWNALIVGEYWSWGHT 468

Query: 533 HLRTTGLGAYIAESTEKGSFPEVVLGVLIMCCFVLALNRFLWHPLYLYGTRCLRL 587
            L   GLG YIA +T  G  P  + G  IM   V+  N   W  L     +    
Sbjct: 469 LLVAHGLGKYIAVATAAGDIPRALWGSFIMGIVVVVYNILFWRRLMDLARKRYVA 523