HHSEARCH alignment of GI: 255764498 and SCOP domain: d1a0pa1

Alignment
>d1a0pa1 a.60.9.1 (A:3-100) Recombinase XerD {Escherichia coli [TaxId: 562]}
Probab=94.46  E-value=0.032  Score=29.51  Aligned_cols=38  Identities=13%  Similarity=0.247  Sum_probs=33.0

Q ss_pred             HHHHHHHHHHH-HCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999999999-779984353221011233432100012
Q gi|255764498|r   40 NHLISYLNHLS-QRKLVTSSQRRKISVIRQFYNFLCYEG   77 (300)
Q Consensus        40 ~~i~~~~~~l~-~~~~s~~T~~~~~~~l~~~~~~~~~~~   77 (300)
                      ..|+.|+.++. ++|+|++|+..+...|+.|+.|+...+
T Consensus         4 ~~ie~fl~~l~~erg~S~~Ti~aY~~dl~~f~~~l~~~~   42 (98)
T d1a0pa1           4 ARIEQFLDALWLEKNLAENTLNAYRRDLSMMVEWLHHRG   42 (98)
T ss_dssp             HHHHHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             999999999998849599999999999999999887616


SCOP domain information

class: All alpha proteins
fold: SAM domain-like
superfamily: lambda integrase-like, N-terminal domain
family: lambda integrase-like, N-terminal domain
domain: Recombinase XerD
species: Escherichia coli [TaxId: 562]