BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764498|ref|YP_003065000.2| site-specific tyrosine
recombinase XerD [Candidatus Liberibacter asiaticus str. psy62]
         (300 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|255764498|ref|YP_003065000.2| site-specific tyrosine recombinase XerD [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254547849|gb|ACT57060.2| site-specific tyrosine recombinase XerD [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 300

 Score =  221 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 300/300 (100%), Positives = 300/300 (100%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR
Sbjct: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA
Sbjct: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL
Sbjct: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII
Sbjct: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHYN 300
           RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHYN
Sbjct: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHYN 300


>gi|154252172|ref|YP_001412996.1| tyrosine recombinase XerD [Parvibaculum lavamentivorans DS-1]
 gi|154156122|gb|ABS63339.1| tyrosine recombinase XerD [Parvibaculum lavamentivorans DS-1]
          Length = 319

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 140/300 (46%), Positives = 191/300 (63%), Gaps = 4/300 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+S+ER ++ NTL AY+RDLK+   FL ++   L  AS N +  YL +LS + L  S+  
Sbjct: 18  MLSAERGAARNTLDAYERDLKDFSGFLVSRGRDLVQASANDIRQYLENLSDQGLSASTAA 77

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S IRQF+ FL  EG+R D+P  ++E P++   LPKTL  + +  LL  A+   +   
Sbjct: 78  RRLSAIRQFHGFLFAEGVRTDDPCGSIEGPRRARPLPKTLTVEEVDALLSAAQRAEDGRT 137

Query: 121 PGQ----WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILS 176
             +    +KR R+  L+E+LYATG+RVSELV L    +   ER + + GKG +ERLV LS
Sbjct: 138 QEESVLAYKRARLVCLMEVLYATGLRVSELVGLPLSAVRGQERFLAVSGKGGRERLVPLS 197

Query: 177 PSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            +A  A+  Y    S         WLFPS  + GHL+R  FA+ LK LA  AG+    +S
Sbjct: 198 ETARAAIDAYLPLRSLRLGEQVSPWLFPSRGRQGHLTRHRFAQLLKDLAVAAGLDASRVS 257

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH +RHAFASHLL  GADLR +Q +LGH DISTTQIYTH+L ++L++LVQ +HPLAKK K
Sbjct: 258 PHTLRHAFASHLLANGADLRAVQQMLGHADISTTQIYTHVLDERLKELVQTHHPLAKKGK 317


>gi|51892959|ref|YP_075650.1| recombinase [Symbiobacterium thermophilum IAM 14863]
 gi|51856648|dbj|BAD40806.1| recombinase [Symbiobacterium thermophilum IAM 14863]
          Length = 294

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 108/291 (37%), Positives = 166/291 (57%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +S ER  + NTL +Y RDL++   +L   ++ L A S + +I+YL +L ++   T++  R
Sbjct: 12  LSVERGLATNTLESYGRDLRQYYQYLGEDQVDLDAVSRSTIINYLMYLQKQGKATATIAR 71

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           +++ ++ FY FL  E   K +P+  LE PK    LP+ L    +  LL Q         P
Sbjct: 72  RLAALKAFYQFLVREKRIKTDPTANLESPKLEKRLPRVLTVSEVERLLAQP-------DP 124

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RVSELV+L+   +NL    +   GKG+KER+V L   A+ 
Sbjct: 125 SLPAGLRDRAMLELLYATGIRVSELVSLNIEDVNLETGYIRCTGKGSKERIVPLGSLAIK 184

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      +   +      +     L+RQ F + +K  A  A I K+ I+PH +R
Sbjct: 185 WVKEYLQQGRPKLVKDREEAALFVNHHGHRLTRQGFWKIVKKYAEDARIDKE-ITPHTLR 243

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE GADLR++Q +LGH DISTTQIYTH+   +L+++    HP A
Sbjct: 244 HSFATHLLENGADLRSVQEMLGHADISTTQIYTHVTKGRLKEVYARTHPRA 294


>gi|121535764|ref|ZP_01667566.1| tyrosine recombinase XerD [Thermosinus carboxydivorans Nor1]
 gi|121305663|gb|EAX46603.1| tyrosine recombinase XerD [Thermosinus carboxydivorans Nor1]
          Length = 295

 Score =  210 bits (533), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 108/292 (36%), Positives = 163/292 (55%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISL-SAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  + NTL +Y RDL++ Q FL N ++ +   ++ N +++YLN+L  +    S+  
Sbjct: 12  LAVERGLAQNTLESYGRDLRQFQLFLQNDKLDIIKDSNRNTILNYLNNLQSKGRAVSTIS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ I+ FY +L  E     +P+  LE PK    LPK L    +  LL+Q         
Sbjct: 72  RNLAAIKSFYQYLVRERYIDKDPAANLESPKLEKKLPKILSIAEVEELLKQPNSLL---- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++ELLYATG+RVSEL++L+   +NL    +   GKG KER+V L   A 
Sbjct: 128 ---PTGLRDKAMLELLYATGIRVSELISLNITDVNLDMGYIKCYGKGAKERIVPLGSIAA 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +Q Y        +   D      +     L+RQ F + +K  A  A I K+ I+PH +
Sbjct: 185 KCVQEYIAKGRPKLVRTYDEPALFVNHHGNRLTRQGFWKIIKKYAQEANITKE-ITPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++Q +LGH DISTTQIYTH+  ++L+++    HP A
Sbjct: 244 RHSFATHLLENGADLRSVQEMLGHADISTTQIYTHVTKNRLKEVYDKAHPRA 295


>gi|150397765|ref|YP_001328232.1| site-specific tyrosine recombinase XerD [Sinorhizobium medicae
           WSM419]
 gi|150029280|gb|ABR61397.1| tyrosine recombinase XerD [Sinorhizobium medicae WSM419]
          Length = 313

 Score =  207 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 161/299 (53%), Positives = 212/299 (70%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER +++NTL +Y+RDL++ ++FL ++ + L  AS + L SYL+HL+     +SSQ 
Sbjct: 15  MMSAERGAAVNTLQSYERDLRDARSFLRSRGVGLVDASADDLRSYLSHLTGEGFKSSSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQFY FL  EGLR D P+  L+ PKKN  LPKTL  + +  L+ QA+ EAE   
Sbjct: 75  RRLSALRQFYKFLYAEGLRTDEPTGILDAPKKNRALPKTLSIEDVTRLIGQAETEAEKGG 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                ++R+  LIELLYATGMRVSELV+L A  L    R +II+GKGNKERLV LS +A+
Sbjct: 135 EDAVAKLRMHALIELLYATGMRVSELVSLPASVLAQDGRFLIIRGKGNKERLVPLSQTAI 194

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A++ Y +         +  WLFPS  + G+L RQVFARDLK+LAARAGI+   ISPH++
Sbjct: 195 RAMRAYGQALHREADGADSPWLFPSYGRNGYLPRQVFARDLKSLAARAGIRVAAISPHVL 254

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++L  LVQ +HPLAK+ KK  
Sbjct: 255 RHAFASHLLANGADLRAVQELLGHSDISTTQIYTHVLEERLHDLVQSHHPLAKQAKKQD 313


>gi|297616683|ref|YP_003701842.1| tyrosine recombinase XerD [Syntrophothermus lipocalidus DSM 12680]
 gi|297144520|gb|ADI01277.1| tyrosine recombinase XerD [Syntrophothermus lipocalidus DSM 12680]
          Length = 296

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/293 (35%), Positives = 161/293 (54%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN-NKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
           ++ ER  S NTL AY+RD+     +    + I  +S    + ++ +L  L +     SS 
Sbjct: 12  LNFERGLSENTLQAYRRDIGSFLVYCEKERGISDISQVKRHDVVDFLGWLLKGGRAYSSL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R +S ++ F+ F+  E     NP+D +E P+    LP+ L    +  LLEQ        
Sbjct: 72  ARTLSALKSFFRFMQKERYILTNPTDNIESPQVVRRLPRVLSVSEVEKLLEQPN------ 125

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
            P   + +R   ++EL+YATG+RVSEL+ L    +NL    +   GKG KER+V ++ ++
Sbjct: 126 -PVTVRGIRDRAMLELMYATGLRVSELLALQLEDINLVAGFVRCLGKGRKERIVPVNKTS 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  ++ Y     +  +  +       + K   LSRQ F + L   A +AGI+K+ I PH 
Sbjct: 185 VFWVERYISRSRNHLVKSSLERTLFVNAKGKKLSRQGFWKILNGYARQAGIEKE-IHPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTHL   +L+++ +  HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHLTKSRLREVYEKSHPRA 296


>gi|302389829|ref|YP_003825650.1| tyrosine recombinase XerD subunit [Thermosediminibacter oceani DSM
           16646]
 gi|302200457|gb|ADL08027.1| tyrosine recombinase XerD subunit [Thermosediminibacter oceani DSM
           16646]
          Length = 299

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 103/293 (35%), Positives = 164/293 (55%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNH-LISYLNHLSQRKLVTSSQ 59
            +S E+  + NT+ +Y+RDLK    FL ++ I     ++   +ISYL  + +    +SS 
Sbjct: 15  FLSVEKGLARNTIESYRRDLKSYLVFLRSQHIPDIKFTSKTTIISYLLLMQKSGKASSSI 74

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R  + I+ FY+FL  E   +++P+  L+ PK    LP+ L  + +  LLEQ        
Sbjct: 75  SRACAAIKSFYHFLVRERYIQEDPTVNLDTPKLEKKLPRVLTVEEVERLLEQP------- 127

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                   R   ++E+LYATG+RVSEL++L+   +NL    +   GKG+KER+V +   A
Sbjct: 128 DTSNPLGFRDKTMLEVLYATGIRVSELISLTVDDVNLDMGFLRCLGKGSKERIVPIGSFA 187

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           ++ L+ Y        + G    +   +     L+RQ F + +K  A +AGI  K I+PH 
Sbjct: 188 VNYLRQYINDVRKKILKGKSTNILFVNHMGQALTRQGFWKIIKKYARKAGIN-KVITPHT 246

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HL+E GADLR +Q +LGH DISTTQ+YTH+   +++++    HP A
Sbjct: 247 LRHSFATHLIENGADLRAVQEMLGHADISTTQVYTHITRTRIKEVYDKTHPRA 299


>gi|15966434|ref|NP_386787.1| site-specific tyrosine recombinase XerD [Sinorhizobium meliloti
           1021]
 gi|307318393|ref|ZP_07597828.1| tyrosine recombinase XerD [Sinorhizobium meliloti AK83]
 gi|34222988|sp|Q92ME3|XERD_RHIME RecName: Full=Tyrosine recombinase xerD
 gi|15075705|emb|CAC47260.1| Probable integrase/recombinase DNA recombination protein
           [Sinorhizobium meliloti 1021]
 gi|306896075|gb|EFN26826.1| tyrosine recombinase XerD [Sinorhizobium meliloti AK83]
          Length = 311

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 161/299 (53%), Positives = 217/299 (72%), Gaps = 2/299 (0%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTL +Y+RDL++ ++FL ++   L+ AS + L SYL+HL+ +    SSQ 
Sbjct: 15  MMSAERGAAANTLQSYERDLEDARSFLRSRGTGLTDASADDLRSYLSHLAGQGFKASSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQFY FL  EGLR D+P+  L+ PKK   LPKTL  + +  L+ QA+ EA++ +
Sbjct: 75  RRLSALRQFYKFLYAEGLRTDDPTGILDAPKKARTLPKTLSIEDVTRLIGQAEAEAKSGS 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                ++R+  LIELLYATGMRVSELV+L A  L    R +II+GKGNKERLV LS +A+
Sbjct: 135 DDVMAKLRMHALIELLYATGMRVSELVSLPASVLAQNGRFLIIRGKGNKERLVPLSQAAI 194

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A++ Y +       + +  WLFPS+ K+GHL RQVFARDLK+LAARAGI+   ISPH++
Sbjct: 195 RAMRAYGEALQEE--SADSPWLFPSNGKSGHLPRQVFARDLKSLAARAGIRVAAISPHVL 252

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++L  LVQ++HPLAK+ KK  
Sbjct: 253 RHAFASHLLANGADLRAVQELLGHSDISTTQIYTHVLEERLHDLVQNHHPLAKQAKKQD 311


>gi|328541970|ref|YP_004302079.1| Tyrosine recombinase XerD [polymorphum gilvum SL003B-26A1]
 gi|326411720|gb|ADZ68783.1| Tyrosine recombinase XerD [Polymorphum gilvum SL003B-26A1]
          Length = 308

 Score =  204 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 133/296 (44%), Positives = 186/296 (62%), Gaps = 5/296 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER ++ NTL +Y+RDL +   FL         A+   + +YL+ L+ R    SSQ 
Sbjct: 14  MLAAERGAAHNTLDSYRRDLDDFAAFLGTTAT--RDATAEDVSAYLSDLAARGFAASSQA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEA---E 117
           R++S +RQ++ FL  EG R D+P+ TL  PKK   LP+ L +  +  L+E A  +A    
Sbjct: 72  RRLSALRQYFKFLYAEGERGDDPTRTLASPKKRQGLPRILSEAEVDRLIEAACFDATLEH 131

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                  +  R++ L+E+LYATG+RVSELV L         R + I+GKG KERLV LSP
Sbjct: 132 ETPGRALRAQRLYTLLEVLYATGLRVSELVALPVGAALRDARLIGIRGKGGKERLVPLSP 191

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
            A  A++ Y    ++        WLFPS  ++GH +RQ FARDLK LA   G+    +SP
Sbjct: 192 RAQEAMRAYVARRNAEGAYKGSPWLFPSHGESGHFTRQAFARDLKDLARAVGLDAAKVSP 251

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           H++RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L++LV+ +HPLAK
Sbjct: 252 HVLRHAFASHLLQNGADLRVVQQLLGHADISTTQIYTHVLDERLRQLVEAHHPLAK 307


>gi|227823255|ref|YP_002827227.1| site-specific tyrosine recombinase XerD [Sinorhizobium fredii
           NGR234]
 gi|227342256|gb|ACP26474.1| tyrosine recombinase XerD [Sinorhizobium fredii NGR234]
          Length = 313

 Score =  204 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 162/299 (54%), Positives = 211/299 (70%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++INTL +Y+RDL++   FL +    L++A+ + L  YL+HL+     +SSQ 
Sbjct: 15  MMSAERGAAINTLQSYERDLRDALAFLRSSGARLNSATADDLKRYLSHLAGEGFKSSSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQFY FL  EGLR D+P+  L+ PKK   LPKTL  D +  L+ QA+ EA    
Sbjct: 75  RRLSALRQFYKFLYAEGLRGDDPTGILDAPKKARALPKTLSIDDVTRLIGQAEAEAAAGG 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
              + R+R+  LIELLYATGMRVSELV+L A  L    R ++I+GKGNKERLV LS +A+
Sbjct: 135 EDAFARLRMHALIELLYATGMRVSELVSLPASVLAQNGRFLVIRGKGNKERLVPLSQAAI 194

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A++ Y              WLFPSS K+GHL RQVFARDLK+LAARAGI+   ISPH++
Sbjct: 195 RAMRTYGDALRRRAAEAESPWLFPSSGKSGHLPRQVFARDLKSLAARAGIRVAVISPHVL 254

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++L +LVQ++HPLAK+ KK  
Sbjct: 255 RHAFASHLLANGADLRAVQELLGHSDISTTQIYTHVLEERLHELVQNHHPLAKQAKKQD 313


>gi|307300528|ref|ZP_07580308.1| tyrosine recombinase XerD [Sinorhizobium meliloti BL225C]
 gi|306904694|gb|EFN35278.1| tyrosine recombinase XerD [Sinorhizobium meliloti BL225C]
          Length = 311

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 160/299 (53%), Positives = 216/299 (72%), Gaps = 2/299 (0%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTL +Y+RDL++ ++FL ++   L+ AS + L SYL+HL+ +    SSQ 
Sbjct: 15  MMSAERGAAANTLQSYERDLEDARSFLRSRGTGLTDASADDLRSYLSHLAGQGFKASSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQFY FL  EGLR D+P+  L+ PKK   LPKTL  + +  L+ QA+ EA++ +
Sbjct: 75  RRLSALRQFYKFLYAEGLRTDDPTGILDAPKKARTLPKTLSIEDVTRLIGQAEAEAKSGS 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                ++R+  LIELLYATGMRVSELV+L A  L    R +II+GKGNKERLV LS +A+
Sbjct: 135 DDVMAKLRMHALIELLYATGMRVSELVSLPASVLAQNGRFLIIRGKGNKERLVPLSQAAI 194

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A++ Y +       + +  WLFPS+ K+GHL RQVFARDLK+LAARAGI+   I PH++
Sbjct: 195 RAMRAYGEALQEE--SADSPWLFPSNGKSGHLPRQVFARDLKSLAARAGIRVAAIWPHVL 252

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++L  LVQ++HPLAK+ KK  
Sbjct: 253 RHAFASHLLANGADLRAVQELLGHSDISTTQIYTHVLEERLHDLVQNHHPLAKQAKKQD 311


>gi|217963893|ref|YP_002349571.1| tyrosine recombinase XerD [Listeria monocytogenes HCC23]
 gi|290892115|ref|ZP_06555111.1| integrase/recombinase XerD [Listeria monocytogenes FSL J2-071]
 gi|217333163|gb|ACK38957.1| tyrosine recombinase XerD [Listeria monocytogenes HCC23]
 gi|290558238|gb|EFD91756.1| integrase/recombinase XerD [Listeria monocytogenes FSL J2-071]
 gi|307571537|emb|CAR84716.1| integrase/recombinase [Listeria monocytogenes L99]
          Length = 297

 Score =  202 bits (514), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 99/295 (33%), Positives = 159/295 (53%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFL--NNKEISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S NT+ AY+RDL+   +++         +    + ++ ++    Q      S
Sbjct: 11  FLIVERGLSANTIKAYERDLRYFVSYMDVAKGLTDPNTLERSDIVGFMAFARQEGKSPRS 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ +R F+++L ++G    +P   +E PK+   LPK L+ D +  LL         
Sbjct: 71  VARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQAQGLPKVLNLDDVEKLLSS------- 123

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RV+ELV+L    L+L    +   GKG+KER++ L  +
Sbjct: 124 SDTSTPLGLRDQAMMEILYATGLRVTELVSLKMDDLHLHMGFIQTIGKGDKERIIPLGKT 183

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A   L+ Y +     ++           +     L+RQ F + LK +A  +GI+K  I+P
Sbjct: 184 ATTVLEKYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKP-ITP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 243 HTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQFHPRA 297


>gi|162329627|ref|YP_471302.2| site-specific tyrosine recombinase XerD [Rhizobium etli CFN 42]
          Length = 317

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 164/303 (54%), Positives = 221/303 (72%), Gaps = 4/303 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTL +Y+RDL ++++FLN + I L+ A++  L +YL  L+++    SSQ 
Sbjct: 15  MMSAERGAAANTLQSYERDLDDVRSFLNGRSIRLTEAASADLAAYLASLARQGFKPSSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+++ +RQFY FL  EGLR D+P+  L+ PKK   LPKT+  + +  LL QA+ EA++PA
Sbjct: 75  RRLAAMRQFYKFLYAEGLRTDDPTGVLDAPKKGRPLPKTMGVEEVGRLLSQAQTEADDPA 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQ +R R+  L+ELLYATGMRVSELV+L A  L+   R ++I+GKGNKERLV LS SA+
Sbjct: 135 PGQLQRRRMLALLELLYATGMRVSELVSLPARVLDQEGRFLMIRGKGNKERLVPLSHSAI 194

Query: 181 HALQMY----KKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            AL+ Y        ++ K      WLFP+++K G+L RQVFARDLK LA RAG+    IS
Sbjct: 195 AALKSYGRLLAADAAAAKEPQESPWLFPAASKEGYLPRQVFARDLKNLAIRAGLTPSLIS 254

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++LQ+LVQ +HPLAK+ K
Sbjct: 255 PHVMRHAFASHLLANGADLRVVQELLGHSDISTTQIYTHVLEERLQQLVQMHHPLAKQAK 314

Query: 297 KHY 299
           KH 
Sbjct: 315 KHE 317


>gi|86283512|gb|ABC92575.1| tyrosine site-specific integrase/recombinase protein [Rhizobium
           etli CFN 42]
          Length = 383

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 164/303 (54%), Positives = 221/303 (72%), Gaps = 4/303 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTL +Y+RDL ++++FLN + I L+ A++  L +YL  L+++    SSQ 
Sbjct: 81  MMSAERGAAANTLQSYERDLDDVRSFLNGRSIRLTEAASADLAAYLASLARQGFKPSSQA 140

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+++ +RQFY FL  EGLR D+P+  L+ PKK   LPKT+  + +  LL QA+ EA++PA
Sbjct: 141 RRLAAMRQFYKFLYAEGLRTDDPTGVLDAPKKGRPLPKTMGVEEVGRLLSQAQTEADDPA 200

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQ +R R+  L+ELLYATGMRVSELV+L A  L+   R ++I+GKGNKERLV LS SA+
Sbjct: 201 PGQLQRRRMLALLELLYATGMRVSELVSLPARVLDQEGRFLMIRGKGNKERLVPLSHSAI 260

Query: 181 HALQMY----KKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            AL+ Y        ++ K      WLFP+++K G+L RQVFARDLK LA RAG+    IS
Sbjct: 261 AALKSYGRLLAADAAAAKEPQESPWLFPAASKEGYLPRQVFARDLKNLAIRAGLTPSLIS 320

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++LQ+LVQ +HPLAK+ K
Sbjct: 321 PHVMRHAFASHLLANGADLRVVQELLGHSDISTTQIYTHVLEERLQQLVQMHHPLAKQAK 380

Query: 297 KHY 299
           KH 
Sbjct: 381 KHE 383


>gi|188586285|ref|YP_001917830.1| tyrosine recombinase XerD subunit [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350972|gb|ACB85242.1| tyrosine recombinase XerD subunit [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 295

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 109/292 (37%), Positives = 164/292 (56%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NTL++Y RDLK    FLN + ++        H++ YL  + ++   +++  
Sbjct: 12  LNVERGLSENTLNSYLRDLKNFLEFLNQQGVTKWQEVKRTHIMKYLIFMKEKGKASATVT 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R I+ +R F+ FL  EG+  +NPS  LE PK+   LP+ L    +  LL Q         
Sbjct: 72  RNIASVRSFFQFLLQEGMISENPSTDLETPKQEKKLPEILSPQEVDKLLNQP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
              +K  R   ++E+LYATGMRVSEL++L+   ++     ++ +GKG+KER+V L   A+
Sbjct: 125 TTDFKGKRDKAMLEVLYATGMRVSELISLNVEHVDSNNGYILCKGKGDKERIVPLGKMAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            ++  Y                   +     LSRQ F + LK  A + GI++K I+PH +
Sbjct: 185 KSVSDYISKSRPQLRKNLSEPALFLNHHGKRLSRQGFWKILKKYAEKIGIKQK-ITPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q +LGH+DISTTQIYTHL   +L+ +    HP A
Sbjct: 244 RHSFATHLLENGADLRAVQEMLGHSDISTTQIYTHLTKQRLKDVYSKSHPRA 295


>gi|332312396|gb|EGJ25491.1| Tyrosine recombinase xerD [Listeria monocytogenes str. Scott A]
          Length = 302

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 99/295 (33%), Positives = 159/295 (53%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFL--NNKEISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S NT+ AY+RDL+   +++         +    + ++ ++    Q      S
Sbjct: 16  FLIVERGLSANTIKAYERDLRYFVSYMDVAKGLTDPNTLERSDIVGFMAFARQEGKSARS 75

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ +R F+++L ++G    +P   +E PK+   LPK L+ D +  LL         
Sbjct: 76  VARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQAQGLPKVLNLDDVEKLLSS------- 128

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RV+ELV+L    L+L    +   GKG+KER++ L  +
Sbjct: 129 SDTSTPLGLRDQAMMEILYATGLRVTELVSLKMDDLHLHMGFIQTIGKGDKERIIPLGKT 188

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A   L+ Y +     ++           +     L+RQ F + LK +A  +GI+K  I+P
Sbjct: 189 ATTVLEKYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKP-ITP 247

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 248 HTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQFHPRA 302


>gi|46908189|ref|YP_014578.1| integrase/recombinase XerD [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47093384|ref|ZP_00231151.1| integrase/recombinase XerD [Listeria monocytogenes str. 4b H7858]
 gi|226224560|ref|YP_002758667.1| integrase/recombinase [Listeria monocytogenes Clip81459]
 gi|254825549|ref|ZP_05230550.1| integrase/recombinase XerD [Listeria monocytogenes FSL J1-194]
 gi|254852857|ref|ZP_05242205.1| integrase/recombinase XerD [Listeria monocytogenes FSL R2-503]
 gi|254931873|ref|ZP_05265232.1| integrase/recombinase XerD [Listeria monocytogenes HPB2262]
 gi|254992940|ref|ZP_05275130.1| integrase/recombinase [Listeria monocytogenes FSL J2-064]
 gi|255520096|ref|ZP_05387333.1| integrase/recombinase [Listeria monocytogenes FSL J1-175]
 gi|300763733|ref|ZP_07073730.1| tyrosine recombinase XerD [Listeria monocytogenes FSL N1-017]
 gi|71153414|sp|Q71Y59|XERD_LISMF RecName: Full=Tyrosine recombinase xerD
 gi|46881459|gb|AAT04755.1| integrase/recombinase XerD [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47018255|gb|EAL09021.1| integrase/recombinase XerD [Listeria monocytogenes str. 4b H7858]
 gi|225877022|emb|CAS05731.1| Putative integrase/recombinase [Listeria monocytogenes serotype 4b
           str. CLIP 80459]
 gi|258606190|gb|EEW18798.1| integrase/recombinase XerD [Listeria monocytogenes FSL R2-503]
 gi|293583424|gb|EFF95456.1| integrase/recombinase XerD [Listeria monocytogenes HPB2262]
 gi|293594790|gb|EFG02551.1| integrase/recombinase XerD [Listeria monocytogenes FSL J1-194]
 gi|300515469|gb|EFK42519.1| tyrosine recombinase XerD [Listeria monocytogenes FSL N1-017]
 gi|328466303|gb|EGF37460.1| tyrosine recombinase xerD [Listeria monocytogenes 1816]
 gi|328472797|gb|EGF43646.1| tyrosine recombinase xerD [Listeria monocytogenes 220]
          Length = 297

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 99/295 (33%), Positives = 159/295 (53%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFL--NNKEISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S NT+ AY+RDL+   +++         +    + ++ ++    Q      S
Sbjct: 11  FLIVERGLSANTIKAYERDLRYFVSYMDVAKGLTDPNTLERSDIVGFMAFARQEGKSARS 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ +R F+++L ++G    +P   +E PK+   LPK L+ D +  LL         
Sbjct: 71  VARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQAQGLPKVLNLDDVEKLLSS------- 123

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RV+ELV+L    L+L    +   GKG+KER++ L  +
Sbjct: 124 SDTSTPLGLRDQAMMEILYATGLRVTELVSLKMDDLHLHMGFIQTIGKGDKERIIPLGKT 183

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A   L+ Y +     ++           +     L+RQ F + LK +A  +GI+K  I+P
Sbjct: 184 ATTVLEKYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKP-ITP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 243 HTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQFHPRA 297


>gi|254501286|ref|ZP_05113437.1| tyrosine recombinase XerD [Labrenzia alexandrii DFL-11]
 gi|222437357|gb|EEE44036.1| tyrosine recombinase XerD [Labrenzia alexandrii DFL-11]
          Length = 307

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 140/297 (47%), Positives = 199/297 (67%), Gaps = 5/297 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER ++ NTL+ Y+RDL++  +FL   +  L+ A+++H+  Y++ L++R    +SQ 
Sbjct: 13  MLAAERGAAENTLAGYRRDLEDFSDFLGRTK--LAEANSDHISGYMSDLTRRGFAETSQA 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE---AE 117
           R++S ++QFY FL  EG R+D+P+ TL  PKK   LPK L  D +  L+E A+ +   + 
Sbjct: 71  RRLSALKQFYKFLYSEGSRQDDPTRTLSAPKKRGSLPKVLSMDEVDRLIETARQQTKVSH 130

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
             A    +  R++ LIE+LYATG+RVSELV L         R + I+GKG KERLV LS 
Sbjct: 131 KSAAAALRAQRMYTLIEVLYATGLRVSELVALPVTAALRDARLIEIKGKGGKERLVPLSH 190

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           +A  A++MY    S+     N  WLFPS   +GHL+RQ F RDLK LA  AG+    +SP
Sbjct: 191 AAQSAMKMYVGLRSAEGAYENSPWLFPSHGGSGHLTRQHFGRDLKDLAIAAGLDASKVSP 250

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           H++RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L++LV+  HPLA+K
Sbjct: 251 HVLRHAFASHLLQNGADLRVVQQLLGHADISTTQIYTHVLDERLRELVETAHPLARK 307


>gi|323340732|ref|ZP_08080984.1| integrase/recombinase XerD [Lactobacillus ruminis ATCC 25644]
 gi|323091855|gb|EFZ34475.1| integrase/recombinase XerD [Lactobacillus ruminis ATCC 25644]
          Length = 300

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 99/292 (33%), Positives = 158/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           + +ER  S NT+S+Y  DL++  N+L+  +I  L+      ++ YL++L  +    +S  
Sbjct: 17  LKAERGLSENTVSSYGLDLQQFINYLSEHKITDLNDVDKQVIVDYLDYLMNKGKANASII 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ +R+F+  +  +   +D+P  ++E PK    LP+ L  + +  LL           
Sbjct: 77  RCVTSLRKFFQSMKQDEKIQDDPMISIETPKGEKHLPEVLSIEEVEMLLNAP-------D 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             Q   +R   ++EL+YATG+RVSE+V L    L+L    +   GKG KER+V +   A+
Sbjct: 130 TSQTLGIRNRAILELMYATGLRVSEVVNLKLEDLHLDVGIIQTMGKGRKERIVPIGDEAI 189

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +  Y                   +     L+RQ   ++LK    +AGI  KN++PH +
Sbjct: 190 VWINNYLNDARPELCKNKRSPFLFVNFHGERLTRQGIWKNLKNEVKKAGIS-KNVTPHTL 248

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+H+LE GADLR +Q LLGH+DISTTQIYTH+   +L K+  + HP A
Sbjct: 249 RHSFATHILENGADLRIVQELLGHSDISTTQIYTHISKKRLSKIYDESHPHA 300


>gi|118592100|ref|ZP_01549494.1| probable site-specific integrase/recombinase [Stappia aggregata IAM
           12614]
 gi|118435396|gb|EAV42043.1| probable site-specific integrase/recombinase [Stappia aggregata IAM
           12614]
          Length = 307

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 141/297 (47%), Positives = 194/297 (65%), Gaps = 5/297 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER ++ NTL+ Y+RDL++   FL  K  SL++A +  + +YL  L++R    +SQ 
Sbjct: 13  MLAAERGAAENTLAGYRRDLEDFSGFLGRK--SLASAQSEDISAYLGDLNRRGFAETSQA 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S ++QFY FL  EG R+D+P+ TL  PKK   LPK L  + +  L+E A+ E E P 
Sbjct: 71  RRLSALKQFYKFLYAEGTREDDPTRTLSAPKKRASLPKVLSIEDVDRLIETARAETERPR 130

Query: 121 PGQWKRVRIFLLI---ELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                R+R   +    E+LYATG+RVSELV L         R + I+GKG KERLV LS 
Sbjct: 131 KSATARLRAQRMYTLIEVLYATGLRVSELVALPVTAALRDARLIEIKGKGGKERLVPLSR 190

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           +A  A++ Y    ++        WLFPS   +GHL+RQ FAR+LK LA  AG+    ISP
Sbjct: 191 AAQAAMKDYVGLRAAEGAYEKSPWLFPSHGDSGHLTRQHFARELKDLAVAAGLDAGKISP 250

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           H++RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L++LV+  HPLAKK
Sbjct: 251 HVLRHAFASHLLQNGADLRVVQQLLGHADISTTQIYTHVLDERLRELVESAHPLAKK 307


>gi|147677545|ref|YP_001211760.1| site-specific recombinase XerD [Pelotomaculum thermopropionicum SI]
 gi|146273642|dbj|BAF59391.1| site-specific recombinase XerD [Pelotomaculum thermopropionicum SI]
          Length = 295

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 107/292 (36%), Positives = 161/292 (55%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NTL +Y+ DL +  +F     + S+  A  + +++YL  L      T++  
Sbjct: 12  LAVERGLSENTLVSYRADLAKFISFCAKAGLKSVEQAGRDTVMAYLFQLQLDGRSTATIS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ IR FY F   EG+   +PS  LE PK    LP+ L  + +  L+ Q         
Sbjct: 72  RHLASIRAFYRFAVGEGILPADPSSDLETPKPAQKLPRVLSVEEVDLLMGQP-------G 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            G+   +R   ++ELLYATGMRVSELV+L+   +NL    +   GKG++ER++ +   A+
Sbjct: 125 SGEPAGLRDKAMLELLYATGMRVSELVSLNLEHVNLENGFVRCLGKGSRERIIPVGDVAV 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y +                 +     L+RQ F + +K  A +A I KK I+PH +
Sbjct: 185 RWLKEYLERARYKLSKPGRTDALFVNQHGRRLTRQGFWKIIKKYARKAKI-KKVITPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++Q +LGH DISTTQIYTHL  ++L+ +    HP A
Sbjct: 244 RHSFATHLLENGADLRSVQEMLGHADISTTQIYTHLTRNRLRDVYNRTHPRA 295


>gi|332716418|ref|YP_004443884.1| tyrosine recombinase xerD [Agrobacterium sp. H13-3]
 gi|325063103|gb|ADY66793.1| tyrosine recombinase xerD [Agrobacterium sp. H13-3]
          Length = 331

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 158/309 (51%), Positives = 211/309 (68%), Gaps = 13/309 (4%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTLS+Y+RDL +++ FL  +  SL  A+T  L +YL HLS +    +SQ 
Sbjct: 20  MMSAERGAAANTLSSYERDLSDLREFLGGRGQSLMEAATADLSAYLTHLSTQGFAATSQA 79

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQFY FL  EGLR D+P+ T++ PKK   LPKT+    +  LL  A  EA    
Sbjct: 80  RRLSSMRQFYRFLYSEGLRGDDPTGTIDAPKKGLTLPKTMSVADVTKLLGIAAEEAALTG 139

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQ  R+R+ LL+ELLYATGMRVSELV+L    L    R ++I+GKGNK+R+V+LS +A+
Sbjct: 140 PGQLARIRMHLLLELLYATGMRVSELVSLPVKVLRQEGRFLMIRGKGNKDRMVLLSRAAI 199

Query: 181 HALQMYKKTCSSMKMTG-------------NDLWLFPSSTKTGHLSRQVFARDLKALAAR 227
            A++ Y     S+                    WLFPS++K GHL RQVFARDLK +A R
Sbjct: 200 EAMEKYDAARKSLVPEKSRTPASPKKADSPESPWLFPSNSKEGHLPRQVFARDLKDIAIR 259

Query: 228 AGIQKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQD 287
           AG+    +SPH++RHAFASHLL+ GADLR +Q LLGH+DISTTQIYTH+L ++LQ+LVQ 
Sbjct: 260 AGLNPSAVSPHVLRHAFASHLLQNGADLRAVQELLGHSDISTTQIYTHVLEERLQELVQT 319

Query: 288 YHPLAKKEK 296
           +HPLAK+ K
Sbjct: 320 HHPLAKQGK 328


>gi|295695953|ref|YP_003589191.1| tyrosine recombinase XerD [Bacillus tusciae DSM 2912]
 gi|295411555|gb|ADG06047.1| tyrosine recombinase XerD [Bacillus tusciae DSM 2912]
          Length = 295

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 106/292 (36%), Positives = 165/292 (56%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ E+  + +TL +Y+ DL++  +FL              H+++YL HL +     ++  
Sbjct: 12  LAIEKGLAPSTLGSYRSDLEDFSDFLQRTGCGDWPETGRRHIVAYLAHLQKLGRAPATVS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ +R FY FL  EGL + +P+  L+ PK +  LP+ L+ + +  LL   +       
Sbjct: 72  RHMASLRSFYQFLSREGLIEVDPTGQLDSPKADKRLPRVLNVEEVERLLAAPEGL----- 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++E+LYATG+RVSELV+L+   +NL    +   GKG+KER+V L  +AL
Sbjct: 127 --TPMALRDRAMLEMLYATGVRVSELVSLNVTDVNLNMGYVKCYGKGSKERIVPLGSAAL 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  Y     +  +   D      + +   L+RQ F + LK  A  AGIQ K I+PH +
Sbjct: 185 EAVHAYLTRGRAGLLKNGDPGALFVNHQGKRLTRQGFWKILKKYAQTAGIQ-KAITPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + +  HP A
Sbjct: 244 RHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTQTRLKDVYERTHPRA 295


>gi|16803994|ref|NP_465479.1| hypothetical protein lmo1955 [Listeria monocytogenes EGD-e]
 gi|47097098|ref|ZP_00234668.1| integrase/recombinase XerD [Listeria monocytogenes str. 1/2a F6854]
 gi|224498595|ref|ZP_03666944.1| hypothetical protein LmonF1_02414 [Listeria monocytogenes Finland
           1988]
 gi|224501245|ref|ZP_03669552.1| hypothetical protein LmonFR_01770 [Listeria monocytogenes FSL
           R2-561]
 gi|254827160|ref|ZP_05231847.1| integrase/recombinase XerD [Listeria monocytogenes FSL N3-165]
 gi|254899348|ref|ZP_05259272.1| hypothetical protein LmonJ_06029 [Listeria monocytogenes J0161]
 gi|254912513|ref|ZP_05262525.1| tyrosine recombinase XerD [Listeria monocytogenes J2818]
 gi|254936840|ref|ZP_05268537.1| integrase/recombinase XerD [Listeria monocytogenes F6900]
 gi|255028942|ref|ZP_05300893.1| hypothetical protein LmonL_06711 [Listeria monocytogenes LO28]
 gi|34222939|sp|Q8Y5V0|XERD_LISMO RecName: Full=Tyrosine recombinase xerD
 gi|16411408|emb|CAD00033.1| lmo1955 [Listeria monocytogenes EGD-e]
 gi|47014543|gb|EAL05506.1| integrase/recombinase XerD [Listeria monocytogenes str. 1/2a F6854]
 gi|258599542|gb|EEW12867.1| integrase/recombinase XerD [Listeria monocytogenes FSL N3-165]
 gi|258609436|gb|EEW22044.1| integrase/recombinase XerD [Listeria monocytogenes F6900]
 gi|293590498|gb|EFF98832.1| tyrosine recombinase XerD [Listeria monocytogenes J2818]
          Length = 297

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 99/295 (33%), Positives = 160/295 (54%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S NT+ AY+RDL    ++++   +    +    + ++ ++    Q      S
Sbjct: 11  FLIVERGLSANTIKAYERDLHYFVSYMDVTKELTDPNTLERSDIVGFMAFARQEGKSPRS 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ +R F+++L ++G    +P   +E PK+   LPK L+ D +  LL         
Sbjct: 71  VARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQAQGLPKVLNLDDVEKLLSS------- 123

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RV+ELV+L    L+L    +   GKG+KER++ L  +
Sbjct: 124 SDTSTPLGLRDQAMMEILYATGLRVTELVSLKMDDLHLHMGFIQTIGKGDKERIIPLGKT 183

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A   L+ Y +     ++           +     L+RQ F + LK +A  +GI+K  I+P
Sbjct: 184 ATTVLEKYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKP-ITP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 243 HTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQFHPRA 297


>gi|289435303|ref|YP_003465175.1| integrase/recombinase XerD [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171547|emb|CBH28093.1| integrase/recombinase XerD [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
          Length = 297

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 98/295 (33%), Positives = 158/295 (53%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  E+  S NT+ AY+RDL    +++N        +    + ++ ++    +      S
Sbjct: 11  FLIVEKGLSANTIKAYERDLHYFVSYINTARPLTDPNTLERSDIVGFMAFARKEGKSARS 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ +R F+++L ++G    +P   +E PK+   LPK L+ D +  LL         
Sbjct: 71  VARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQAQGLPKVLNLDDVELLLSS------- 123

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RV+ELV L    L+L    +   GKG+KER++ L  +
Sbjct: 124 SDTSTPLGLRDQAMMEILYATGLRVTELVQLKMDDLHLQMGFIQTIGKGDKERIIPLGKT 183

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A   L+ Y +     ++           +     L+RQ F + LK +A  +GI+K  I+P
Sbjct: 184 ATTVLEQYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKP-ITP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 243 HTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQFHPRA 297


>gi|15891311|ref|NP_356983.1| site-specific tyrosine recombinase XerD [Agrobacterium tumefaciens
           str. C58]
 gi|34222927|sp|Q8U9U6|XERD_AGRT5 RecName: Full=Tyrosine recombinase xerD
 gi|15159692|gb|AAK89768.1| site-specific recombinase [Agrobacterium tumefaciens str. C58]
          Length = 331

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 153/309 (49%), Positives = 210/309 (67%), Gaps = 13/309 (4%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTLS+Y+ DL +++ FL  +  SL+ A T  L +YL HL+ +    +SQ 
Sbjct: 20  MMSAERGAAANTLSSYEHDLADLREFLGRRGQSLTEAQTPDLSAYLTHLAAQGFAATSQA 79

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQFY FL  EGLR D+P+  ++ P+K   LPKT+    +  LL  A  EA    
Sbjct: 80  RRLSSMRQFYRFLYSEGLRGDDPTGIIDAPRKGLALPKTMSVADVNRLLGLAAQEAATEG 139

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQ  R+R+ LL+ELLYATGMRVSELV+L    L    R ++I+GKGNK+R+V+LS +A+
Sbjct: 140 PGQLARIRMHLLLELLYATGMRVSELVSLPVKVLRQEGRFLMIRGKGNKDRMVLLSRAAI 199

Query: 181 HALQMYKKTCSSMKMTG-------------NDLWLFPSSTKTGHLSRQVFARDLKALAAR 227
            A++ Y+    ++                    WLFPS++K GHL RQVFARDLK +A R
Sbjct: 200 EAMEKYEAGRKALSQEKSKAAASQKKTDTAESPWLFPSNSKEGHLPRQVFARDLKDIAIR 259

Query: 228 AGIQKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQD 287
           AG+    +SPH++RHAFASHLL+ GADLR +Q LLGH+DISTTQIYTH+L ++LQ+LVQ 
Sbjct: 260 AGLTASAVSPHVLRHAFASHLLQNGADLRAVQELLGHSDISTTQIYTHVLEERLQELVQT 319

Query: 288 YHPLAKKEK 296
           +HPLAK+ K
Sbjct: 320 HHPLAKQGK 328


>gi|315121780|ref|YP_004062269.1| site-specific tyrosine recombinase XerD [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495182|gb|ADR51781.1| site-specific tyrosine recombinase XerD [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 318

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 239/297 (80%), Positives = 271/297 (91%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMSSERA+S+NTL++YK DL+E+Q FL++ ++ LS AS+++LI+YLNHLSQRKL  SSQR
Sbjct: 21  MMSSERAASVNTLTSYKSDLEEVQLFLDDDDLLLSKASSDNLIAYLNHLSQRKLKASSQR 80

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS IRQFYNFLC EGLRKDNPS+TL+ PKKNH LPKTLHK+ IA+LL+QAKIE+E+P+
Sbjct: 81  RKISAIRQFYNFLCCEGLRKDNPSETLQFPKKNHTLPKTLHKNAIADLLKQAKIESEDPS 140

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQWKR+R+FLLIELLY+TGMRVSELVTLS+HTLNL ER MII+GKGN+ER VI SPS+L
Sbjct: 141 PGQWKRIRMFLLIELLYSTGMRVSELVTLSSHTLNLEERIMIIKGKGNRERFVIFSPSSL 200

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            ALQMYKK CS+M+MT N  WLFPSSTKTGHLSRQVFARDLK LA+RA IQ KNISPHII
Sbjct: 201 CALQMYKKMCSTMEMTKNSPWLFPSSTKTGHLSRQVFARDLKELASRASIQTKNISPHII 260

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           RHAFASHLLEGGADLRTIQILLGH DISTTQIYTHLLPDKLQKLVQDYHPLAKK KK
Sbjct: 261 RHAFASHLLEGGADLRTIQILLGHIDISTTQIYTHLLPDKLQKLVQDYHPLAKKLKK 317


>gi|116873397|ref|YP_850178.1| integrase/recombinase [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|116742275|emb|CAK21399.1| integrase/recombinase [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 297

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 98/295 (33%), Positives = 158/295 (53%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  E+  S NT+ AY+RDL+   +++         +    + ++ ++    Q      S
Sbjct: 11  FLIVEKGLSANTIKAYQRDLRYFVSYMETSKNLTDPNILERSDIVGFMAFARQEGKSARS 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ +R F+++L ++G    +P   +E PK+   LPK L+ D +  LL         
Sbjct: 71  VARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQAQSLPKVLNLDDVEKLLSS------- 123

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RV+ELV L    L+L    +   GKG+KER++ L  +
Sbjct: 124 SDISTPLGLRDQAMMEILYATGLRVTELVRLKMDDLHLHMGFIQTIGKGDKERIIPLGKT 183

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A   L+ Y +     ++           +     L+RQ F + LK +A  +GI+K  I+P
Sbjct: 184 ATTVLEQYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKP-ITP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 243 HTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQFHPRA 297


>gi|254831444|ref|ZP_05236099.1| hypothetical protein Lmon1_08823 [Listeria monocytogenes 10403S]
 gi|284802400|ref|YP_003414265.1| hypothetical protein LM5578_2156 [Listeria monocytogenes 08-5578]
 gi|284995542|ref|YP_003417310.1| hypothetical protein LM5923_2107 [Listeria monocytogenes 08-5923]
 gi|284057962|gb|ADB68903.1| hypothetical protein LM5578_2156 [Listeria monocytogenes 08-5578]
 gi|284061009|gb|ADB71948.1| hypothetical protein LM5923_2107 [Listeria monocytogenes 08-5923]
          Length = 297

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 99/295 (33%), Positives = 160/295 (54%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S NT+ AY+RDL    ++++   +    +    + ++ ++    Q      S
Sbjct: 11  FLIVERGLSANTIKAYERDLHYFVSYMDVTKELTDPNTLERSDIVGFMAFARQEGKSPRS 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ +R F+++L ++G    +P   +E PK+   LPK L+ D +  LL         
Sbjct: 71  VARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQAKGLPKVLNLDDVEKLLSS------- 123

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RV+ELV+L    L+L    +   GKG+KER++ L  +
Sbjct: 124 SDTSTPLGLRDQAMMEILYATGLRVTELVSLKMDDLHLHMGFIQTIGKGDKERIIPLGKT 183

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A   L+ Y +     ++           +     L+RQ F + LK +A  +GI+K  I+P
Sbjct: 184 ATTVLEKYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKP-ITP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 243 HTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQFHPRA 297


>gi|16801135|ref|NP_471403.1| hypothetical protein lin2069 [Listeria innocua Clip11262]
 gi|34222947|sp|Q92A53|XERD_LISIN RecName: Full=Tyrosine recombinase xerD
 gi|16414570|emb|CAC97299.1| lin2069 [Listeria innocua Clip11262]
 gi|313618111|gb|EFR90213.1| tyrosine recombinase XerD [Listeria innocua FSL S4-378]
 gi|313623100|gb|EFR93374.1| tyrosine recombinase XerD [Listeria innocua FSL J1-023]
          Length = 297

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 98/295 (33%), Positives = 157/295 (53%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI--SLSAASTNHLISYLNHLSQRKLVTSS 58
            +  E+  S NT+ AY+RDL    ++++             N ++ ++    +      S
Sbjct: 11  FLIVEKGLSANTIKAYERDLHYFVSYMDTSRTLTDPDTLERNDIVGFMAFARKEGKSPRS 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ +R F+++L ++G    +P   +E PK+   LPK L+ D +  LL         
Sbjct: 71  VARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQAQSLPKVLNLDDVEKLLSS------- 123

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RV+ELV L    L+L    +   GKG+KER++ L  +
Sbjct: 124 SDTSTPLGLRDQAMLEILYATGLRVTELVKLKMDDLHLQMGFIQTIGKGDKERIIPLGKT 183

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A   L+ Y +     ++           +     L+RQ F + LK +A  +GI+K  I+P
Sbjct: 184 ATTVLEQYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKP-ITP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 243 HTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQFHPRA 297


>gi|258511717|ref|YP_003185151.1| tyrosine recombinase XerD [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257478443|gb|ACV58762.1| tyrosine recombinase XerD [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 294

 Score =  199 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 96/291 (32%), Positives = 165/291 (56%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT ++Y RDL +   +L  ++ ++  A    ++ YL+ L +R + +++  R
Sbjct: 12  LRLERGLSENTATSYARDLADFSQYLAREQRTMRDADRTAVLRYLSDLKRRGMKSTTIAR 71

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           ++S +R F+ +L  EG+ + +P+  +E+   +  LP+ + ++ +  L+   +        
Sbjct: 72  RMSALRSFFRYLLREGVLQADPTANIEVAAPDEHLPRVVSEEDVERLIGAVR-------R 124

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E LYATG+RVSEL+ LS   + L    + + GKG KER+V L   A  
Sbjct: 125 PDAMGLRDRAMLETLYATGVRVSELLALSLEDVELAAGFIRVFGKGKKERVVPLGEIAQD 184

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           AL +Y +    + +          +     ++RQ F   LK  A +AG+  + ++PH +R
Sbjct: 185 ALGLYLRYGRPLLVRDRGESAVFLNRLGRRMTRQGFWNILKGYARQAGVSAE-VTPHTLR 243

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLEGGADLR +Q LLGH DISTT+ YTH+ P +L+++ ++ HP A
Sbjct: 244 HSFATHLLEGGADLRVVQELLGHADISTTERYTHVTPHRLREVYRNAHPRA 294


>gi|190893664|ref|YP_001980206.1| tyrosine site-specific integrase/recombinase [Rhizobium etli CIAT
           652]
 gi|190698943|gb|ACE93028.1| tyrosine site-specific integrase/recombinase protein [Rhizobium
           etli CIAT 652]
          Length = 383

 Score =  199 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 161/303 (53%), Positives = 223/303 (73%), Gaps = 4/303 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTL +Y+RDL ++++FLN + I L+ A++  L +YL  L+++    SSQ 
Sbjct: 81  MMSAERGAAANTLQSYERDLDDIRSFLNGRSIRLTEAASADLSAYLASLARQGFKPSSQA 140

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+++ +RQFY FL  EG+R D+P+  L+ PKK   LPKT+  + ++ LL QA+ EA++PA
Sbjct: 141 RRLAAMRQFYKFLYAEGIRTDDPTGVLDAPKKGRPLPKTMGVEEVSRLLSQAQAEADDPA 200

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQ +R+R+  L+ELLYATGMRVSELV+L A  L+   R ++I+GKGNKERLV LS SA+
Sbjct: 201 PGQLQRLRMLALLELLYATGMRVSELVSLPARVLDQEGRFLMIRGKGNKERLVPLSQSAI 260

Query: 181 HALQMYKK----TCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            AL+ Y +      ++ K      +LF +++K G+L RQVFARDLK LA RAG+    IS
Sbjct: 261 KALKSYGRLLAAENAAAKEPQESPFLFSAASKEGYLPRQVFARDLKNLAIRAGLTPSLIS 320

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++LQ+LVQ +HPLAK+ K
Sbjct: 321 PHVMRHAFASHLLANGADLRVVQELLGHSDISTTQIYTHVLEERLQQLVQTHHPLAKQAK 380

Query: 297 KHY 299
           KH 
Sbjct: 381 KHE 383


>gi|299821615|ref|ZP_07053503.1| tyrosine recombinase XerD [Listeria grayi DSM 20601]
 gi|299817280|gb|EFI84516.1| tyrosine recombinase XerD [Listeria grayi DSM 20601]
          Length = 296

 Score =  199 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 95/292 (32%), Positives = 149/292 (51%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+  + NT+ AYKRDL+   +FL  + I   ++ +   +++++           +  
Sbjct: 12  LVVEKGLAANTIQAYKRDLRYFDSFLEIEGITDPNSITRGTVVAFIAFARDADKSPRTIA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ +R F++FL ++     +P   +E PK+   LPK LH + +  LL           
Sbjct: 72  RYLASLRSFFHFLLHDQKMDHDPMIQIETPKQTKALPKVLHLEEVEKLLAAP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           P     +R   ++E+LYATG+RVSEL+ L    L+L    +   GKG+KER++ L  +A 
Sbjct: 125 PNSILGLRDQAMLEILYATGLRVSELIHLKLDDLHLHMGFIQTIGKGDKERIIPLGHTAT 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L  Y +              +      G    +     L    A+     K I+PH +
Sbjct: 185 AVLTKYLEEARPKLRKPKYRNDYVFLNHHGGGLTRQGFWKLLKQLAQKAGIDKPITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +LQ + + YHP A
Sbjct: 245 RHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLQDVYKKYHPRA 296


>gi|116618399|ref|YP_818770.1| tyrosine recombinase XerD subunit [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|116097246|gb|ABJ62397.1| tyrosine recombinase XerD subunit [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
          Length = 297

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 102/291 (35%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT+ +Y +DL +   +LN +++ L       ++S+LN L       SS  R
Sbjct: 15  IRIERGLSENTIKSYHQDLVQFGEYLNGEKLVLDQVDHIVILSWLNKLRDLGKSNSSVIR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ +R F+ +L  E +   NP + +  PKK   LP  L  + I  LL+    +      
Sbjct: 75  MVTTLRNFFGYLVREKVVAHNPMNDVRPPKKAEHLPAVLSIEEIDRLLQAPIED------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   L+E++YATG+RVSELV L    L+L    +   GKG+KER++ +   A+ 
Sbjct: 129 -TPLGLRNRTLLEVMYATGLRVSELVNLKMSDLHLQLGLIQTLGKGDKERIIPIGEIAID 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L  Y      + +   +      + +   +SRQ   + +K L   AGI  K++SPH +R
Sbjct: 188 WLTRYFNESRIVLLKDKESPYVFLNDRGNQISRQGIWKIIKKLVTTAGIT-KDVSPHTLR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+H+LE GADLR +Q LLGH DISTTQIYTH+   +L ++  +YHP A
Sbjct: 247 HSFATHILENGADLRIVQELLGHADISTTQIYTHISKKRLSEVYDEYHPRA 297


>gi|227431702|ref|ZP_03913732.1| site-specific recombinase XerD [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
 gi|227352526|gb|EEJ42722.1| site-specific recombinase XerD [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
          Length = 298

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 103/291 (35%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT+ +Y +DL +   +LN +++ L       ++S+LN L       SS  R
Sbjct: 16  IRIERGLSENTIKSYHQDLVQFGEYLNGEKLVLDQVDHIVILSWLNQLRDLGKSNSSVIR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ +R F+ +L  E +   NP + +  PKK   LP  L  + I  LL+    +      
Sbjct: 76  MVTTLRNFFGYLVREKVVAHNPMNDVRPPKKAEHLPAVLSIEEIDRLLQAPIED------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   LIE++YATG+RVSELV L    L+L    +   GKG+KER++ +   A+ 
Sbjct: 130 -TPLGLRNRTLIEVMYATGLRVSELVNLKMSDLHLQLGLIQTLGKGDKERIIPIGEIAID 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L  Y      + +   +      + +   +SRQ   + +K L   AGI  K++SPH +R
Sbjct: 189 WLTRYFNESRIVLLKDKESPYVFLNDRGNQISRQGIWKIIKKLVTTAGIT-KDVSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+H+LE GADLR +Q LLGH DISTTQIYTH+   +L ++  +YHP A
Sbjct: 248 HSFATHILENGADLRIVQELLGHADISTTQIYTHISKKRLSEVYDEYHPRA 298


>gi|327188713|gb|EGE55912.1| tyrosine site-specific integrase/recombinase protein [Rhizobium
           etli CNPAF512]
          Length = 317

 Score =  198 bits (503), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 161/303 (53%), Positives = 221/303 (72%), Gaps = 4/303 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTL +Y+RDL ++++FLN + I L+ A++  L +YL  L+ +    SSQ 
Sbjct: 15  MMSAERGAAANTLQSYERDLDDIRSFLNGRSIRLTEAASADLSAYLASLASQGFKPSSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+++ +RQFY FL  EG+R D+P+  L+ PKK   LPKT+  + +  LL QA+ EA++PA
Sbjct: 75  RRLAAMRQFYKFLYAEGIRTDDPTGVLDAPKKGRPLPKTMGVEEVGRLLSQAQTEADDPA 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQ +R+R+  L+ELLYATGMRVSELV+L A  L+   R ++I+GKGNKERLV LS SA+
Sbjct: 135 PGQLQRLRMLALLELLYATGMRVSELVSLPAGVLDQEGRFLMIRGKGNKERLVPLSQSAI 194

Query: 181 HALQMYKK----TCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            AL+ Y +      ++ K      +LF +++K G+L RQVFARDLK LA RAG+    IS
Sbjct: 195 KALKSYGRLLAAENAAAKEPQESPFLFSAASKEGYLPRQVFARDLKNLAIRAGLTPSLIS 254

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++LQ+LVQ +HPLAK+ K
Sbjct: 255 PHVMRHAFASHLLANGADLRVVQELLGHSDISTTQIYTHVLEERLQQLVQTHHPLAKQAK 314

Query: 297 KHY 299
           KH 
Sbjct: 315 KHE 317


>gi|328957336|ref|YP_004374722.1| site-specific tyrosine recombinase XerD [Carnobacterium sp. 17-4]
 gi|328673660|gb|AEB29706.1| site-specific tyrosine recombinase XerD [Carnobacterium sp. 17-4]
          Length = 299

 Score =  198 bits (503), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 167/294 (56%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            ++ ER  S NT+ +YKRD+++   F+   +++         ++S+L  L +++    + 
Sbjct: 14  FLTIERGLSKNTIESYKRDIRQYLVFIEQIKVTKWDQIDRYTVLSFLQDLKEKEKSAGTI 73

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS +RQF+ FL  E + + +P   ++ PKK   LPK L    +  L+E         
Sbjct: 74  IRMISCLRQFHQFLKQEQISQSDPMLHIDTPKKAQKLPKVLSIKEVDRLIETPN------ 127

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
             G+   +R   ++E++YATG+RVSEL  L    L+L+   +   GKG+KER++ L   A
Sbjct: 128 -TGETLGLRDRAMLEVMYATGLRVSELTELKLDDLHLSLGLIQTIGKGDKERIIPLGDLA 186

Query: 180 LHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           +  ++ Y +   + ++  G        +     L+RQ   ++LK +  +AGI+K+ ++PH
Sbjct: 187 ITWIEKYLRYSRTKLEKDGQRSPHLFLNHHGRKLTRQGVWKNLKIIVKKAGIEKE-VTPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLE GADLR +Q LLGH+DISTTQIYTH+   ++  + + YHP A
Sbjct: 246 TLRHSFATHLLENGADLRVVQELLGHSDISTTQIYTHITKKRMSSVYKTYHPRA 299


>gi|162447539|ref|YP_001620671.1| site-specific tyrosine recombinase [Acholeplasma laidlawii PG-8A]
 gi|161985646|gb|ABX81295.1| site-specific tyrosine recombinase [Acholeplasma laidlawii PG-8A]
          Length = 301

 Score =  198 bits (502), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 101/298 (33%), Positives = 166/298 (55%), Gaps = 10/298 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI--SLSAASTNHLISYLNHLSQRKLVTSSQ 59
           +++E   S NT+ AY RDLK+ ++FL+       +    + H+  YL  + ++ L   + 
Sbjct: 12  LNNELGLSKNTIDAYMRDLKDYESFLDKYHKLKDVDNIQSKHIEGYLKSIKKKGLSAKTI 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            RK++ I+ F+ FL  E    ++ +  +  PK    LP  L  D + ++LE         
Sbjct: 72  SRKLTSIKSFHKFLLMEKEVDEDVTHKIARPKIEKTLPTVLSVDEVISILEVI------- 124

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   L+EL+Y +G+RVSEL+ +    +++ +  +I+ GKG+KER+V +S  A
Sbjct: 125 DKSTTLGLRNMALLELIYGSGLRVSELLNIKLKDIHMQQSYVIVTGKGSKERMVPISDMA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           + A++ Y        +     +LF ++     LSR  F + LK LA+ A +  + +SPH 
Sbjct: 185 IIAIRNYLVKARDDLIKEKTDYLFINNQ-GKTLSRVGFFKVLKKLASEANLDPEKVSPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           +RH+FA+HLLE G DLR++Q LLGH DISTTQIYTH+   +L+++    HP AK+  K
Sbjct: 244 LRHSFATHLLENGMDLRSLQNLLGHEDISTTQIYTHISQSRLKQVYNKTHPRAKENNK 301


>gi|241206577|ref|YP_002977673.1| site-specific tyrosine recombinase XerD [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240860467|gb|ACS58134.1| tyrosine recombinase XerD [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 317

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 164/303 (54%), Positives = 222/303 (73%), Gaps = 4/303 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTL +Y+RDL ++++FL  + I L+ A++  L +YL+ L++     SSQ 
Sbjct: 15  MMSAERGAAANTLQSYERDLDDVRSFLTERSIRLTEAASADLAAYLSSLAREGFKPSSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+++ +RQFY FL  EGLR D+P+  L+ PKK   LPKT+  + +  LL QA+ EAE+ A
Sbjct: 75  RRLAAMRQFYKFLYAEGLRTDDPTGILDAPKKGRPLPKTMGVEEVGRLLSQAEAEAEDTA 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQ +R+R+  L+ELLYATGMRVSELV+L A  L+   R ++I+GKGNKERLV LS SA+
Sbjct: 135 PGQLQRLRMLALLELLYATGMRVSELVSLPARVLDQEGRFLMIRGKGNKERLVPLSHSAI 194

Query: 181 HALQMYKK----TCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            AL+ Y +      +++K      WLFPS++K G+L RQVFARDLK LA RAG+    IS
Sbjct: 195 SALKSYGRLLAAENAAVKERQESPWLFPSASKEGYLPRQVFARDLKNLAIRAGLTPSLIS 254

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++LQ+LVQ +HPLAK+ K
Sbjct: 255 PHVMRHAFASHLLANGADLRVVQELLGHSDISTTQIYTHVLEERLQQLVQTHHPLAKQAK 314

Query: 297 KHY 299
           KH 
Sbjct: 315 KHE 317


>gi|116254087|ref|YP_769925.1| site-specific tyrosine recombinase XerD [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115258735|emb|CAK09841.1| putative tyrosine recombinase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 317

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 164/303 (54%), Positives = 224/303 (73%), Gaps = 4/303 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTL +Y+RDL ++++FL  + I L+ A++  L +YL+ L+++    SSQ 
Sbjct: 15  MMSAERGAAANTLQSYERDLDDVRSFLTERSIRLTEAASTDLAAYLSSLARKGFKPSSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+++ +RQFY FL  EGLR D+P+  L+ PKK   LPKT+  + +  LL +A+ EAE+PA
Sbjct: 75  RRLAAMRQFYKFLYAEGLRADDPTGILDAPKKGRPLPKTMGVEEVGRLLSRAEAEAEDPA 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQ +R+R+  L+ELLYATGMRVSELV+L A  L+   R ++I+GKGNKERLV LS SA+
Sbjct: 135 PGQLQRLRMLALLELLYATGMRVSELVSLPARVLDQEGRFLMIRGKGNKERLVPLSQSAI 194

Query: 181 HALQMYKK----TCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            AL+ Y +      +++K      WLFPS++K G+L RQVFARDLK LA RAG+    IS
Sbjct: 195 SALKSYGRLLAVENAAVKEPQESPWLFPSASKEGYLPRQVFARDLKNLAIRAGLTPSLIS 254

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++LQ+LVQ +HPLAK+ K
Sbjct: 255 PHVMRHAFASHLLANGADLRVVQELLGHSDISTTQIYTHVLEERLQQLVQTHHPLAKQAK 314

Query: 297 KHY 299
           KH 
Sbjct: 315 KHE 317


>gi|169831443|ref|YP_001717425.1| tyrosine recombinase XerD [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169638287|gb|ACA59793.1| tyrosine recombinase XerD [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 295

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 104/292 (35%), Positives = 153/292 (52%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NTL+AY+ DL++   FL  + +  L+    +H+ +YL    +     ++  
Sbjct: 12  LHVERGLSENTLAAYRGDLQQFGAFLAAQGVRDLNDLQASHITAYLLAQKRLGRRPATVA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +R F  FL  EGL   NP++    PK+   LP+ L  D +  LL           
Sbjct: 72  RRLSAVRAFLKFLTAEGLVTANPAEYTGSPKQAQRLPRVLRVDEVDRLLTAP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   L+E+LYA+G+RVSE V L    L+L    +   GKG +ER+V +   A+
Sbjct: 125 TANPMGLRDRALMEVLYASGLRVSEAVNLKVGDLDLRGGLVRCVGKGGRERVVPVGGEAV 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +  Y      + + G        + +   L+RQ   + LK  A  AGIQK+ I+PH +
Sbjct: 185 RLVDEYLARSRPLLLKGRRTRFLFVNRRGQPLTRQTVWKLLKRYAREAGIQKE-ITPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q +LGH DI TTQIYTHL    L+ +    HP A
Sbjct: 244 RHSFATHLLENGADLRAVQEMLGHADIVTTQIYTHLTSRGLRAVYDRTHPRA 295


>gi|315282996|ref|ZP_07871279.1| tyrosine recombinase XerD [Listeria marthii FSL S4-120]
 gi|313613367|gb|EFR87228.1| tyrosine recombinase XerD [Listeria marthii FSL S4-120]
          Length = 297

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 99/295 (33%), Positives = 157/295 (53%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S NT+ AY+RDL    +++         +    + ++ ++    Q      S
Sbjct: 11  FLIVERGLSANTIKAYQRDLHYFVSYMETSKNLTDPNILERSDIVGFMAFARQEGKSARS 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ +R F+++L ++G    +P   +E PK+   LPK L+ D +  LL         
Sbjct: 71  VARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQAQSLPKVLNLDDVEKLLSS------- 123

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RV+ELV L    L+L    +   GKG+KER++ L  +
Sbjct: 124 SDTSTPLGLRDQAMMEILYATGLRVTELVRLKMDDLHLHMGFIQTIGKGDKERIIPLGKT 183

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A   L+ Y +     ++           +     L+RQ F + LK +A  +GI+K  I+P
Sbjct: 184 ATTVLEQYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKP-ITP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 243 HTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQFHPRA 297


>gi|332799335|ref|YP_004460834.1| Tyrosine recombinase xerC [Tepidanaerobacter sp. Re1]
 gi|332697070|gb|AEE91527.1| Tyrosine recombinase xerC [Tepidanaerobacter sp. Re1]
          Length = 295

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 108/292 (36%), Positives = 171/292 (58%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +S E+  + NT+ AY+RDLK    +L  K+I+ +++ + + + SYL  + +    +SS  
Sbjct: 12  LSVEKGLAKNTIDAYRRDLKSYIYYLKTKKITNINSTNRSTIASYLLLMQKNGKASSSIS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R  + I+ FY FL  E +  ++P+  L+ PK    LPK L  + I  LL         P 
Sbjct: 72  RACAAIKSFYQFLFMEHIISEDPTVNLDAPKLEQRLPKVLSVEEIEKLL-------CQPD 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++ELLYATGMRVSEL+++S   +NL    +   GKG+KER+V +   A+
Sbjct: 125 MANPLGIRDRSMLELLYATGMRVSELISISVEDVNLEMGFLRCVGKGSKERIVPIGSIAV 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L++Y     +  + G    +   + +   ++RQ F + +K  + +AGI KK I+PH  
Sbjct: 185 KYLKLYTLDARNKILNGKKSKILFLNRQGSAMTRQGFWKIIKKYSQQAGINKK-ITPHTF 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q +LGH+DISTTQIYTH+  +K++++  + HP A
Sbjct: 244 RHSFATHLLENGADLRVVQEILGHSDISTTQIYTHITRNKIKEVYDNTHPRA 295


>gi|77919114|ref|YP_356929.1| site-specific recombinase [Pelobacter carbinolicus DSM 2380]
 gi|77545197|gb|ABA88759.1| tyrosine recombinase XerD subunit [Pelobacter carbinolicus DSM
           2380]
          Length = 295

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 106/292 (36%), Positives = 155/292 (53%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+  S NTL AY RDL     FL+ K ++ L   S   ++++L+ L +R L   S+ 
Sbjct: 12  LVVEKGLSANTLDAYGRDLARYLEFLSVKGVTGLEQVSPPMVVAFLSALKERGLSARSRA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+  +R F+ FL  E L   NP+  +  PK    LP+ L  D + +LL           
Sbjct: 72  RKLVSLRMFHRFLLAENLATTNPAAQVAAPKSFAKLPQILTPDEVESLLSAPGNTTCF-- 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++E+LYATG+RVSELV L+   L L    +   GK  K+R+V L  +A 
Sbjct: 130 -----DLRDKAMLEILYATGLRVSELVGLTLQDLQLDVGYLTAFGKRAKQRIVPLGDAAR 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  Y                   +     L+RQ F + +K  A  AGI  KNI+PH +
Sbjct: 185 EAVLEYLSHGRGELAGEVGSGFLFLNRSGNGLTRQGFWKMMKRRAMEAGIN-KNITPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLL+ GADLR +Q +LGH DISTTQIYTH+  ++++ + Q +HP  
Sbjct: 244 RHSFATHLLDNGADLRAVQAMLGHADISTTQIYTHVTRERMKVIHQQHHPRG 295


>gi|218289606|ref|ZP_03493826.1| tyrosine recombinase XerD [Alicyclobacillus acidocaldarius LAA1]
 gi|218240256|gb|EED07439.1| tyrosine recombinase XerD [Alicyclobacillus acidocaldarius LAA1]
          Length = 294

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 96/291 (32%), Positives = 165/291 (56%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT ++Y RDL +   +L  ++ ++  A    ++ YL+ L +R + +++  R
Sbjct: 12  LRLERGLSENTATSYARDLADFSQYLACEQRTMRDADRTVVLRYLSDLKRRGMKSTTIAR 71

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           ++S +R F+ +L  EG+ + +P+  +E+   +  LP+ + ++ +  L+   +        
Sbjct: 72  RMSALRSFFRYLLREGILQADPTANIEVAAPDEHLPRVVSEEDVERLIGAVR-------R 124

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E LYATG+RVSEL+ LS   + L    + + GKG KER+V L   A  
Sbjct: 125 PDAMGLRDRAMLETLYATGVRVSELLALSLEDVELAAGFIRVFGKGKKERVVPLGEIAQD 184

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           AL +Y +    + +          +     ++RQ F   LK  A +AG+  + ++PH +R
Sbjct: 185 ALGLYLRYGRPLLVRDRGESAVFLNRLGRRMTRQGFWNILKGYARQAGVSAE-VTPHTLR 243

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLEGGADLR +Q LLGH DISTT+ YTH+ P +L+++ ++ HP A
Sbjct: 244 HSFATHLLEGGADLRVVQELLGHADISTTERYTHVTPHRLREVYRNAHPRA 294


>gi|241896295|ref|ZP_04783591.1| site-specific recombinase XerD [Weissella paramesenteroides ATCC
           33313]
 gi|241870456|gb|EER74207.1| site-specific recombinase XerD [Weissella paramesenteroides ATCC
           33313]
          Length = 302

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 99/292 (33%), Positives = 157/292 (53%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFL-NNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NT  +Y++DL +   +L   K  +L+      ++++L  L Q+    ++  
Sbjct: 19  LTVERGLSANTKHSYQQDLVQFFQYLIAEKYDTLTVVDRFTIMAFLGQLEQKGKSRNTII 78

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R+F+ F+    L   NP D ++ PKK   LP  L  + +  LL+          
Sbjct: 79  RMVSTLRKFFEFVQMNNLITSNPMDQVDSPKKAQHLPAVLTLEEVEALLQVP-------D 131

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++E++YATG+RVSELV L    L+L    +   GKG+KER+V +   A+
Sbjct: 132 TNTPLGLRNRTILEVMYATGLRVSELVNLRLDNLHLDLGLIQTIGKGDKERIVPIGDVAV 191

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y      +     D  +   +     L+RQ   + +K    +AGI  K++SPH +
Sbjct: 192 KWLENYLNNSRPLLGKQQDPHVIFLNDHGHQLTRQGVWKLIKQWVKQAGIT-KDVSPHTL 250

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+H+LE GADLR +Q LLGH DISTTQIYTH+   +L ++ +  HP A
Sbjct: 251 RHSFATHILENGADLRIVQELLGHADISTTQIYTHISNKRLTEVYEKAHPRA 302


>gi|311030726|ref|ZP_07708816.1| site-specific tyrosine recombinase XerD [Bacillus sp. m3-13]
          Length = 296

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 166/294 (56%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  E+  + NT+ +Y+RDLK    +L+  E   SL A S + +I +L  L++    + +
Sbjct: 11  FLVVEKGLASNTVVSYERDLKSYLLYLSKVEEISSLEAVSRSTIIQFLKFLTENGKSSKT 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ IR F+ FL  E +   +P+  ++ PK+   LP+ +  + +  LL+        
Sbjct: 71  IARHIASIRSFHQFLLREKVTTQDPTVHIDRPKQEQKLPQVMSVEEVQALLDSP------ 124

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
               +   +R   ++ELLYATGMRVSEL++L+   ++LT   +   GKGNKER++ L   
Sbjct: 125 -DTSKVFGMRDKAMLELLYATGMRVSELISLNLSDVHLTMGFVRCIGKGNKERIIPLGTM 183

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A +A+  Y +   S  +          +     L+RQ F + LK L   AGI+K+ ++PH
Sbjct: 184 AQNAITNYIEESRSQLLKKKTTDALFVNLYGNRLTRQGFWKILKKLTKEAGIEKE-LTPH 242

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +++ +   +HP A
Sbjct: 243 TLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRMKDVYSMFHPRA 296


>gi|83590344|ref|YP_430353.1| tyrosine recombinase XerD subunit [Moorella thermoacetica ATCC
           39073]
 gi|83573258|gb|ABC19810.1| tyrosine recombinase XerD subunit [Moorella thermoacetica ATCC
           39073]
          Length = 295

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 100/292 (34%), Positives = 159/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  + NTL++Y  DL++   +L    + S    +   L++YL  + Q     ++  
Sbjct: 12  LVVERGLAENTLASYNSDLQQFLLYLEGAGVKSPRDVTRGLLVAYLVKMQQDGRSPATIS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           + ++ ++ FY+FL  E L + +P+  LE P+++  LP+ L    +  LL Q + +     
Sbjct: 72  QHLAALKSFYHFLLRERLVESDPTADLESPRQSKKLPQVLTVAEVEKLLNQPRTD----- 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++ELLYATG+RVSELV+L+   +NL    +   GKG+KER+V +   A 
Sbjct: 127 --TPAGLRDKAMLELLYATGLRVSELVSLNVDQVNLEGEFVRCLGKGSKERVVPMGQVAC 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             ++ Y +      +          +     LSRQ   + LK     A + KK+I+PH +
Sbjct: 185 FYVRTYIENGRGKLIKRATEPALFVNHHGRRLSRQGCWKILKGYVRAANL-KKDITPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++Q LLGH DI TTQIYTHL   K++++    HP A
Sbjct: 244 RHSFATHLLENGADLRSVQELLGHADIGTTQIYTHLTRKKIREIYDHTHPRA 295


>gi|209551174|ref|YP_002283091.1| site-specific tyrosine recombinase XerD [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209536930|gb|ACI56865.1| tyrosine recombinase XerD [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 317

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 161/303 (53%), Positives = 219/303 (72%), Gaps = 4/303 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER +++NTL +Y+RDL ++  FL  + + L+ A++  L +YL  L+++    SSQ 
Sbjct: 15  MMSAERGAAVNTLQSYERDLDDVHAFLTGRSVRLTEAASADLAAYLASLARKGFKASSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+++ +RQFY FL  EGLR D+P+  L+ PKK   LPKT+  + +  LL QA+ EA + A
Sbjct: 75  RRLAAMRQFYKFLYAEGLRTDDPTGILDAPKKGRPLPKTMGVEEVGKLLSQAEAEAGDAA 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQ +R+R+  L+ELLYATGMRVSELV+L A  L+   R ++I+GKGNKERLV LS SA+
Sbjct: 135 PGQLQRLRMLALLELLYATGMRVSELVSLPARVLDQEGRFLMIRGKGNKERLVPLSQSAI 194

Query: 181 HALQMYKK----TCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            AL+ Y +      ++ K      WLFP+++K G+L RQVFARDLK LA RAG+    IS
Sbjct: 195 SALKSYGRLLAAENAAAKNPQESPWLFPAASKEGYLPRQVFARDLKNLAIRAGLTPSMIS 254

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++LQ+LVQ +HPLAK+ K
Sbjct: 255 PHVMRHAFASHLLANGADLRVVQELLGHSDISTTQIYTHVLEERLQQLVQTHHPLAKQAK 314

Query: 297 KHY 299
           KH 
Sbjct: 315 KHE 317


>gi|330686041|gb|EGG97664.1| tyrosine recombinase XerD [Staphylococcus epidermidis VCU121]
          Length = 295

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 100/293 (34%), Positives = 154/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S+NT+ AY+RDL + + +L  ++IS +       +   L +L  +   + S 
Sbjct: 11  FIQIEKGLSVNTIGAYRRDLNKYKEYLTLQKISNIDFVDRQTIQECLGYLIDQGQSSKSI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  +E PK    LP  L  D +  LL          
Sbjct: 71  ARFISTIRSFHQFALREKYAAKDPTVLIETPKYEKKLPDVLEVDEVIELLNAP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSE++ +    +NL    + + GKG+KER+V L  + 
Sbjct: 124 DLNKNNGYRDRTMLELLYATGMRVSEVIQIEVEDVNLMMGFVRVFGKGDKERIVPLGDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +      +   +     LSRQ   + +K    +A I  K ++PH 
Sbjct: 184 IDYLTTYIETVRPQLLKQTVTNVLFLNMHGKPLSRQGIWKMIKQNGLKANIN-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   YHP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQYHPRA 295


>gi|218680623|ref|ZP_03528520.1| site-specific tyrosine recombinase XerD [Rhizobium etli CIAT 894]
          Length = 311

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 159/297 (53%), Positives = 216/297 (72%), Gaps = 4/297 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTL +Y+RDL ++  FL  + I L+ A++  L +YL  L+++    SSQ 
Sbjct: 15  MMSAERGAAANTLQSYERDLDDVSAFLKERGIRLTEAASADLAAYLASLARKGFKPSSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+++ +RQFY FL  EGLR D+P+  L+ PKK   LPKT+  + +  LL QA+ EA++ A
Sbjct: 75  RRLAAMRQFYKFLYAEGLRTDDPTGILDAPKKGRPLPKTMGVEEVGKLLSQAETEAQDAA 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PGQ +R+R+  L+ELLYATGMRVSELV+L A  L+   R ++I+GKGNKERLV LS SA+
Sbjct: 135 PGQLQRLRMLALLELLYATGMRVSELVSLPARVLDQEGRFLMIRGKGNKERLVPLSQSAI 194

Query: 181 HALQMYKK----TCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            AL+ Y +      +++K      WLFP+++K G+L RQVFARDLK LA RAG+    IS
Sbjct: 195 SALKSYGRLLAAENAAVKDPQESPWLFPAASKEGYLPRQVFARDLKNLAIRAGLTPSMIS 254

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           PH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++LQ+LVQ +HPLAK
Sbjct: 255 PHVMRHAFASHLLANGADLRVVQELLGHSDISTTQIYTHVLEERLQQLVQTHHPLAK 311


>gi|56963547|ref|YP_175278.1| site-specific tyrosine recombinase [Bacillus clausii KSM-K16]
 gi|56909790|dbj|BAD64317.1| site-specific tyrosine recombinase [Bacillus clausii KSM-K16]
          Length = 297

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 99/293 (33%), Positives = 155/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ +Y RDLK+   +L  + I   +    + L  YL  L +    +++ 
Sbjct: 13  FIKVEKGLSPNTIESYARDLKQYGAYLKKRGIDQFAKVDRSTLQHYLFTLKETGKSSATI 72

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R ++ +R  + FL  E     +P+  +E P+ +  LP  L  + +  LL          
Sbjct: 73  ARNVTTLRALHQFLYREKWTDHDPTLWIETPRIDKKLPGVLSIEEVDALLAAP------- 125

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++ELLYA+GMRV+EL++L    ++L+   + + GKGNKER+V L   A
Sbjct: 126 DSSTPFGVRNKAMLELLYASGMRVTELISLGLDDVHLSMGFVRVIGKGNKERIVPLGKEA 185

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             AL  Y +      +          +     +SRQ F + +K LA  A I+ K+ SPH 
Sbjct: 186 TKALNTYLERGRGALLKHERHDKLFVNHHGRPISRQGFWKIMKQLAKTANIE-KDFSPHT 244

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR++Q +LGH D+STTQIYTH+   +++ +   YHP A
Sbjct: 245 LRHSFATHLLENGADLRSVQEMLGHADLSTTQIYTHVTKTRMKDVYSRYHPRA 297


>gi|239636836|ref|ZP_04677835.1| tyrosine recombinase XerD [Staphylococcus warneri L37603]
 gi|239597510|gb|EEQ80008.1| tyrosine recombinase XerD [Staphylococcus warneri L37603]
          Length = 295

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 101/293 (34%), Positives = 157/293 (53%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S+NT+ AY+RDL + + +L+ ++IS +       +   L +L  +   + S 
Sbjct: 11  FIQIEKGLSVNTIGAYRRDLNKYKEYLDLQKISNIDFVDRQTIQECLGYLIDQGQSSKSI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  +E PK    LP  L  D + +LL          
Sbjct: 71  ARFISTIRSFHQFALREKYAAKDPTVLIETPKYEKKLPDVLEVDEVIDLLNAP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSE++ +    +NL    + + GKG+KER+V LS + 
Sbjct: 124 DLNKNNGYRDRTMLELLYATGMRVSEVIQIEVEDVNLMMGFVRVFGKGDKERIVPLSDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +      +   +     LSRQ   + +K    +A I  K ++PH 
Sbjct: 184 IDYLTTYIETVRPQLLKQTVTNVLFLNMHGKPLSRQGIWKMMKQNGLKANIN-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   YHP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQYHPRA 295


>gi|296133169|ref|YP_003640416.1| tyrosine recombinase XerD [Thermincola sp. JR]
 gi|296031747|gb|ADG82515.1| tyrosine recombinase XerD [Thermincola potens JR]
          Length = 295

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 103/292 (35%), Positives = 164/292 (56%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  + NTL +Y RDL+    FL+   I+   A +  ++++YL HL ++   TS+  
Sbjct: 12  LTVERGLAENTLESYARDLERYSAFLSKHGITKFEATNKTNVMAYLLHLQKQGKATSTIS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ ++ FY +L  E   + +P+  LE PK    LP+ L  + +  LL Q ++      
Sbjct: 72  RHLASLKSFYQYLLREKHIEQDPTVNLESPKLQKKLPRVLSVEEVEILLNQPRL------ 125

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +    R   ++ELLYATG+RVSEL++L    +NL    +   GKG+KER++ +   A 
Sbjct: 126 -NEPAGSRDKAMLELLYATGIRVSELISLDLDHVNLEMGYVRCFGKGSKERIIPIGSLAK 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             ++ Y        +          +     ++RQ F + +K  A  AGI KK+I+PH +
Sbjct: 185 KYVEEYLHRGRVRLIKSKGETALFVNHHGRRMTRQGFWKIIKKYAREAGI-KKDITPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++Q +LGH DI+TTQIYTHL   +L+++    HP A
Sbjct: 244 RHSFATHLLENGADLRSVQEMLGHADITTTQIYTHLTRGRLREVYSKTHPRA 295


>gi|52080868|ref|YP_079659.1| site-specific tyrosine recombinase XerD [Bacillus licheniformis
           ATCC 14580]
 gi|52786240|ref|YP_092069.1| site-specific tyrosine recombinase XerD [Bacillus licheniformis
           ATCC 14580]
 gi|319645175|ref|ZP_07999408.1| RipX protein [Bacillus sp. BT1B_CT2]
 gi|52004079|gb|AAU24021.1| site-specific integrase/recombinase [Bacillus licheniformis ATCC
           14580]
 gi|52348742|gb|AAU41376.1| RipX [Bacillus licheniformis ATCC 14580]
 gi|317392984|gb|EFV73778.1| RipX protein [Bacillus sp. BT1B_CT2]
          Length = 296

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 156/291 (53%), Gaps = 10/291 (3%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEI--SLSAASTNHLISYLNHLSQRKLVTSSQRR 61
            ER  S NT+ +Y+RDL     +L  +E   S    +  H+I +L HL        +  R
Sbjct: 14  VERGLSHNTVVSYERDLNSYAAYLEEQEQLSSFDQVTRLHIIQFLKHLKDAGKSGKTVAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ IR F+ FL  E +   +PS  +E  K    LPK L    +  LL+  K+       
Sbjct: 74  HLASIRSFHQFLLREKVTAQDPSVHIESQKTERTLPKVLSLQEVETLLDTPKLTGPF--- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                 R   ++ELLYATG+RVSE++ L    ++L+   +   GKG KER+V L  +A H
Sbjct: 131 ----GYRDKAMLELLYATGIRVSEMIALKLSDVHLSMGFIRCFGKGRKERIVPLGEAASH 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           A+  Y        +  N       +     +SRQ F ++LK +A  AGI K+ ++PH +R
Sbjct: 187 AVGEYLSKARGKLLKKNTEDALFLNHHGRQMSRQGFWKNLKKIALEAGINKE-LTPHTLR 245

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + YHP A
Sbjct: 246 HSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYRQYHPRA 296


>gi|89099048|ref|ZP_01171927.1| tyrosine recombinase [Bacillus sp. NRRL B-14911]
 gi|89086178|gb|EAR65300.1| tyrosine recombinase [Bacillus sp. NRRL B-14911]
          Length = 297

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 104/295 (35%), Positives = 161/295 (54%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  E+  + NT+ +Y+RDLK    F+   E   SL+     H++ +L  L ++     +
Sbjct: 11  FLLIEKGLANNTIVSYERDLKNYLKFIVKSEGLASLNEVQRVHIVQFLKKLKEQGKSAKT 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ IR F+ FL  E + +++PS  +E P++   LPK L    +  LLE     +  
Sbjct: 71  LARHIASIRAFHQFLLREKVCENDPSVHIESPQQERSLPKVLSMAEVETLLESPSDSSHY 130

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++ELLYATG+RVSEL+ L    ++LT   +   GKGNKER++ +  +
Sbjct: 131 -------SLRDKAMLELLYATGIRVSELIGLQIGDVHLTMGFVRCIGKGNKERIIPIGKT 183

Query: 179 ALHAL-QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A  A+ +       +             +     L+RQ F + LK LA  AGI+K+ ++P
Sbjct: 184 ASEAIERYLLHGRPNFVSKSRRDDTLFLNHHGRQLTRQGFWKILKKLAGDAGIEKE-LTP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ +   +HP A
Sbjct: 243 HTLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYSKFHPRA 297


>gi|90420213|ref|ZP_01228121.1| tyrosine recombinase XerD [Aurantimonas manganoxydans SI85-9A1]
 gi|90335547|gb|EAS49297.1| tyrosine recombinase XerD [Aurantimonas manganoxydans SI85-9A1]
          Length = 328

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 136/299 (45%), Positives = 202/299 (67%), Gaps = 3/299 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MM+ ER ++ NT++AY+RDL++   F+  +  SL  A+T  + +Y+  L+ R    +S+ 
Sbjct: 29  MMAVERGAADNTVAAYRRDLEDAAGFMAGQGGSLMTATTEDIRAYVGRLAARGFAETSRS 88

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQ+Y FL  EG R D+P+  +E  ++   LPK + +D +  LL++A  EA +P 
Sbjct: 89  RRLSALRQYYRFLYVEGRRGDDPTGPIEGARRKRPLPKVMSEDEVDRLLDRAAAEAVDPE 148

Query: 121 PGQW---KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                  +  R+  L+ELLYATGMRVSELV+L    L   +R ++++GKG+KER+V +  
Sbjct: 149 RSPAGLVRAARMHALVELLYATGMRVSELVSLPRAVLRGRQRMIVVRGKGDKERMVPIGE 208

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           +A  AL  + +      ++    WLFP+ ++TGHL+RQ FARDLKALAAR GI  + ISP
Sbjct: 209 AARDALIRFAEAMKLAGVSEEGRWLFPAVSETGHLTRQAFARDLKALAAREGIPAERISP 268

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           H++RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L +LV D+HPL+ + +
Sbjct: 269 HVLRHAFASHLLQNGADLRAVQELLGHADISTTQIYTHVLEERLIRLVTDHHPLSDESR 327


>gi|307942508|ref|ZP_07657856.1| tyrosine recombinase XerD [Roseibium sp. TrichSKD4]
 gi|307774147|gb|EFO33360.1| tyrosine recombinase XerD [Roseibium sp. TrichSKD4]
          Length = 307

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 134/297 (45%), Positives = 191/297 (64%), Gaps = 5/297 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+S+ER ++ NTL +Y+RDL +   F   +    SA +T+ + +YL  LS R    +SQ 
Sbjct: 13  MLSAERGAAENTLQSYRRDLDDFAEFTAPQN--PSAVNTDRISAYLRDLSLRGFAETSQA 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLL---EQAKIEAE 117
           R++S ++Q++ FL  +G+R D+P+ TL  PKK   LPK L  D +  L+   +QA  + +
Sbjct: 71  RRLSALKQYFKFLYADGIRTDDPTRTLSAPKKRQALPKVLSIDEVDKLIGEAQQAATKKQ 130

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
           +    Q +  R++ L+E+LYATG+RVSELV L        +R + + GKG KERLV LSP
Sbjct: 131 DSPAKQLRAQRLYTLLEVLYATGLRVSELVALPVTAAQRDQRLIEVTGKGGKERLVPLSP 190

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           +A  A++ Y +  + +       WLFPS  K+GH +RQ F RDLK LA    I    +SP
Sbjct: 191 AAQKAMRDYIRQRAELGAYATSPWLFPSHGKSGHFTRQAFGRDLKDLAVDTKIDTDKVSP 250

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           H++RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L +LV+  HPLAK+
Sbjct: 251 HVLRHAFASHLLQNGADLRVVQQLLGHADISTTQIYTHVLDERLTQLVESAHPLAKR 307


>gi|163791502|ref|ZP_02185908.1| integrase/recombinase XerD, putative [Carnobacterium sp. AT7]
 gi|159873225|gb|EDP67323.1| integrase/recombinase XerD, putative [Carnobacterium sp. AT7]
          Length = 296

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 166/294 (56%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            ++ ER  S NT+ +YKRD+ +   F+   +++         ++S+L  L + +    + 
Sbjct: 11  FLTIERGLSKNTIESYKRDISQYLTFIEENKLTEWVQIDRYVVLSFLQKLKENQKSAGTI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS +RQF+ FL  E L   +P   ++ PKK   LPK L    +  L+E         
Sbjct: 71  IRMISCLRQFHQFLKQEQLSLTDPMLHIDTPKKAQKLPKVLSIKEVDRLIETPN------ 124

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
             G+   +R   ++E+LYATG+RVSEL  L  + L+L+   +   GKG+KER++ L   A
Sbjct: 125 -TGETLGLRDRAMLEVLYATGLRVSELTELKLNDLHLSLGLIQTIGKGDKERILPLGDMA 183

Query: 180 LHAL-QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           +  + +  + + S ++  G+       +     L+RQ   ++LK L  +AGI+K+ ++PH
Sbjct: 184 IEWIEKYRRYSRSKLEKEGHRSPYLFLNHHGRKLTRQGVWKNLKILVKKAGIEKE-VTPH 242

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLE GADLR +Q LLGH+DISTTQIYTH+   ++  + + YHP A
Sbjct: 243 TLRHSFATHLLENGADLRVVQELLGHSDISTTQIYTHITKQRMSSVYKTYHPRA 296


>gi|319775822|ref|YP_004138310.1| Site-specific recombinase XerD [Haemophilus influenzae F3047]
 gi|329123666|ref|ZP_08252226.1| tyrosine recombinase XerD [Haemophilus aegyptius ATCC 11116]
 gi|317450413|emb|CBY86629.1| Site-specific recombinase XerD [Haemophilus influenzae F3047]
 gi|327469865|gb|EGF15330.1| tyrosine recombinase XerD [Haemophilus aegyptius ATCC 11116]
          Length = 297

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 98/289 (33%), Positives = 164/289 (56%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+   +SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNGLSLETLDAVDLQGFLGERLEKGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  +++LL    +E        
Sbjct: 76  SAMRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTPDVEV------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +   ++RQ F   +K  A  A I  + +SPH++RHA
Sbjct: 189 RQFMLYGRPVLLNGQSSDVVFPSQRAQQMTRQTFWHRVKHYAILADIDAEALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|226311968|ref|YP_002771862.1| tyrosine recombinase [Brevibacillus brevis NBRC 100599]
 gi|226094916|dbj|BAH43358.1| probable tyrosine recombinase [Brevibacillus brevis NBRC 100599]
          Length = 295

 Score =  195 bits (495), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 101/293 (34%), Positives = 163/293 (55%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            ++ E+  S NTL +Y+RD+    ++L  + ++ +  ++  H+I YL  L ++   T++ 
Sbjct: 11  FLTVEKGLSRNTLESYQRDMVAFTSYLQEQGVTRVEDSTRTHIIGYLLVLREKGRATATL 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R ++ IR FY FL  +     +PS  LE PK    LPK L  + +  LLE   +     
Sbjct: 71  SRNMASIRAFYQFLIRDKYIDKDPSIHLETPKIEKRLPKVLSVEEVERLLESPPV----- 125

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSELV L +  +NL    +   GKG+KER++ L   A
Sbjct: 126 --NHPAGLRDKAMLELLYATGIRVSELVNLDSADVNLDMGFVKCLGKGSKERIIPLGSVA 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  ++ Y +      + G        +     ++RQ F + +K  A ++ I+ + I+PH 
Sbjct: 184 IQMVRHYLQAGRPKMVKGTGDTALFLNHLGKQITRQGFWKIIKRYAQKSNIRAE-ITPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR++Q +LGH DISTTQIYTH+   +++ +    HP A
Sbjct: 243 LRHSFATHLLENGADLRSVQEMLGHADISTTQIYTHVTRTRIKDIYAKTHPRA 295


>gi|239827607|ref|YP_002950231.1| site-specific tyrosine recombinase XerD [Geobacillus sp. WCH70]
 gi|239807900|gb|ACS24965.1| tyrosine recombinase XerD [Geobacillus sp. WCH70]
          Length = 299

 Score =  195 bits (494), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 111/295 (37%), Positives = 167/295 (56%), Gaps = 12/295 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           ++ ER  + NT+ +Y+RDLK+  ++L    +  S +  +  H++ +L  L ++     + 
Sbjct: 13  LTVERNLAKNTIISYERDLKKYAHYLRHVEQIQSWNDVTRLHIMQFLKFLKEKGNSPKTI 72

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E + + +PS  +E P+    LPK L  + +  LLE         
Sbjct: 73  ARHIASIRSFHQFLLREKVAEQDPSVHIESPQMERTLPKVLSLEEVEALLEAP------- 125

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++ELLYATGMRVSELV L+   ++LT   +   GKG KER+V +   A
Sbjct: 126 KTNTPIGVRDKAMLELLYATGMRVSELVNLNLSDVHLTMGFVRCYGKGKKERIVPVGSMA 185

Query: 180 LHALQMYKKTCSSMKM--TGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           L+AL++Y +T     +            +     L+RQ F + LK LA  A I+K+ ++P
Sbjct: 186 LNALKVYLETARPKLINSKKRTTDALFLNHHGERLTRQGFWKILKKLAKEANIEKE-LTP 244

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   +L+ + + YHP A
Sbjct: 245 HTLRHSFATHLLENGADLRAVQELLGHADISTTQIYTHVTKTRLKDVYKQYHPRA 299


>gi|153008242|ref|YP_001369457.1| site-specific tyrosine recombinase XerD [Ochrobactrum anthropi ATCC
           49188]
 gi|151560130|gb|ABS13628.1| tyrosine recombinase XerD [Ochrobactrum anthropi ATCC 49188]
          Length = 307

 Score =  195 bits (494), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 140/294 (47%), Positives = 206/294 (70%), Gaps = 2/294 (0%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTL +Y+RDL+ +   L+ + ++L+ A  +H+ S ++ ++      +SQ 
Sbjct: 13  MMSAERGAAENTLESYRRDLEAVAEALSARGVNLAEAGADHIRSAIDAMATEGFAATSQA 72

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQF+ FL  EG R+D+P+ T++ PKK   LPK +  + +  LL++A +E    A
Sbjct: 73  RRLSALRQFFRFLYSEGYRQDDPTGTVDAPKKQKPLPKIMSVENVTKLLDRAALETSEEA 132

Query: 121 P--GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
               ++K +R+  LIE LYATGMRVSELV L      +  R +++ GKG+KER+V LSP 
Sbjct: 133 EPAERFKALRLHALIETLYATGMRVSELVGLPVGVARIDHRFLLVCGKGSKERMVPLSPK 192

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A  ALQ +     S+  + ++ WLFP+ +++GHL+RQVFAR+LK LAARAG+    +SPH
Sbjct: 193 AREALQRFLALRDSLPGSDDNPWLFPAFSESGHLARQVFARELKGLAARAGLSAAAVSPH 252

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RHAFASHLL+ GADLRT+Q LLGH DISTTQIYTH+L ++L KLV ++HPLA
Sbjct: 253 VLRHAFASHLLQNGADLRTVQQLLGHADISTTQIYTHVLEERLHKLVSEHHPLA 306


>gi|319896642|ref|YP_004134835.1| site-specific recombinase xerd [Haemophilus influenzae F3031]
 gi|317432144|emb|CBY80495.1| Site-specific recombinase XerD [Haemophilus influenzae F3031]
          Length = 297

 Score =  195 bits (494), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 99/289 (34%), Positives = 164/289 (56%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+   +SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNGLSLETLDAVDLQGFLGERLEKGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  +++LL    +E        
Sbjct: 76  SAMRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTPDVEV------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +T  ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFMLYGRPVLLNGQSSDVVFPSQRTQQMTRQTFWHRVKHYAILADIDADALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|167628445|ref|YP_001678944.1| tyrosine recombinase xerd, putative [Heliobacterium modesticaldum
           Ice1]
 gi|167591185|gb|ABZ82933.1| tyrosine recombinase xerd, putative [Heliobacterium modesticaldum
           Ice1]
          Length = 328

 Score =  195 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 103/293 (35%), Positives = 166/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NT+ AY+RDL ++  FL  + I   +  + + L  YL H  +R L  +++ 
Sbjct: 34  LAVERGLSGNTIDAYRRDLADLAAFLAERGIGDPADVTRSDLQDYLYHTYRRGLSAATRA 93

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+++ I+ ++ FL  E +R+D+P++ ++ P+   +LP  L+ + +A LL+          
Sbjct: 94  RRLAAIKGYFGFLFDEAIRRDDPTELIDGPRLQRLLPDVLNVEEVAALLQAP-------- 145

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           P     +R   ++E +YA G+RVSEL+ L+   + L    + + GKG KER+V L   A 
Sbjct: 146 PRTIVGLRDRAMLETMYACGLRVSELIALTLDQVRLDLGLVRVVGKGMKERIVPLGGLAA 205

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A++ Y                   + +   L+RQ F + LKA AA AGI  K ++PH +
Sbjct: 206 AAIEEYLSRTRGTLAGHGAEKHLFLNQRGKPLTRQGFWKILKAYAAEAGI-AKEVTPHTL 264

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           RH+FA+HLL  GADLR +Q +LGH D+STTQIYTHL   +L+++    HP A+
Sbjct: 265 RHSFATHLLSNGADLRAVQEMLGHADVSTTQIYTHLTMGRLREVYDRSHPRAR 317


>gi|326692503|ref|ZP_08229508.1| tyrosine recombinase XerD [Leuconostoc argentinum KCTC 3773]
          Length = 298

 Score =  195 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 103/291 (35%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT+++Y++DL +   +L  ++++L A     ++++LN L       +S  R
Sbjct: 16  IRIERGLSDNTINSYRQDLTQFGAYLTAEKLTLEAVDHVVVLAWLNQLRLVGKSNNSVIR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ +R+F+ +L  E +   NP   ++ PKK   LP  L    I  LL            
Sbjct: 76  MVTSLRKFFGYLAQEKIVLPNPMRDIQPPKKATHLPAVLSVAEIDALLAVPTD------- 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   LIE++YATG+RVSELV L    L+L    +   GKG+KER++ +   A  
Sbjct: 129 TTPLDIRNRTLIEVMYATGLRVSELVNLKLSDLHLQLGLIQTIGKGDKERIIPIGEVAAD 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L  Y  +     + G        + + G L+RQ   + +K L   AGI  K++SPH +R
Sbjct: 189 WLTRYFASSRLALLKGKASPYVFLNDRGGQLTRQGVWKIIKKLVVEAGIT-KDVSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+H+LE GADLR +Q LLGH DISTTQIYTH+   +L ++   YHP A
Sbjct: 248 HSFATHILENGADLRIVQELLGHADISTTQIYTHISKKRLSEVYDQYHPRA 298


>gi|134298963|ref|YP_001112459.1| tyrosine recombinase XerD [Desulfotomaculum reducens MI-1]
 gi|134051663|gb|ABO49634.1| tyrosine recombinase XerD subunit [Desulfotomaculum reducens MI-1]
          Length = 296

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 97/292 (33%), Positives = 154/292 (52%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  + NTL++Y+ DL +  + L  + +S L+ A  NH++S+L  L +     ++  
Sbjct: 12  LAVERGLAQNTLASYRIDLSQYLDHLKKQGVSSLTQADRNHILSHLYKLQKDGKAPATIS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ ++ FY FL  +G   ++ + +LE PK    LP  L  + + NLL         P 
Sbjct: 72  RHLAALKHFYRFLVSDGAVSEDYTVSLESPKLKQRLPHVLSTEEVENLL-------CQPQ 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++EL+YATG+RVSE+V+L+   + L    +   GKG KER++ L   A+
Sbjct: 125 LSDPAGLRDKAMLELIYATGIRVSEMVSLNLPDVELDMGYIKCFGKGAKERIIPLGSVAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             ++ Y +        G            G    +     +    A+ G   K I+PH +
Sbjct: 185 RYIREYLERSRVKLTKGKTEHQALFVNVQGKRLTRQGFWKIIKKYAKEGRINKPITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q +LGH DISTTQIYTHL   +L+++    HP A
Sbjct: 245 RHSFATHLLENGADLRAVQEMLGHADISTTQIYTHLTKLRLREVYTKAHPRA 296


>gi|300214635|gb|ADJ79051.1| Integrase/recombinase, XerD/RipX family [Lactobacillus salivarius
           CECT 5713]
          Length = 297

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 105/292 (35%), Positives = 159/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+++Y  DLK    +L   EI S    +   +++Y+          SS  
Sbjct: 14  LKVERGLSENTINSYGIDLKLFLEYLRENEIPSFKQVNKEVIVNYMQSEKNNNKANSSIL 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R+F+ +L  E + + +P   ++ PKK   LP+ L K+ +  LL           
Sbjct: 74  RSVSSLRKFFQYLAQEKIIEKDPMLLIDTPKKKQHLPQVLTKEEVEKLLRSPN------- 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            GQ   +R   ++EL+YATG+R+SE++ L    L+LT  T+   GKG+KER+V +   A+
Sbjct: 127 TGQVLGLRDRAMLELMYATGLRISEIINLKLEDLHLTMGTLQTLGKGHKERIVPVGDEAI 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +  Y +      +          +    +L+RQ   ++LKA   +AGIQ KNI+PH +
Sbjct: 187 KWVNRYLEEARPKLLKQKRSNYLFLNFHGNNLTRQGVWKNLKAEVRKAGIQ-KNITPHTL 245

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+H+LE GADLR +Q LLGH DISTTQIYTHL   +L  +    HP A
Sbjct: 246 RHSFATHILENGADLRIVQELLGHADISTTQIYTHLSNKQLADIYNRAHPRA 297


>gi|313632584|gb|EFR99578.1| tyrosine recombinase XerD [Listeria seeligeri FSL N1-067]
 gi|313637133|gb|EFS02675.1| tyrosine recombinase XerD [Listeria seeligeri FSL S4-171]
          Length = 297

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 96/295 (32%), Positives = 159/295 (53%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  E+  S NT+ AY+RDL    +++N        +    + ++ ++    +      S
Sbjct: 11  FLIVEKGLSANTIKAYERDLHYFVSYINTARPLTDPNTLERSDIVGFMAFARKEGKSARS 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ +R F+++L ++G    +P   +E PK+   LPK L+       L+  ++   +
Sbjct: 71  VARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQAQGLPKVLN-------LDDVELLLSS 123

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RV+ELV L    L+L    +   GKG+KER++ L  +
Sbjct: 124 SDTSTSLGLRDQAMMEILYATGLRVTELVQLKMDDLHLQMGFIQTIGKGDKERIIPLGKT 183

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A   L+ Y +     ++           +     L+RQ F + LK +A  +GI+K  I+P
Sbjct: 184 ATTVLEQYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKP-ITP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 243 HTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVYKQFHPRA 297


>gi|157692850|ref|YP_001487312.1| site-specific tyrosine recombinase XerD [Bacillus pumilus SAFR-032]
 gi|157681608|gb|ABV62752.1| tyrosine recombinase [Bacillus pumilus SAFR-032]
          Length = 296

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 161/294 (54%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFL--NNKEISLSAASTNHLISYLNHLSQRKLVTSS 58
            M+ ER  S NT+ +YKRDL+   +FL  + +   +   +  H+I YL  L +    + +
Sbjct: 11  FMTVERGLSENTIVSYKRDLQNYLSFLMTHEQLSDIKDVTRLHIIHYLKQLKEEGKSSKT 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R +S IR F+ FL  E + KD+PS  +E  K    LPK L    +  LL+        
Sbjct: 71  SVRHLSSIRSFHQFLLREKVTKDDPSWNIETQKTERKLPKVLSLGEVEKLLDTPNQH--- 127

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                    R   ++ELLYATG+RVSE++ L+   ++LT   +   GKG KER+V +  +
Sbjct: 128 ----TPFDYRDKAMLELLYATGIRVSEMLDLTLADVHLTMGFIRCFGKGRKERIVPIGEA 183

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A  A++ Y +      +          +     +SRQ F ++LK  A  AGIQK+ ++PH
Sbjct: 184 AASAIEEYLEKGRGKLLKKQPADALFLNHHGKKMSRQGFWKNLKKRALEAGIQKE-LTPH 242

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ +   +HP A
Sbjct: 243 TLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYHKFHPRA 296


>gi|194016964|ref|ZP_03055577.1| tyrosine recombinase XerD [Bacillus pumilus ATCC 7061]
 gi|194011570|gb|EDW21139.1| tyrosine recombinase XerD [Bacillus pumilus ATCC 7061]
          Length = 296

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 161/294 (54%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFL--NNKEISLSAASTNHLISYLNHLSQRKLVTSS 58
            M+ ER  S NT+ +YKRDL+   +FL  + +   +   +  H+I YL  L +    + +
Sbjct: 11  FMTVERGLSENTIVSYKRDLQNYLSFLMTHEQLTDIKDVTRLHIIHYLKKLKEEGKSSKT 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R +S IR F+ FL  E +  D+PS  +E  K    LPK L    +  LL+        
Sbjct: 71  SVRHLSSIRSFHQFLLREKVTTDDPSWNIETQKTERKLPKVLSLGEVEKLLDTPNQH--- 127

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                    R   ++ELLYATG+RVSE++ L+   ++LT   +   GKG KER+V +  +
Sbjct: 128 ----TPFDYRDKAMLELLYATGIRVSEMLDLTLADVHLTMGFIRCFGKGRKERIVPIGEA 183

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A  A++ Y +   S  +          +     +SRQ F ++LK  A  AGIQK+ ++PH
Sbjct: 184 AASAIEEYLEKGRSKLLKKQPADALFLNHHGKKMSRQGFWKNLKKRALEAGIQKE-LTPH 242

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ +   +HP A
Sbjct: 243 TLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYHKFHPRA 296


>gi|260893180|ref|YP_003239277.1| tyrosine recombinase XerD [Ammonifex degensii KC4]
 gi|260865321|gb|ACX52427.1| tyrosine recombinase XerD [Ammonifex degensii KC4]
          Length = 302

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 103/296 (34%), Positives = 157/296 (53%), Gaps = 10/296 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNH-LISYLNHLSQRKLVTSSQ 59
            +  ER  + NT++AY+ DLK    F+  ++ SL  +S     + YL  L+    + S+ 
Sbjct: 12  FLRVERGLADNTIAAYRTDLKHFCAFVARRQFSLDPSSLRDACLCYLYELNAAGYLASTV 71

Query: 60  RRKISVIRQFYNFLCYEGLR-KDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
            R+++ ++ F  +L  +      +P++ L  PK    LPK L  + +  LL   +     
Sbjct: 72  ARRLAALKSFCAYLATQAGYLPWDPAEELSSPKIPERLPKVLRPEEVERLLTAPR----- 126

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                 + +R   L+EL YATGMRVSELV L    LNL    + + GKG KER+V +   
Sbjct: 127 --TNTPQGLRDRALLELAYATGMRVSELVGLDVDHLNLEAGYVRVLGKGGKERIVPVGRV 184

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A H L+ Y +      +          + + G L+RQ   + LK  A +AG+     SPH
Sbjct: 185 AQHYLREYLEKAWPRLVKDRRTSALFVNRRGGRLTRQAVFKLLKDYARQAGLTSAP-SPH 243

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
            +RH+FA+HLLE GADLR +Q LLGH  ISTTQIYTHL   +++++ +  HP ++K
Sbjct: 244 TLRHSFATHLLENGADLRVVQELLGHVSISTTQIYTHLTSTRVREVYRRAHPRSRK 299


>gi|227510303|ref|ZP_03940352.1| site-specific DNA tyrosine recombinase, XerD [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
 gi|227189955|gb|EEI70022.1| site-specific DNA tyrosine recombinase, XerD [Lactobacillus brevis
           subsp. gravesensis ATCC 27305]
          Length = 295

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 99/293 (33%), Positives = 155/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
            +  ER  S NT+ +Y++DL E  +F       +S      +++YL +L Q K   ++  
Sbjct: 11  FLRVERGLSENTIKSYQQDLSEAIHFFQKTTKDISKVDQFLILNYLENLQQEKKSRNTVI 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R F+ +L   G+  D+P   ++ PK++  LP  L    +  LL         P 
Sbjct: 71  RTVSSLRNFFRYLAQFGVVPDDPMLKVDSPKQSKTLPDVLSVSEVNKLLS-------MPN 123

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP-SA 179
             +   VR   ++E LYATG+RVSELV L    L+L  + +   GKG++ER++ +   + 
Sbjct: 124 VSKPLGVRDRAMLETLYATGLRVSELVNLRLVDLHLPMKLIQTVGKGDRERIIPIGDVAI 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
               +  K T   +     +      +     L+RQ   + +K     AGI K++++PH 
Sbjct: 184 DWITKYLKTTRIDLLRKRTNTDFVFLNAHGRRLTRQAIWQMIKKYVKLAGI-KRHVTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+    L ++ Q +HP A
Sbjct: 243 LRHSFATHLLENGADLRIVQELLGHADISTTQIYTHISHKHLTEVYQKFHPRA 295


>gi|301299326|ref|ZP_07205611.1| tyrosine recombinase XerD [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|300853066|gb|EFK80665.1| tyrosine recombinase XerD [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 290

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 105/292 (35%), Positives = 159/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+++Y  DLK    +L   EI S    +   +++Y+          SS  
Sbjct: 7   LKVERGLSENTINSYGIDLKLFLEYLRENEIPSFKQVNKEVIVNYMQSEKNNNKANSSIL 66

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R+F+ +L  E + + +P   ++ PKK   LP+ L K+ +  LL           
Sbjct: 67  RSVSSLRKFFQYLAQEKIIEKDPMLLIDTPKKKQHLPQVLTKEEVEKLLRSPN------- 119

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            GQ   +R   ++EL+YATG+R+SE++ L    L+LT  T+   GKG+KER+V +   A+
Sbjct: 120 TGQVLGLRDRAMLELMYATGLRISEIINLKLEDLHLTMGTLQTLGKGHKERIVPVGDEAI 179

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +  Y +      +          +    +L+RQ   ++LKA   +AGIQ KNI+PH +
Sbjct: 180 KWVNRYLEEARPKLLKQKRSNYLFLNFHGNNLTRQGVWKNLKAEVRKAGIQ-KNITPHTL 238

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+H+LE GADLR +Q LLGH DISTTQIYTHL   +L  +    HP A
Sbjct: 239 RHSFATHILENGADLRIVQELLGHADISTTQIYTHLSNKQLADIYNRAHPRA 290


>gi|145628659|ref|ZP_01784459.1| tyrosine recombinase [Haemophilus influenzae 22.1-21]
 gi|144979129|gb|EDJ88815.1| tyrosine recombinase [Haemophilus influenzae 22.1-21]
 gi|309972530|gb|ADO95731.1| Site-specific, tyrosine recombinase XerD [Haemophilus influenzae
           R2846]
          Length = 297

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 99/289 (34%), Positives = 165/289 (57%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+  ++SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNDLSLETLDAVDLQGFLGERLEKGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  +++LL    +E        
Sbjct: 76  SAMRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTPDVEV------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +T  ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFMLYGRPVLLNGQSSDVVFPSQRTQQMTRQTFWHRVKHYAILADIDADALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|145636556|ref|ZP_01792224.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           PittHH]
 gi|145270381|gb|EDK10316.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           PittHH]
          Length = 297

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 98/289 (33%), Positives = 164/289 (56%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+  ++SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNDLSLETLDAVDLQGFLGERLEKGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  +++LL    +E        
Sbjct: 76  SAMRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTPDVEV------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +   ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFILYGRPVLLNGQSSDVVFPSQRAQQMTRQTFWHRVKHYAILADIDADTLSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|242240703|ref|YP_002988884.1| tyrosine recombinase XerD [Dickeya dadantii Ech703]
 gi|242132760|gb|ACS87062.1| tyrosine recombinase XerD [Dickeya dadantii Ech703]
          Length = 299

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 112/288 (38%), Positives = 168/288 (58%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  + NTL +Y+RDL+ +  +L +   SLS A  + L S+L          +S  R +S
Sbjct: 19  ERNLAENTLQSYRRDLRTLAAWLAHHHASLSDARPDDLQSFLAERVDGGYKATSSARLLS 78

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            +R+ + +L  E +R D+PS  L  PK    LPK L +  + +LL          A  Q 
Sbjct: 79  AMRRLFQYLYREKVRPDDPSAVLSSPKLPQRLPKDLTEAQVESLLAAP-------ATDQP 131

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++ ++
Sbjct: 132 LELRDKAMLEVLYATGLRVSELVGLTMSDVSLRQGVVRVIGKGNKERLVPLGEEAVYWVE 191

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            Y +      + G  L +   ST+   ++RQ F   +K  A  A I    +SPH++RHAF
Sbjct: 192 QYLEYGRPWLLDGQTLDVMFPSTRGRQMTRQTFWHRIKHYAVLASIDSARLSPHVLRHAF 251

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 252 ATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|319651425|ref|ZP_08005554.1| tyrosine recombinase [Bacillus sp. 2_A_57_CT2]
 gi|317396956|gb|EFV77665.1| tyrosine recombinase [Bacillus sp. 2_A_57_CT2]
          Length = 297

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 108/294 (36%), Positives = 164/294 (55%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI--SLSAASTNHLISYLNHLSQRKLVTSSQ 59
           +  E+  + NT+ +Y+RDLK    +L ++E   SL +     ++ +L  L ++   + + 
Sbjct: 12  LLVEKGLAKNTIVSYERDLKSYLKYLKSEEKISSLESVQRTQIVQFLGFLKKQGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E     +PS  +E P+    LPK L+   +  LL+  +I+    
Sbjct: 72  ARHIASIRAFHQFLLREKAVGHDPSVHIETPQMERSLPKVLNMQEVETLLDFPEIKDHF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER+V +  +A
Sbjct: 131 ------GLRDKAMLELLYATGIRVSELIGLNIGDVHLTMGFVRCIGKGNKERIVPIGKTA 184

Query: 180 LHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
             AL+ Y            +       +     LSRQ F + LK LA  AGI+K+ ++PH
Sbjct: 185 SEALEKYLNEGRGKFAPKKHKDEALFLNHHGKRLSRQGFWKILKRLAQEAGIEKE-LTPH 243

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ +   YHP A
Sbjct: 244 TLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYSQYHPRA 297


>gi|227513310|ref|ZP_03943359.1| site-specific DNA tyrosine recombinase XerD [Lactobacillus buchneri
           ATCC 11577]
 gi|227083511|gb|EEI18823.1| site-specific DNA tyrosine recombinase XerD [Lactobacillus buchneri
           ATCC 11577]
          Length = 295

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 100/293 (34%), Positives = 155/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
            +  ER  S NT+ +Y++DL E  +F       +S      +++YL +L Q K   ++  
Sbjct: 11  FLRVERGLSENTIKSYQQDLSEAIHFFQKTTKDISKVDQFLILNYLENLQQEKKSRNTVI 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R F+ +L   G+  D+P   ++ PK++  LP  L    +  LL         P 
Sbjct: 71  RTVSSLRNFFRYLAQFGVVPDDPMLKVDSPKQSKTLPDVLSVSEVNKLLS-------MPN 123

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP-SA 179
             +   VR   ++E LYATG+RVSELV L    L+L  + +   GKG++ER++ +   + 
Sbjct: 124 VSKPLGVRDRAMLETLYATGLRVSELVNLRLVDLHLPMKLIQTVGKGDRERIIPIGDVAI 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
               Q  K T   +     +      +     L+RQ   + +K     AGI K++++PH 
Sbjct: 184 DWITQYLKTTRIDLLRKRTNTDFVFLNAHGRRLTRQAIWQMIKKYVKLAGI-KRHVTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+    L ++ Q +HP A
Sbjct: 243 LRHSFATHLLENGADLRIVQELLGHADISTTQIYTHISHKHLTEVYQKFHPRA 295


>gi|270291303|ref|ZP_06197525.1| tyrosine recombinase XerD [Pediococcus acidilactici 7_4]
 gi|270280149|gb|EFA25985.1| tyrosine recombinase XerD [Pediococcus acidilactici 7_4]
          Length = 295

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 103/292 (35%), Positives = 160/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+ +Y+++L+ +QNFL  + I  +       +++YL+ L Q     SS  
Sbjct: 12  LKVERGLSDNTIVSYRQELRHLQNFLQEQHIADIKDVDRYTILNYLDALKQTGRARSSSI 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
             IS +R+F+ +L      + NP   ++ PK+   LP  L  + +  LL+          
Sbjct: 72  HTISSLRKFFKYLLLNDQIQTNPMANIDPPKRAQHLPSVLTTEEVERLLKVP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATG+RVSEL+ L+ + L+L    +   GKGNK+R++ +   A+
Sbjct: 125 TSKPLGIRDRAILEVMYATGLRVSELIALNLNELHLEMGLIETVGKGNKQRIIPIGDVAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y        +          +     L+RQ   ++LKA   +AGI KKNI+PH +
Sbjct: 185 QWLERYINGPRRALLGAKRYNEIFLNQHGHPLTRQGVWKNLKAQVQKAGI-KKNITPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   +L  +   YHP A
Sbjct: 244 RHSFATHLLENGADLRIVQELLGHADISTTQIYTHITQQRLVDVYDKYHPRA 295


>gi|301154937|emb|CBW14400.1| site-specific tyrosine recombinase [Haemophilus parainfluenzae
           T3T1]
          Length = 297

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 101/289 (34%), Positives = 162/289 (56%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+ + +SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKQNLSLETLEPLDLQQFLGSRLEQGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  + +LL    +E        
Sbjct: 76  SAMRKLFQYLYREKYRTDDPSAVLSSPKLPSRLPKYLTEQQVTDLLNTPDVEI------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELVTL+   +NL +  + + GKGNKER+V +   A   +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVTLTIENMNLQQGVVRVIGKGNKERIVPMGEEAAFWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +   ++RQ F   +K  A  AGI    +SPH++RHA
Sbjct: 189 RQFVLYGRPILLNGQSSDVVFPSQRAQQMTRQTFWHRIKHYAILAGIDTDALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKHLHERFHPRG 297


>gi|210634278|ref|ZP_03298051.1| hypothetical protein COLSTE_01973 [Collinsella stercoris DSM 13279]
 gi|210158880|gb|EEA89851.1| hypothetical protein COLSTE_01973 [Collinsella stercoris DSM 13279]
          Length = 302

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 96/297 (32%), Positives = 153/297 (51%), Gaps = 15/297 (5%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +S ER  S  T++AY+RDL+  + FL  + ++   + +   +  ++ H  +     +S  
Sbjct: 15  LSVERNLSPYTVAAYRRDLEAYRAFLAERGVTGPDSVTRRDVEDFVAHRRETGAADASVN 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S ++  + FL  EG+    P+  +  PK    LP  +  D    LL+Q         
Sbjct: 75  RALSAVKGLHRFLVREGISTTYPTSAIRTPKAAKHLPDVISIDQACALLDQPF------- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           P      R    +E+LY  G+RVSEL  L    L+L E  +++ GKG+KERL  ++ SAL
Sbjct: 128 PATAAGARDHAALEVLYGCGLRVSELTGLDVRDLHLDEEFLLVMGKGSKERLAPITGSAL 187

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPS-----STKTGHLSRQVFARDLKALAARAGIQKKNI 235
            AL+ Y    +  ++ G+      S     + +   LSRQ      +      GI+   +
Sbjct: 188 RALEAYLTLGARDELMGHARAAGVSPAVFLNARGTRLSRQSVHAICERYGRMVGIEG--L 245

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            PH +RH+FA+H+L GGADLR +Q +LGH DI+TTQIYTH+   +L+++    HP A
Sbjct: 246 HPHTLRHSFATHMLAGGADLRVLQEILGHADIATTQIYTHVDQTQLREVYLAAHPRA 302


>gi|16272264|ref|NP_438476.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae Rd
           KW20]
 gi|260581222|ref|ZP_05849041.1| tyrosine recombinase XerD [Haemophilus influenzae RdAW]
 gi|1175025|sp|P44630|XERD_HAEIN RecName: Full=Tyrosine recombinase xerD
 gi|1573278|gb|AAC21974.1| integrase/recombinase (xerD) [Haemophilus influenzae Rd KW20]
 gi|260092147|gb|EEW76091.1| tyrosine recombinase XerD [Haemophilus influenzae RdAW]
          Length = 297

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 98/289 (33%), Positives = 164/289 (56%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+  ++SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNDLSLETLDAVDLQGFLGERLEKGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  +++LL    +E        
Sbjct: 76  SAMRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTPNVEV------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +   ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFMLYGRPVLLNGQSSDVVFPSQRAQQMTRQTFWHRVKHYAILADIDADALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|145640252|ref|ZP_01795836.1| tyrosine recombinase [Haemophilus influenzae R3021]
 gi|145274838|gb|EDK14700.1| tyrosine recombinase [Haemophilus influenzae 22.4-21]
          Length = 297

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 99/289 (34%), Positives = 166/289 (57%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+  ++SL    +  L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNDLSLETLDSVDLQGFLGERLEKGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  +++LL    +E        
Sbjct: 76  SAMRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTPDVEV------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +T  ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFMLYGRPVLLNGQSSDVVFPSQRTQQMTRQTFWHRVKHYAILADIDADALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|157372126|ref|YP_001480115.1| site-specific tyrosine recombinase XerD [Serratia proteamaculans
           568]
 gi|157323890|gb|ABV42987.1| tyrosine recombinase XerD [Serratia proteamaculans 568]
          Length = 299

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 108/291 (37%), Positives = 172/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL+ +  +LN +  SL  A    L ++L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLQALGAWLNQQNTSLLQAQALDLQAFLADRVEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E +R D+P+  L  PK    LPK L +  +  LL+   ++      
Sbjct: 76  LLSAMRRLFQYLYRENMRSDDPTALLASPKLPQRLPKDLSEAQVDALLKAPCVD------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYLEHGRPWMVNGQALDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|145632561|ref|ZP_01788295.1| tyrosine recombinase [Haemophilus influenzae 3655]
 gi|148825411|ref|YP_001290164.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           PittEE]
 gi|229845011|ref|ZP_04465148.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           6P18H1]
 gi|260582592|ref|ZP_05850382.1| tyrosine recombinase XerD [Haemophilus influenzae NT127]
 gi|144986756|gb|EDJ93308.1| tyrosine recombinase [Haemophilus influenzae 3655]
 gi|148715571|gb|ABQ97781.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           PittEE]
 gi|229812145|gb|EEP47837.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           6P18H1]
 gi|260094403|gb|EEW78301.1| tyrosine recombinase XerD [Haemophilus influenzae NT127]
 gi|301169019|emb|CBW28616.1| site-specific tyrosine recombinase [Haemophilus influenzae 10810]
          Length = 297

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 98/289 (33%), Positives = 164/289 (56%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+  ++SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNDLSLETLDAVDLQGFLGERLEKGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  +++LL    +E        
Sbjct: 76  SAMRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTPDVEV------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +   ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFMLYGRPVLLNGQSSDVVFPSQRAQQMTRQTFWHRVKHYAILADIDADALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|145631442|ref|ZP_01787212.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           R3021]
 gi|144982979|gb|EDJ90488.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           R3021]
          Length = 297

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 97/289 (33%), Positives = 164/289 (56%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+  ++SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNDLSLETLDAVDLQGFLGERLEKGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  +++LL    ++        
Sbjct: 76  SAMRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTPDVDV------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +   ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFMLYGRPVLLNGQSSDVVFPSQRAQQMTRQTFWHRVKHYAILADIDADALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|293394605|ref|ZP_06638899.1| tyrosine recombinase XerD [Serratia odorifera DSM 4582]
 gi|291422914|gb|EFE96149.1| tyrosine recombinase XerD [Serratia odorifera DSM 4582]
          Length = 299

 Score =  194 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL+ + N+L      L  A    L ++L    +     SS  R
Sbjct: 16  LWLERNLAENTLASYRLDLQALVNWLAQHNSDLLQAEALDLQAFLAERVEGGYKASSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E +R D+P+  L  PK    LPK L +  I  LL+   ++      
Sbjct: 76  LLSAMRRLFQYLYREKMRADDPTALLASPKLPQRLPKDLSEAQIDALLQAPCVD------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV LS   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPLELRDKAMLEVLYATGLRVSELVGLSISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYLEHGRPWLVNGQTIDVLFPSQRCQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|294501141|ref|YP_003564841.1| tyrosine recombinase XerD [Bacillus megaterium QM B1551]
 gi|294351078|gb|ADE71407.1| tyrosine recombinase XerD [Bacillus megaterium QM B1551]
          Length = 297

 Score =  194 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 95/293 (32%), Positives = 153/293 (52%), Gaps = 9/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           +  ER  + NT+ +Y+RDLK+   +L    +  S +  +  H++++L +LS ++  + + 
Sbjct: 12  LVVERGLAKNTIDSYERDLKKYAQYLEHVEQLKSFNEVTRLHIVNFLKYLSDQQKSSKTI 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R ++  R F+ FL  E     +PS  ++ P+    LPK L+ + +  LL          
Sbjct: 72  ARHVASTRSFHQFLLREKAADTDPSVHIDTPQLERKLPKVLNAEEVEALLNV-------F 124

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSELV L+    +LT   +   GKGNKER+V +   A
Sbjct: 125 DTSTPFGIRDKAMLELLYATGIRVSELVNLNIDDAHLTMGFIRCIGKGNKERIVPIGRLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A++ Y +   S+     +          G    +     +    A     +K ++PH 
Sbjct: 185 TEAIEEYLQHSRSVLTKQKEQDKALFVNHHGRRLTRQGFWKILKKLASEAKIEKELTPHT 244

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ +   +HP A
Sbjct: 245 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKARLKDVYNQFHPRA 297


>gi|295399051|ref|ZP_06809033.1| tyrosine recombinase XerD [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294978517|gb|EFG54113.1| tyrosine recombinase XerD [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 299

 Score =  194 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 112/295 (37%), Positives = 165/295 (55%), Gaps = 12/295 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           ++ ER  + NT+ +Y+RDLK+  ++L    +  S +  S  H++ +L  L ++     + 
Sbjct: 13  LTVERNLAKNTIVSYERDLKKYAHYLRHVEQIQSWNDVSRLHIMQFLKFLKEKGSSPKTI 72

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E +   +PS  +E P+    LPK L  + +  LLE         
Sbjct: 73  ARHIASIRSFHQFLLREKIADQDPSVHIESPQMERTLPKVLSLEEVEALLEAP------- 125

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   +IELLYATGMRVSELV L+   ++LT   +   GKGNKER+V +   A
Sbjct: 126 KTNTPIGIRDKAMIELLYATGMRVSELVNLNLSDVHLTMGFVRCYGKGNKERIVPVGSMA 185

Query: 180 LHALQMYKKTCSS--MKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           L AL+ Y +T     +            +     L+RQ F + LK LA  A I+K+ ++P
Sbjct: 186 LDALKAYLETARPKLINPKKRTTDALFLNHYGDRLTRQGFWKILKKLAKEANIEKE-LTP 244

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 245 HTLRHSFATHLLENGADLRAVQELLGHADISTTQIYTHVTKTRLKDVYKQFHPRA 299


>gi|217967855|ref|YP_002353361.1| tyrosine recombinase XerD [Dictyoglomus turgidum DSM 6724]
 gi|217336954|gb|ACK42747.1| tyrosine recombinase XerD [Dictyoglomus turgidum DSM 6724]
          Length = 296

 Score =  194 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 107/296 (36%), Positives = 156/296 (52%), Gaps = 11/296 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT+ +Y+RDL++   FL  +++++          YL  L  R     S  R
Sbjct: 12  LKFEKNMSPNTIDSYRRDLEDFIIFLQKEKVNIKNLKREEWQRYLVSLYNR-YKIKSIAR 70

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           KIS IR F  FL  EG    N S  + +PK    LP+ L    I N L+        P P
Sbjct: 71  KISSIRSFLKFLLREGYINRNYSSFMIIPKIPMYLPEILDNKEIENFLK-------IPDP 123

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E  YATGMRVSELV L   ++NL E+ +   GKG+KER++ L   A+ 
Sbjct: 124 LSPLGIRNIAILETFYATGMRVSELVNLDVQSINLEEKYVRCFGKGDKERIIPLGDYAVE 183

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           +L+ Y     S             + K   ++RQ     +K  +   G+ KK +SPH  R
Sbjct: 184 SLKKYLLVRDSFNPKDEKA--LFLNKKGERITRQGVWFIIKTYSKILGLPKK-VSPHTFR 240

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           H+FA+HLL  GAD+R +Q LLGH+D++TTQIYTH++  KL ++ Q  HPL ++  K
Sbjct: 241 HSFATHLLSNGADIRIVQELLGHSDVATTQIYTHIVSSKLHEVYQKAHPLTRRNDK 296


>gi|322831506|ref|YP_004211533.1| tyrosine recombinase XerD [Rahnella sp. Y9602]
 gi|321166707|gb|ADW72406.1| tyrosine recombinase XerD [Rahnella sp. Y9602]
          Length = 319

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 108/292 (36%), Positives = 170/292 (58%), Gaps = 7/292 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  + NTLS+Y++DLK +  +L++    L   S   L  +L+   +     +S  
Sbjct: 35  MLWIERNLAENTLSSYRQDLKSLLGWLHHNNTDLLHVSAEDLQLFLSERIEGGYKATSSA 94

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R+ + ++  E +R+D+P+  L  PK    LPK L +  +  LL    ++     
Sbjct: 95  RLLSAMRRLFQYMNRESVRQDDPTALLSSPKLPQRLPKDLSEAQVDALLASPSVDV---- 150

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++ELLYATG+RVSELV L+   L+L +  + + GKGNKERLV +   A+
Sbjct: 151 ---PLELRDKAMLELLYATGLRVSELVGLTLSDLSLRQGVVRVIGKGNKERLVPMGEEAV 207

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           + ++ Y +      + G  L +   S +   ++RQ F   +K  A  AGI  + +SPH++
Sbjct: 208 YWIENYFEHGRPWLLNGQSLDVVFPSNRAQQMTRQTFWHRIKHYAILAGIDAERLSPHVL 267

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RHAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L Q +HP A
Sbjct: 268 RHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKLLHQQHHPRA 319


>gi|224476610|ref|YP_002634216.1| putative site-specific recombinase XerD [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|222421217|emb|CAL28031.1| putative site-specific recombinase XerD [Staphylococcus carnosus
           subsp. carnosus TM300]
          Length = 299

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 98/293 (33%), Positives = 156/293 (53%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDL + + +L  K+I+ +       +   L +L        S 
Sbjct: 15  FIQIEKGLSANTIGAYRRDLNKYKEYLVLKKINNIDFIDREIIQQCLGYLHDDGHSAKSI 74

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS +R F+ F   E     +P+  +E PK    LP  L  + +  LLE         
Sbjct: 75  ARFISTVRSFHQFALRERYAAKDPTVLIETPKYERRLPDVLDVEDVLALLETP------- 127

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRV+EL+ +    +NL    + + GKG+KER++ L  + 
Sbjct: 128 DLSKNNGYRDRTILELLYATGMRVTELIHVRVEDVNLIMGFVRVFGKGSKERIIPLGETV 187

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L+ Y +T     +      +   +     LSRQ   + +K    +A I+KK ++PH 
Sbjct: 188 IDYLKKYIETVRPQLLKQTVTDVLFLNLHGKPLSRQGIWKLIKQYGVKANIKKK-LTPHS 246

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+  ++HP A
Sbjct: 247 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNEFHPRA 299


>gi|152971840|ref|YP_001336949.1| site-specific tyrosine recombinase XerD [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|238896434|ref|YP_002921172.1| site-specific tyrosine recombinase XerD [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262042535|ref|ZP_06015692.1| tyrosine recombinase XerD [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330010972|ref|ZP_08306937.1| tyrosine recombinase XerD [Klebsiella sp. MS 92-3]
 gi|150956689|gb|ABR78719.1| tyrosine recombinase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|238548754|dbj|BAH65105.1| tyrosine recombinase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259040095|gb|EEW41209.1| tyrosine recombinase XerD [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328534349|gb|EGF60959.1| tyrosine recombinase XerD [Klebsiella sp. MS 92-3]
          Length = 298

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 111/291 (38%), Positives = 172/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L+++ +SL++  ++ L + L          +S  R
Sbjct: 15  LWLERNLAENTLSAYRRDLTMLVEWLHHRGLSLASVGSDDLQALLAERQSGGYKATSTAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+  L  E +R D+PS  L  PK    LPK L +  +  LL+   +E      
Sbjct: 75  LLSAVRRFFQHLYREKIRPDDPSALLASPKLPQRLPKDLSEAQVERLLQAPLVE------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A+ 
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVLRVVGKGNKERLVPLGEEAVL 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WVENYLEYGRPWLLNGVASDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|304385052|ref|ZP_07367398.1| tyrosine recombinase XerD [Pediococcus acidilactici DSM 20284]
 gi|304329246|gb|EFL96466.1| tyrosine recombinase XerD [Pediococcus acidilactici DSM 20284]
          Length = 296

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 103/292 (35%), Positives = 160/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+ +Y+++L+ +QNFL  + I  +       +++YL+ L Q     SS  
Sbjct: 13  LKVERGLSDNTIVSYRQELRHLQNFLQEQHIADIKDVDRYTILNYLDALKQTGRARSSSI 72

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
             IS +R+F+ +L      + NP   ++ PK+   LP  L  + +  LL+          
Sbjct: 73  HTISSLRKFFKYLLLNDQIQTNPMVNIDPPKRAQHLPSVLTTEEVERLLKVP-------D 125

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATG+RVSEL+ L+ + L+L    +   GKGNK+R++ +   A+
Sbjct: 126 TSKPLGIRDRAILEVMYATGLRVSELIALNLNELHLEMGLIETVGKGNKQRIIPIGDVAI 185

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y        +          +     L+RQ   ++LKA   +AGI KKNI+PH +
Sbjct: 186 QWLERYINGPRRALLGAKRYNEIFLNQHGHPLTRQGVWKNLKAQVQKAGI-KKNITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   +L  +   YHP A
Sbjct: 245 RHSFATHLLENGADLRIVQELLGHADISTTQIYTHITQQRLVDVYDKYHPRA 296


>gi|325577298|ref|ZP_08147782.1| tyrosine recombinase XerD [Haemophilus parainfluenzae ATCC 33392]
 gi|325160880|gb|EGC73001.1| tyrosine recombinase XerD [Haemophilus parainfluenzae ATCC 33392]
          Length = 297

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 100/289 (34%), Positives = 161/289 (55%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+ + +SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKQNLSLETLDPLDLQQFLGSRLEQGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  + +LL    +E        
Sbjct: 76  SAMRKLFQYLYREKYRTDDPSAVLNSPKLPSRLPKYLTEQQVTDLLNTPDVEI------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELVTL+   +NL +  + + GKGNKER+V +   A   +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVTLTIENMNLQQGVVRVIGKGNKERIVPMGEEAAFWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +   ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFVLYGRPILLNGQSSDVVFPSQRAQQMTRQTFWHRIKHYAVLAEIDTDALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKHLHERFHPRG 297


>gi|312110344|ref|YP_003988660.1| tyrosine recombinase XerD [Geobacillus sp. Y4.1MC1]
 gi|311215445|gb|ADP74049.1| tyrosine recombinase XerD [Geobacillus sp. Y4.1MC1]
          Length = 299

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 112/295 (37%), Positives = 165/295 (55%), Gaps = 12/295 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           ++ ER  + NT+ +Y+RDLK+  ++L    +  S +  S  H++ +L  L ++     + 
Sbjct: 13  LTVERNLAKNTIVSYERDLKKYAHYLRHVEQIQSWNDVSRLHIMQFLKFLKEKGSSPKTI 72

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E +   +PS  +E P+    LPK L  + +  LLE         
Sbjct: 73  ARHIASIRSFHQFLLREKIADQDPSVHIESPQMERTLPKVLSLEEVEALLEAP------- 125

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   +IELLYATGMRVSELV L+   ++LT   +   GKGNKER+V +   A
Sbjct: 126 KTNTPIGIRDKAMIELLYATGMRVSELVNLNLSDVHLTMGFVRCYGKGNKERIVPIGSMA 185

Query: 180 LHALQMYKKTCSS--MKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           L AL+ Y +T     +            +     L+RQ F + LK LA  A I+K+ ++P
Sbjct: 186 LDALKAYLETARPKLINPKKRATDALFLNHYGDRLTRQGFWKILKKLAKEANIEKE-LTP 244

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 245 HTLRHSFATHLLENGADLRAVQELLGHADISTTQIYTHVTKTRLKDVYKQFHPRA 299


>gi|258515282|ref|YP_003191504.1| tyrosine recombinase XerD [Desulfotomaculum acetoxidans DSM 771]
 gi|257778987|gb|ACV62881.1| tyrosine recombinase XerD [Desulfotomaculum acetoxidans DSM 771]
          Length = 296

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 100/292 (34%), Positives = 162/292 (55%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  + NTLSAY+ DL+   +F  +K+I S S A  N ++ Y+  L Q+ +  ++  
Sbjct: 12  LAVERGLAENTLSAYRMDLQNFLSFCQDKQIKSWSDAGKNTILMYMMFLKQQAMSPATIS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+++ ++ F+ FL  E + + +P++++E PK +  LP  L    +  LL         P 
Sbjct: 72  RRLAALKSFFRFLTSEQVVEFSPTESMESPKLSQKLPNVLSTSEVELLL-------MQPK 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             Q   +R   ++ELLYATG+RVSELV L+   +++ E+ +   GKG+KER+V L   + 
Sbjct: 125 ISQPAGIRDKAMLELLYATGIRVSELVDLNLEDVSIAEQFIRCYGKGSKERIVPLGSLSA 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             ++ Y +      +              G    +     +     R G   K I+PH +
Sbjct: 185 SFVEEYLQKGRVKLIKKAQTTNALFLNHHGQRLTRQGFWKIIKKYGRQGKIDKPITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++Q +LGH DISTTQIYTHL   +L+++ ++ HP A
Sbjct: 245 RHSFATHLLENGADLRSVQEMLGHADISTTQIYTHLTKTRLKEVYKNSHPRA 296


>gi|307129430|ref|YP_003881446.1| site-specific tyrosine recombinase [Dickeya dadantii 3937]
 gi|306526959|gb|ADM96889.1| site-specific tyrosine recombinase [Dickeya dadantii 3937]
          Length = 299

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 167/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLS+Y+ DL+ + ++L + + SL  A  + L  +L    +     +S  R
Sbjct: 16  LWLERNLAENTLSSYRNDLRSLADWLAHHDSSLLQAQPSDLQDFLAERLEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R D+PS  L  PK    LPK L +  +  LL     +      
Sbjct: 76  LLSAMRRLFQYLYREKQRPDDPSAPLSSPKLPQRLPKDLTEAQVEALLAAPVTD------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++ELLYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPIELRDKAMLELLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  L +   S +   ++RQ F   +K  A  A I    +SPH++R
Sbjct: 189 WLEQYLEYSRPWLLNGQTLDVLFPSNRAQQMTRQTFWHRIKHYATLASIDSNKLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 299


>gi|296112007|ref|YP_003622389.1| integrase/recombinase [Leuconostoc kimchii IMSNU 11154]
 gi|295833539|gb|ADG41420.1| integrase/recombinase [Leuconostoc kimchii IMSNU 11154]
          Length = 298

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 101/291 (34%), Positives = 159/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT+ +Y++DLK+   ++  + ++L+A     ++++LN L +     +S  R
Sbjct: 16  IRIERGLSDNTIKSYQQDLKQFSVYMTAENLNLNAVDHVVILTWLNQLRELNKSNNSVIR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ +R+F+ +L  E + + NP   ++ PKK   LP  L    I  LL+           
Sbjct: 76  MVTSLRKFFGYLLQENVIRHNPMSDVKPPKKAEHLPAVLSVAEIDALLQVP-------TE 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   LIE++YATG+RVSELV L    L+L    +   GKG+KER++ +   A  
Sbjct: 129 KTALGLRNRALIEVMYATGLRVSELVNLKMSDLHLQLGLIQTIGKGDKERIIPIGEIATE 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y        +          + +   LSRQ   + +K L + AGI  K++SPH +R
Sbjct: 189 WLERYFSHSRLTLLKDKVSPFVFLNDRGTQLSRQGVWKIIKNLVSAAGID-KDVSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+H+LE GADLR +Q LLGH DISTTQIYTH+   +L ++   +HP A
Sbjct: 248 HSFATHILENGADLRIVQELLGHADISTTQIYTHISKKRLSEVYDAFHPRA 298


>gi|68248917|ref|YP_248029.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           86-028NP]
 gi|68057116|gb|AAX87369.1| Site-specific recombinase XerD [Haemophilus influenzae 86-028NP]
          Length = 297

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 97/289 (33%), Positives = 162/289 (56%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+  ++SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNDLSLETLDAVDLQGFLGERLEKGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  +++LL              
Sbjct: 76  SAMRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTP-------DVKV 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +   ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFMLYGRPVLLNGQSSDVVFPSQRAQQMTRQTFWHRVKHYAILADIDADALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|282852078|ref|ZP_06261436.1| tyrosine recombinase XerD [Lactobacillus gasseri 224-1]
 gi|282556838|gb|EFB62442.1| tyrosine recombinase XerD [Lactobacillus gasseri 224-1]
          Length = 296

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 94/292 (32%), Positives = 154/292 (52%), Gaps = 10/292 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT+ +Y+ DL+E  ++L ++  +        + ++L     +   T+S  R 
Sbjct: 13  QVERGLSPNTIISYRTDLEEYLDYLQDQNETSWEVDYLVVDAFLATQKDKGKATTSISRM 72

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           IS +R+FY +L  + + + +P   ++ PK    LP  L ++ +  LL             
Sbjct: 73  ISSLRKFYQWLLRQDIIERDPLVKIDSPKSERRLPTALSEEEVDKLLAAP-------DTN 125

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
               +R   ++E+LYATGMRVSEL+ L    ++   + + + GKG+KERLV ++  AL  
Sbjct: 126 TPLGIRDRAMLEVLYATGMRVSELINLRTGDIHADLKIIRVLGKGSKERLVPITEVALSW 185

Query: 183 LQMYKKTCS--SMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           L+ Y+       +  +G    +   +     L+RQ   + +K      GI  KN++PH +
Sbjct: 186 LEKYQTDVRDAQVLKSGQFTDVIFLNNHGHQLTRQAVWQKIKKYCQLIGIT-KNVTPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH FA+HLLE GADLR +Q +LGH+DI+TTQIYT+L    + ++    HP A
Sbjct: 245 RHTFATHLLENGADLRVVQEILGHSDITTTQIYTNLTQKHILEVYNQAHPRA 296


>gi|52424801|ref|YP_087938.1| site-specific tyrosine recombinase XerD [Mannheimia
           succiniciproducens MBEL55E]
 gi|52306853|gb|AAU37353.1| XerC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 298

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 101/287 (35%), Positives = 160/287 (55%), Gaps = 7/287 (2%)

Query: 6   RASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKISV 65
           +  S NT+ +Y+ DL  +  +L  +  SL    ++ L ++L     +    +S  R +S 
Sbjct: 19  KGLSDNTVQSYRLDLTALSQWLQGQGKSLETLDSSDLQAFLGERVDQGYKATSTARMLSA 78

Query: 66  IRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQWK 125
           +R+ + +L  E  R D+PS  L  PK    LPK L +  + +LL          +     
Sbjct: 79  MRKLFQYLYQESYRTDDPSAILSSPKLPGRLPKYLTEQQVGDLLNAP-------STDIPL 131

Query: 126 RVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQM 185
            +R   ++ELLYATG+RV+ELVTLS   +NL +  + + GKGNKER+V +   A + +  
Sbjct: 132 ELRDKAMLELLYATGLRVTELVTLSTDNINLEQGVVRVIGKGNKERIVPMGEEASYWVGQ 191

Query: 186 YKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAFA 245
           +      M + G    +   S +   ++RQ F   +K  A  A I   ++SPH++RHAFA
Sbjct: 192 FILYGRPMLLNGQSSDVIFPSKRALQMTRQTFWHRIKHYAILADIDTDSLSPHVLRHAFA 251

Query: 246 SHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +HL+  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L + YHP  
Sbjct: 252 THLVNHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKRLHEKYHPRG 298


>gi|300173433|ref|YP_003772599.1| tyrosine recombinase XerD [Leuconostoc gasicomitatum LMG 18811]
 gi|299887812|emb|CBL91780.1| tyrosine recombinase XerD [Leuconostoc gasicomitatum LMG 18811]
          Length = 298

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 161/291 (55%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT+ +Y +DL++   ++  +++ L+      ++++LN+L ++    +S  R
Sbjct: 16  IRIERGLSDNTIKSYHQDLQQFALYVTTEKLQLNDIDHIAILTWLNNLREQGKSNNSVIR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ +R+F+ +L  EGL   NP   +  PKK   LP  L    I  LL            
Sbjct: 76  MVTSLRKFFGYLLQEGLILHNPMTDVRPPKKAEHLPSVLTVAEIDALLAVP-------TE 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                VR   LIE+LYATG+RVSELV L    L+L    +   GKG+KER++ +   A  
Sbjct: 129 TTPLGVRNRTLIEVLYATGLRVSELVNLKMSDLHLQLGLIQTIGKGDKERIIPIGEVAAD 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y      + + GN+      + +   LSRQ   + +K L   AGI  K++SPH +R
Sbjct: 189 WLEKYFSNSRLLLLKGNESPFVFLNDRGNQLSRQGVWKIIKKLVLLAGIT-KDVSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+H+LE GADLR +Q LLGH DISTTQIYTH+   +L ++  ++HP A
Sbjct: 248 HSFATHILENGADLRIVQELLGHADISTTQIYTHISKKRLSEVYDNFHPRA 298


>gi|229543943|ref|ZP_04433002.1| tyrosine recombinase XerD [Bacillus coagulans 36D1]
 gi|229325082|gb|EEN90758.1| tyrosine recombinase XerD [Bacillus coagulans 36D1]
          Length = 297

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 109/295 (36%), Positives = 164/295 (55%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI--SLSAASTNHLISYLNHLSQRKLVTSS 58
            M  E+  + NT+++YKRDL     +L   E+  S +  +  H++ +LN L Q+   + +
Sbjct: 11  FMIVEKGLAENTIASYKRDLHSYLRYLQKVELVTSWNEVTRFHILHFLNFLKQQGKSSKT 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R ++ IR F+ FL  E     +P+  +E PK    LPK L    +  LL   K +   
Sbjct: 71  IARHVASIRSFHQFLLREKFAGQDPTVHIETPKPERTLPKVLSVQEVEALLAAPKGD--- 127

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++ELLYATGMRVSE+  L+   L+L+   +   GKG+KER++ +  +
Sbjct: 128 ----TPLHMRDGAMLELLYATGMRVSEMTGLNLDDLHLSMGFIKCIGKGDKERIIPIGRT 183

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A  AL+ Y K     +    N       +     LSRQ F + LKALA +A I+ K+I+P
Sbjct: 184 ASAALERYLKEGRPKLVSKTNRTDALFLNHHGARLSRQGFWKILKALAKKANIE-KDITP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HL+E GADLR +Q +LGH DISTTQIYTH+   +L+ +   +HP A
Sbjct: 243 HTLRHSFATHLIENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYAKFHPRA 297


>gi|254472325|ref|ZP_05085725.1| tyrosine recombinase XerD [Pseudovibrio sp. JE062]
 gi|211958608|gb|EEA93808.1| tyrosine recombinase XerD [Pseudovibrio sp. JE062]
          Length = 295

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 134/295 (45%), Positives = 191/295 (64%), Gaps = 3/295 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+S ER S+ NTL +Y+ DL++  +FL  + + L A     + +YL+ L+ R    SSQ 
Sbjct: 1   MLSVERVSAFNTLESYRTDLEDFDSFLTTQGVDLLAVQVTDVRAYLSDLTDRGFAASSQA 60

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLL---EQAKIEAE 117
           R++S +RQFY F   E +R D+P+ T+  P+K   LP  L ++ +  L+   E+      
Sbjct: 61  RRLSALRQFYQFCYAEDIRDDDPTRTVASPRKAATLPSVLSEEEVDRLIGKAEELANITH 120

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
           +    Q +  RI+ L+E+LYATG+RVSELV+L         R + ++GKG KER V LSP
Sbjct: 121 DSDAKQIRAARIYTLLEVLYATGLRVSELVSLPVSAAIRDSRLITVKGKGGKERAVPLSP 180

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
            A  A+  Y +  +++    + +WLFPS  ++GH +RQ F RDLKALA  A I +  +SP
Sbjct: 181 RAQSAMVEYVRLRAAVGAYADSVWLFPSHGESGHFTRQAFGRDLKALALEADIDRNKVSP 240

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H++RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++LQKLV+D+HPLA
Sbjct: 241 HVLRHAFASHLLQNGADLRVVQQLLGHADISTTQIYTHVLEERLQKLVEDHHPLA 295


>gi|118586872|ref|ZP_01544306.1| integrase/recombinase [Oenococcus oeni ATCC BAA-1163]
 gi|118432704|gb|EAV39436.1| integrase/recombinase [Oenococcus oeni ATCC BAA-1163]
          Length = 302

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 94/292 (32%), Positives = 151/292 (51%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           + +ER    N++ +YK+DL E   ++  + I L       ++ +LN+L       +S   
Sbjct: 19  LRTERGLLENSIKSYKQDLSEFGAYIQKENILLVKVDRFTILDWLNYLQNSGKSNNSIVH 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+ +L  +   + +P   +  PKKN  LP+ L    I  +L            
Sbjct: 79  MVSSLRKFFAYLSDDQQIQIDPMLKVTTPKKNSHLPQVLTATEIEAVLAVP-------DI 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   L+E +YATG RVSE+  L    L+     +   GKG K+R+V +   +L 
Sbjct: 132 STTLGLRNRALLETMYATGFRVSEICNLKLADLHDELGLITTIGKGQKQRIVPIGEMSLL 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            +  Y K    + +   +      +     +SRQ   + +K +A +AGI  K+ISPH +R
Sbjct: 192 YISKYFKESRPILLKDKESPYLFLNDHGHRISRQGIFKLVKEIAIKAGID-KDISPHTLR 250

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           H+FA++LLE GADLR +Q LLGH+DISTTQIYTH+    +++    +HP AK
Sbjct: 251 HSFATNLLENGADLRIVQELLGHSDISTTQIYTHVSQKHIREQYNRFHPRAK 302


>gi|227524454|ref|ZP_03954503.1| site-specific DNA tyrosine recombinase XerD [Lactobacillus
           hilgardii ATCC 8290]
 gi|227088413|gb|EEI23725.1| site-specific DNA tyrosine recombinase XerD [Lactobacillus
           hilgardii ATCC 8290]
          Length = 295

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 100/293 (34%), Positives = 154/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
            +  ER  S NT+  Y++DL E  +F       +S      +++YL +L Q K   ++  
Sbjct: 11  FLRVERGLSENTIKGYQQDLSEAIHFFQKTTKDISKVDQFLILNYLENLQQEKKSRNTVI 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R F+ +L   G+  D+P   ++ PK++  LP  L    +  LL         P 
Sbjct: 71  RTVSSLRNFFRYLAQFGVVPDDPMLKVDSPKQSKTLPDVLSVSEVNKLLS-------MPN 123

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP-SA 179
             +   VR   ++E LYATG+RVSELV L    L+L  + +   GKG++ER++ +   + 
Sbjct: 124 VSKPLGVRDRAMLETLYATGLRVSELVNLRLVDLHLPMKLIQTVGKGDRERIIPIGDVAI 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
               Q  K T   +     +      +     L+RQ   + +K     AGI K++++PH 
Sbjct: 184 DWITQYLKTTRIDLLRKRTNTDFVFLNAHGRRLTRQAIWQMIKKYVKLAGI-KRHVTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+    L ++ Q +HP A
Sbjct: 243 LRHSFATHLLENGADLRIVQELLGHADISTTQIYTHISHKHLTEVYQKFHPRA 295


>gi|170017033|ref|YP_001727952.1| site-specific recombinase XerD [Leuconostoc citreum KM20]
 gi|169803890|gb|ACA82508.1| Site-specific recombinase XerD [Leuconostoc citreum KM20]
          Length = 298

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 103/291 (35%), Positives = 160/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT+++Y++DL +   +L+ + + L       ++S+LN L       SS  R
Sbjct: 16  IRIERGLSENTITSYRQDLNQFGMYLSQEHLLLGEVDHIVVLSWLNRLRTNGKSNSSVIR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ +R+F+ +L  E +   NP   ++ PKK   LP  L  + I  LL         P P
Sbjct: 76  MVTSLRRFFGYLTQENMITHNPMSHVKPPKKAAHLPAVLSFEEIDTLL-------GVPVP 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   L+E++YATG+RVSELV L    L++    +   GKG+KER++ +   A+ 
Sbjct: 129 STPLGMRNRTLLEVMYATGLRVSELVNLKMSDLHIQLGLIQTLGKGDKERIIPIGEVAVD 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y        +   +      + + G L+RQ   + +K L   AGI  K++SPH +R
Sbjct: 189 WLERYFAGARLTLLKAQESPYVFVNDRGGQLTRQGVWKIIKKLVLEAGIT-KDVSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+H+LE GADLR +Q LLGH DISTTQIYTH+   +L ++  +YHP A
Sbjct: 248 HSFATHILENGADLRIVQELLGHADISTTQIYTHISKKRLSEVYDEYHPRA 298


>gi|145638777|ref|ZP_01794386.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           PittII]
 gi|148827463|ref|YP_001292216.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           PittGG]
 gi|145272372|gb|EDK12280.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           PittII]
 gi|148718705|gb|ABQ99832.1| tyrosine recombinase [Haemophilus influenzae PittGG]
 gi|309750267|gb|ADO80251.1| Site-specific, tyrosine recombinase XerD [Haemophilus influenzae
           R2866]
          Length = 297

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 101/289 (34%), Positives = 166/289 (57%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+  ++SL      HL  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNDLSLETLDAVHLQGFLGERLEKGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S IR+ + +L  E  R D+PS  L  PK    LPK L +  +++LL    +E        
Sbjct: 76  SAIRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTPDVEV------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + + G    +   S +T  ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFMLYGRPVLLNGQSSDVVFPSQRTQQMTRQTFWHRVKHYAILADIDADALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|313884218|ref|ZP_07817984.1| tyrosine recombinase XerD [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620665|gb|EFR32088.1| tyrosine recombinase XerD [Eremococcus coleocola ACS-139-V-Col8]
          Length = 301

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 101/293 (34%), Positives = 157/293 (53%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISL-SAASTNHLISYLNHLSQRKLVTSSQ 59
            ++ ++  S NT++ Y+ DLK+   F   + + L S   T+ +  ++  L++     S+ 
Sbjct: 17  FLAIDKGLSQNTIANYELDLKKFFRFCQIQNMDLLSQIDTDLVRLFIASLNKAGYAASTA 76

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R +S +R F++FL  EG+   NP   +E PKK   LP +L    +  +L     + +  
Sbjct: 77  ARILSSLRAFFHFLMVEGVVSKNPMALIESPKKARTLPHSLSMAEVEAILAAPNTDTKF- 135

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   + E LYATG+RVSEL  LS   L+L  R +   GKGNKER+V L   A
Sbjct: 136 ------GIRDRAMFETLYATGLRVSELANLSLGDLHLDLRFIQTLGKGNKERMVPLGEEA 189

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  ++ Y        +          + +    +RQ   + L    + AGIQKK +SPH+
Sbjct: 190 VFWIEKYLDQVRDGWLPKAGSDYLFLTQRGKAFTRQGIWKTLNKYVSLAGIQKK-VSPHV 248

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+H+LE GADLR +Q LLGH +ISTTQIYTH+   +LQ++ +   P A
Sbjct: 249 LRHSFATHILENGADLRLVQELLGHENISTTQIYTHISHYRLQEVYRKSFPGA 301


>gi|329667457|gb|AEB93405.1| integrase/recombinase XerD [Lactobacillus johnsonii DPC 6026]
          Length = 296

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 94/292 (32%), Positives = 156/292 (53%), Gaps = 10/292 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT+ +Y+ DL+E  ++L ++  +        + ++L     +   T+S  R 
Sbjct: 13  QVERGLSPNTIVSYRTDLEEYLSYLEDQNETSWEVDYLVVDAFLATQKDKGKATTSISRM 72

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           IS +R+FY +L  + + + +P   ++ PK    LP  L ++ +  LL+            
Sbjct: 73  ISSLRKFYQWLLRQDIIERDPLVKIDSPKSERRLPTALSEEEVTKLLDAP-------DTN 125

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
               +R   ++E+LYATGMRVSEL+ L    ++   + + + GKG+KERLV ++  AL  
Sbjct: 126 TRLGIRDRAMLEVLYATGMRVSELINLRTGDIHSELKIIRVLGKGSKERLVPVTEVALSW 185

Query: 183 LQMYKKTCSSMKMTGNDLWLF--PSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           L+ Y+K     ++  +  +      +     L+RQ   + +K      GI  KN++PH +
Sbjct: 186 LEKYQKDVRENQVLKSGQFTDVIFLNNHGHQLTRQAVWQKIKKYCQLIGIT-KNVTPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH FA+HLLE GADLR +Q +LGH+DI+TTQIYT+L    + ++    HP A
Sbjct: 245 RHTFATHLLENGADLRVVQEILGHSDITTTQIYTNLTQKHILEVYNQAHPRA 296


>gi|110635391|ref|YP_675599.1| site-specific tyrosine recombinase XerD [Mesorhizobium sp. BNC1]
 gi|110286375|gb|ABG64434.1| tyrosine recombinase XerD subunit [Chelativorans sp. BNC1]
          Length = 308

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 143/295 (48%), Positives = 194/295 (65%), Gaps = 3/295 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MM++ER +S NTL++Y+RDL +   +L      +  AS   +  YL  ++ R   +++Q 
Sbjct: 13  MMAAERGASDNTLASYRRDLGDADAYLEAPCGGVFKASAADIRKYLADMTARGFASTTQA 72

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +RQF+ FL  EG+R D+P+  L+ PKK   LPKTL +  +  LLE+A  EA    
Sbjct: 73  RKLSSLRQFFKFLYSEGMRDDDPTGVLDSPKKGRPLPKTLSESEMNALLERAADEAREAP 132

Query: 121 PGQWKRV---RIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
            G   RV   R+  L+E+LYA+G+RVSELV+L        ER   ++GKG KER+V LS 
Sbjct: 133 AGTPARVAAQRLSTLLEMLYASGLRVSELVSLPLRVALRDERFFTVRGKGGKERMVPLSA 192

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
            A  A+ ++ K  +      N  WLFP+ + +G+LSRQVFAR+LK LA RAGI    ISP
Sbjct: 193 KAREAVALWLKERARHPSFANSPWLFPAVSASGYLSRQVFARELKGLAGRAGISTAKISP 252

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H++RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L  +LQ+LVQ +HPLA
Sbjct: 253 HVLRHAFASHLLQNGADLRAVQQLLGHADISTTQIYTHVLEKRLQELVQKHHPLA 307


>gi|42519008|ref|NP_964938.1| integrase/recombinase XerD [Lactobacillus johnsonii NCC 533]
 gi|41583295|gb|AAS08904.1| integrase/recombinase XerD [Lactobacillus johnsonii NCC 533]
          Length = 296

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 94/292 (32%), Positives = 156/292 (53%), Gaps = 10/292 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT+ +Y+ DL+E  ++L ++  +        + ++L     +   T+S  R 
Sbjct: 13  QVERGLSPNTIVSYRTDLEEYLSYLEDQNETSWEVDYLVVDAFLATQKDKGKATTSISRM 72

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           IS +R+FY +L  + + + +P   ++ PK    LP  L ++ +  LL+            
Sbjct: 73  ISSLRKFYQWLLRQDIIERDPLVKIDSPKSERRLPTALSEEEVTKLLDAP-------DTN 125

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
               +R   ++E+LYATGMRVSEL+ L    ++   + + + GKG+KERLV ++  AL  
Sbjct: 126 TRLGIRDRAMLEVLYATGMRVSELINLRTGDIHSELKIIRVLGKGSKERLVPITEVALSW 185

Query: 183 LQMYKKTCSSMKMTGNDLWLF--PSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           L+ Y+K     ++  +  +      +     L+RQ   + +K      GI  KN++PH +
Sbjct: 186 LEKYQKDVRENQVLKSGQFTDVIFLNNHGHQLTRQAVWQKIKKYCQLIGIT-KNVTPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH FA+HLLE GADLR +Q +LGH+DI+TTQIYT+L    + ++    HP A
Sbjct: 245 RHTFATHLLENGADLRVVQEILGHSDITTTQIYTNLTQKHILEVYNQAHPRA 296


>gi|300361568|ref|ZP_07057745.1| tyrosine recombinase XerD [Lactobacillus gasseri JV-V03]
 gi|300354187|gb|EFJ70058.1| tyrosine recombinase XerD [Lactobacillus gasseri JV-V03]
          Length = 302

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 96/292 (32%), Positives = 155/292 (53%), Gaps = 10/292 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT+ +Y+ DL+E  ++L ++  +        + ++L     +   T+S  R 
Sbjct: 19  QVERGLSPNTIISYRTDLEEYLDYLQDQNETSWEVDYLVVDAFLAAQKDKGKATTSISRM 78

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           IS +R+FY +L  + + + +P   ++ PK    LP  L ++ +  LL             
Sbjct: 79  ISSLRKFYQWLLRQDIIERDPLIKIDSPKSERRLPTALSEEEVDKLLAAP-------DTN 131

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
               +R   ++ELLYATGMRVSEL+ L    ++   + + + GKG+KERLV ++  AL  
Sbjct: 132 TPLGIRDRAMLELLYATGMRVSELINLRTGDIHSDLKIIRVLGKGSKERLVPITEVALSW 191

Query: 183 LQMYKKTCS--SMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           L+ Y+K      +  +G    +   +     L+RQ   + +K      GI  KN++PH +
Sbjct: 192 LEKYQKDVRDAQVLKSGQFTDVIFLNNHGHQLTRQAVWQKIKKYCQLVGIT-KNVTPHTL 250

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH FA+HLLE GADLR +Q +LGH+DI+TTQIYT+L    + ++    HP A
Sbjct: 251 RHTFATHLLENGADLRVVQEILGHSDITTTQIYTNLTQKHILEVYNQAHPRA 302


>gi|295706488|ref|YP_003599563.1| tyrosine recombinase XerD [Bacillus megaterium DSM 319]
 gi|294804147|gb|ADF41213.1| tyrosine recombinase XerD [Bacillus megaterium DSM 319]
          Length = 297

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 95/293 (32%), Positives = 152/293 (51%), Gaps = 9/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           +  ER  + NT+ +Y+RDLK    +L    +  S +  +  H++++L +LS ++  + + 
Sbjct: 12  LVVERGLAKNTIDSYERDLKNYAQYLEHVEQLKSFNEVTRLHIVNFLKYLSDQQKSSKTI 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R ++  R F+ FL  E     +PS  ++ P+    LPK L+ + +  LL          
Sbjct: 72  ARHVASTRSFHQFLLREKAADTDPSVHIDTPQLERKLPKVLNAEEVEALLNV-------F 124

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSELV L+    +LT   +   GKGNKER+V +   A
Sbjct: 125 DTSTPFGIRDKAMLELLYATGIRVSELVNLNIDDAHLTMGFIRCIGKGNKERIVPIGRLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A++ Y +   S+     +          G    +     +    A     +K ++PH 
Sbjct: 185 TEAIEDYLQHSRSVLTKQKEQDKALFVNHHGRRLTRQGFWKILKKLASEAKIEKELTPHT 244

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ +   +HP A
Sbjct: 245 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKARLKDVYNQFHPRA 297


>gi|223043159|ref|ZP_03613206.1| tyrosine recombinase XerD [Staphylococcus capitis SK14]
 gi|314933674|ref|ZP_07841039.1| tyrosine recombinase XerD [Staphylococcus caprae C87]
 gi|222443370|gb|EEE49468.1| tyrosine recombinase XerD [Staphylococcus capitis SK14]
 gi|313653824|gb|EFS17581.1| tyrosine recombinase XerD [Staphylococcus caprae C87]
          Length = 295

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 103/293 (35%), Positives = 154/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ + +L  ++IS +       +   L HL      + S 
Sbjct: 11  FIQIEKGLSSNTIGAYRRDLKKYEEYLEERKISHIDFVDRQVIQECLGHLIDLGQSSKSL 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  +E PK    LP  L    + +LLE         
Sbjct: 71  ARFISTIRSFHQFALRERYAAKDPTVLIETPKYEKKLPDVLEVQEVLDLLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSE++ L    +NL    + + GKGNKER+V L  + 
Sbjct: 124 DLSKNNGYRDRTMLELLYATGMRVSEIIQLEVEDVNLMMGFVRVFGKGNKERIVPLGDAV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +      +   +     LSRQ   + +K    +A I  K ++PH 
Sbjct: 184 IEYLTTYIETVRPQLLKQTVTHVLFLNMHGKPLSRQGIWKMIKQNGIKANIN-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQFHPRA 295


>gi|90961911|ref|YP_535827.1| integrase/recombinase XerD/RipX family [Lactobacillus salivarius
           UCC118]
 gi|90821105|gb|ABD99744.1| Integrase/recombinase, XerD/RipX family [Lactobacillus salivarius
           UCC118]
          Length = 297

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 104/292 (35%), Positives = 158/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+++Y  D K    +L   EI S    +   +++Y+          SS  
Sbjct: 14  LKVERGLSENTINSYGIDFKLFLEYLRENEIPSFKQVNKEVIVNYMQSEKNNNKANSSIL 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R+F+ +L  E + + +P   ++ PKK   LP+ L K+ +  LL           
Sbjct: 74  RSVSSLRKFFQYLAQEKIIEKDPMLLIDTPKKKQHLPQVLTKEEVEKLLRSPN------- 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            GQ   +R   ++EL+YATG+R+SE++ L    L+LT  T+   GKG+KER+V +   A+
Sbjct: 127 TGQVLGLRDRAMLELMYATGLRISEIINLKLEDLHLTMGTLQTLGKGHKERIVPVGDEAI 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +  Y +      +          +    +L+RQ   ++LKA   +AGIQ KNI+PH +
Sbjct: 187 KWVNRYLEEARPKLLKQKRSNYLFLNFHGNNLTRQGVWKNLKAEVRKAGIQ-KNITPHTL 245

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+H+LE GADLR +Q LLGH DISTTQIYTHL   +L  +    HP A
Sbjct: 246 RHSFATHILENGADLRIVQELLGHADISTTQIYTHLSNKQLADIYNRAHPRA 297


>gi|260583968|ref|ZP_05851716.1| tyrosine recombinase XerD [Granulicatella elegans ATCC 700633]
 gi|260158594|gb|EEW93662.1| tyrosine recombinase XerD [Granulicatella elegans ATCC 700633]
          Length = 297

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 160/294 (54%), Gaps = 9/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ +   S NT+ +Y+RDL +   FL  ++I        + ++ +L  L Q    TSS  
Sbjct: 12  LAIQ-GLSQNTVMSYQRDLMKFYQFLKEQQIRDWKEVDYSLIVLFLQDLKQDGYATSSTS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +++F+ FL  E L + NP   L++PKK+ +LPK L  D +  +L           
Sbjct: 71  RMISCLKKFFKFLQQEQLVETNPVQPLKVPKKSKMLPKALTVDEVTQVLNSC-------D 123

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++ELLYATGMRVSEL+TL    L+L    +   GKGNK+R++ +  +A 
Sbjct: 124 TSTVLGLRDKAMLELLYATGMRVSELITLKLSDLHLELGFLQTIGKGNKQRIIPIGQAAT 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           + +Q Y      +    ++   +      G+   +           +     K++SPH +
Sbjct: 184 NWVQHYLTYARVVLEQESNPVEYLFLNHRGNGFTRQGFWKNLKKIVQEAGVHKDVSPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH+FA+H+LE GADLR +Q LLGH+DISTTQIYTHL  ++++++ Q  HP AKK
Sbjct: 244 RHSFATHILEAGADLRIVQELLGHSDISTTQIYTHLTNERMKEIYQQAHPRAKK 297


>gi|47568147|ref|ZP_00238851.1| integrase/recombinase XerD [Bacillus cereus G9241]
 gi|222097540|ref|YP_002531597.1| site-specific tyrosine recombinase xerd [Bacillus cereus Q1]
 gi|47555137|gb|EAL13484.1| integrase/recombinase XerD [Bacillus cereus G9241]
 gi|221241598|gb|ACM14308.1| integrase/recombinase (tyrosine recombinase) [Bacillus cereus Q1]
          Length = 285

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 110/293 (37%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  S    +  H++++L HL +    + + 
Sbjct: 1   MVVEKGLAKNTVVSYERDLKSYVKYLQNVEQAKSFHEVTRLHIVNFLQHLKENGKSSKTL 60

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 61  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSVDEVEALLQTPKMTSAF- 119

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 120 ------GVRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 173

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 174 TEAIQKYIEKGRRELMGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 232

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 233 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 285


>gi|116629539|ref|YP_814711.1| integrase [Lactobacillus gasseri ATCC 33323]
 gi|238852689|ref|ZP_04643099.1| tyrosine recombinase XerD [Lactobacillus gasseri 202-4]
 gi|311110818|ref|ZP_07712215.1| tyrosine recombinase XerD [Lactobacillus gasseri MV-22]
 gi|116095121|gb|ABJ60273.1| tyrosine recombinase XerD subunit [Lactobacillus gasseri ATCC
           33323]
 gi|238834835|gb|EEQ27062.1| tyrosine recombinase XerD [Lactobacillus gasseri 202-4]
 gi|311065972|gb|EFQ46312.1| tyrosine recombinase XerD [Lactobacillus gasseri MV-22]
          Length = 302

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 94/292 (32%), Positives = 154/292 (52%), Gaps = 10/292 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT+ +Y+ DL+E  ++L ++  +        + ++L     +   T+S  R 
Sbjct: 19  QVERGLSPNTIISYRTDLEEYLDYLQDQNETSWEVDYLVVDAFLATQKDKGKATTSISRM 78

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           IS +R+FY +L  + + + +P   ++ PK    LP  L ++ +  LL             
Sbjct: 79  ISSLRKFYQWLLRQDIIERDPLVKIDSPKSERRLPTALSEEEVDKLLAAP-------DTN 131

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
               +R   ++E+LYATGMRVSEL+ L    ++   + + + GKG+KERLV ++  AL  
Sbjct: 132 TPLGIRDRAMLEVLYATGMRVSELINLRTGDIHADLKIIRVLGKGSKERLVPITEVALSW 191

Query: 183 LQMYKKTCS--SMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           L+ Y+       +  +G    +   +     L+RQ   + +K      GI  KN++PH +
Sbjct: 192 LEKYQTDVRDAQVLKSGQFTDVIFLNNHGHQLTRQAVWQKIKKYCQLIGIT-KNVTPHTL 250

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH FA+HLLE GADLR +Q +LGH+DI+TTQIYT+L    + ++    HP A
Sbjct: 251 RHTFATHLLENGADLRVVQEILGHSDITTTQIYTNLTQKHILEVYNQAHPRA 302


>gi|70726420|ref|YP_253334.1| site-specific recombinase [Staphylococcus haemolyticus JCSC1435]
 gi|82582338|sp|Q4L6J7|XERD_STAHJ RecName: Full=Tyrosine recombinase xerD
 gi|68447144|dbj|BAE04728.1| site-specific recombinase [Staphylococcus haemolyticus JCSC1435]
          Length = 295

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 98/293 (33%), Positives = 151/293 (51%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ Q ++  ++I  +       +   L  L  +     S 
Sbjct: 11  FIQIEKGLSENTIGAYRRDLKKYQLYMQEQKIAHIDFIDRQTIQECLGSLIDQGASAKSI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  +E PK    LP  L  + +  LLE         
Sbjct: 71  ARFISTIRSFHQFALREKYAAKDPTVLIETPKYEKKLPDVLDVEEVIQLLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRV+EL+ +    +NL    + + GKGNKER++ L  + 
Sbjct: 124 DLTKNNGYRDRTILELLYATGMRVTELIQIEIDDVNLIMGFVKVFGKGNKERIIPLGDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y     S  +      +   +     L+RQ   + +K    RA I  K ++PH 
Sbjct: 184 IEYLDTYINNVRSQLLKKTVTNVLFLNLHGRPLTRQGIWKLIKQYGLRANIN-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++++   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKTQIRQMYNQFHPRA 295


>gi|302389650|ref|YP_003825471.1| tyrosine recombinase XerC [Thermosediminibacter oceani DSM 16646]
 gi|302200278|gb|ADL07848.1| tyrosine recombinase XerC [Thermosediminibacter oceani DSM 16646]
          Length = 298

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 94/291 (32%), Positives = 146/291 (50%), Gaps = 13/291 (4%)

Query: 6   RASSINTLSAYKRDLKEMQNFLNNKEIS----LSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  S NTL AY  DL +   +L   +IS    L+  +   +  +L +L +      +  R
Sbjct: 17  KNQSPNTLKAYANDLGQFIEYLEQNKISKTKTLNDITHLDIRGFLAYLKESGASKKTIAR 76

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           K+S IR F+ +L  EGL  ++P+  ++  K    LP  L+   I  LL     +      
Sbjct: 77  KLSAIRSFFRYLSTEGLVSEDPTKMVQGMKLPKKLPLFLYPAEIEALLSAPGQD------ 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATGMRVSELV+L    +NL    +I+ GKG+KER+V     A  
Sbjct: 131 --VLGIRDRAIMELLYATGMRVSELVSLKLKDVNLGANFIIVFGKGSKERVVFFGSKAAE 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           +L+ Y +      +          +     L+ +   R +        +  K ISPH +R
Sbjct: 189 SLEEYLRKSRPYLVKNLTCDYLFLNKNGTRLTDRSVRRIIDKYVKLLSLNAK-ISPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H FA+H+L  GADL+T+Q LLGH  +STTQIYTH+  ++L+++     P +
Sbjct: 248 HTFATHMLNNGADLKTVQELLGHVSLSTTQIYTHVTKERLKEVYDKAFPHS 298


>gi|229086660|ref|ZP_04218828.1| Tyrosine recombinase xerD [Bacillus cereus Rock3-44]
 gi|228696607|gb|EEL49424.1| Tyrosine recombinase xerD [Bacillus cereus Rock3-44]
          Length = 296

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 105/293 (35%), Positives = 164/293 (55%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  +    +  H++++L +L +    + + 
Sbjct: 12  MIVEKGLAKNTVVSYERDLKSYVKYLQNVEQIKTFHEVTRIHIVNFLQYLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E + + +PS  +E P+    LPK L    +  LL+  K  +   
Sbjct: 72  ARHIASIRSFHQFLLRERVVEHDPSVHIETPQGERKLPKVLSVGEVEALLQTPKATSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GIRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      +    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQRYIEKGRRELVGKKTVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|152979420|ref|YP_001345049.1| site-specific tyrosine recombinase XerD [Actinobacillus
           succinogenes 130Z]
 gi|150841143|gb|ABR75114.1| tyrosine recombinase XerD [Actinobacillus succinogenes 130Z]
          Length = 297

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 102/288 (35%), Positives = 166/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           E+  S NT+ +Y+ DL  + ++LN   +SL +     L S+L    +     +S  R +S
Sbjct: 17  EKGLSENTIQSYRLDLAALCDWLNAHSLSLISLDAVDLQSFLGQRVEAGYKATSTARLLS 76

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            +R+ + +L  E  R D+PS TL  PK    LPK L +  + +LL          +    
Sbjct: 77  AMRKLFQYLYRENYRPDDPSATLSSPKLPTRLPKYLTEQQVNDLLSVP-------STDVP 129

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+LS   ++L++  + + GKGNKER+V +   A + + 
Sbjct: 130 LELRDKAMLELLYATGLRVTELVSLSMDNISLSQGVVRVIGKGNKERIVPMGEEAAYWVG 189

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +   +M + G    +   S +   ++RQ F   +K  A  A I   ++SPH++RHAF
Sbjct: 190 EFIRYGRAMLLNGQSSDVVFPSRRALQMTRQTFWHRIKYYAVLADIDGDSLSPHVLRHAF 249

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HL+  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L + +HP  
Sbjct: 250 ATHLVNHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKRLHEKFHPRG 297


>gi|206576348|ref|YP_002236649.1| tyrosine recombinase XerD [Klebsiella pneumoniae 342]
 gi|290511308|ref|ZP_06550677.1| tyrosine recombinase XerD [Klebsiella sp. 1_1_55]
 gi|206565406|gb|ACI07182.1| tyrosine recombinase XerD [Klebsiella pneumoniae 342]
 gi|289776301|gb|EFD84300.1| tyrosine recombinase XerD [Klebsiella sp. 1_1_55]
          Length = 298

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 111/291 (38%), Positives = 171/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L+++ +SL++  ++ L + L          +S  R
Sbjct: 15  LWLERNLAENTLSAYRRDLTMLVEWLHHRGLSLASVGSDDLQALLAERQTGGYKATSTAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+  L  E +R D+PS  L  PK    LPK L +  +  LL+   +E      
Sbjct: 75  LLSAVRRFFQHLYREKIRPDDPSALLASPKLPQRLPKDLSEAQVERLLQAPLVE------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A+ 
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVLRVIGKGNKERLVPLGEEAVM 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   S +   ++RQ F   +K  A  AGI    +SPH++R
Sbjct: 188 WVENYLEYGRPWLLNGVASDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSAKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|167763873|ref|ZP_02436000.1| hypothetical protein BACSTE_02254 [Bacteroides stercoris ATCC
           43183]
 gi|167697989|gb|EDS14568.1| hypothetical protein BACSTE_02254 [Bacteroides stercoris ATCC
           43183]
          Length = 316

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 102/298 (34%), Positives = 165/298 (55%), Gaps = 8/298 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+A S NTL AY  DL+++ +FL  + I +   + + L  +   L    +   SQ R
Sbjct: 24  LKLEKALSPNTLDAYMTDLQKLLHFLEGENIEIPDVTPDDLQRFAAGLHDIGIHPRSQAR 83

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S I+ F++FL     ++ +PS+ LE PK    LP+ L  + I  ++    +E      
Sbjct: 84  ILSGIKSFFHFLVIADYQEADPSELLEGPKIGFRLPEVLTVEEIDRIISTVDME------ 137

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            + +  R   ++E LY+ G+RVSEL  L    L   E  + ++GKG K+RLV +SP A+ 
Sbjct: 138 -KKEGQRNRAILETLYSCGLRVSELCNLKISDLYFEEGFIKVEGKGGKQRLVPISPRAIK 196

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ +    +  K+          +    ++SR +    +K LA +AGI  KNISPH  R
Sbjct: 197 EIKYWFADRNLGKIKKGYEDYVFLARWGNNISRIMVFHMIKELAEKAGIT-KNISPHTFR 255

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           H+FA+HLLEGGA+LR IQ +LGH  I+TT+IYTH+  ++L+  + ++HP   K +K +
Sbjct: 256 HSFATHLLEGGANLRAIQCMLGHESIATTEIYTHIDRNRLRSEIIEHHPRNIKYRKEH 313


>gi|227496090|ref|ZP_03926396.1| tyrosine recombinase [Actinomyces urogenitalis DSM 15434]
 gi|226834324|gb|EEH66707.1| tyrosine recombinase [Actinomyces urogenitalis DSM 15434]
          Length = 316

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 104/300 (34%), Positives = 157/300 (52%), Gaps = 14/300 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLS-----QRKLV 55
           +  ER  S NTL+AY+RDL     FL  + +  L+A +   + ++L  +       R L 
Sbjct: 22  LRVERGLSPNTLAAYERDLTRYCRFLLARGVQDLAAVTEADVAAFLEAIRTGDDGGRALA 81

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
            SS  R ++ +R ++ FL  EG    +PS  +  P+    LPK L  + +  LLE A  +
Sbjct: 82  ASSASRTVTAVRGWHKFLLDEGNTDVDPSAAVHPPQVGRRLPKALSVEEVQALLEAASTD 141

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
                    + +R   L+ELLYATG R+SE V L    L+     + + GKG KER+V +
Sbjct: 142 ------DSPRSLRDRALLELLYATGARISEAVGLVIDDLDRESGCIRLFGKGRKERIVPV 195

Query: 176 SPSALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ-KK 233
              A  AL  Y       +   G  +     +T    LSRQ     L+  +ARAG+   K
Sbjct: 196 GQYAWDALDAYLVQARPVLAAKGRGVPEVFLNTLGRPLSRQSAWGVLRQASARAGLGADK 255

Query: 234 NISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           ++SPH +RH+FA+HLL GGAD+R +Q +LGH  ++TTQIYT +  + L+++    HP A+
Sbjct: 256 HVSPHTLRHSFATHLLAGGADVRVVQEMLGHASVTTTQIYTKVTVEHLREVYATSHPRAR 315


>gi|78042632|ref|YP_360783.1| tyrosine recombinase XerD [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77994747|gb|ABB13646.1| tyrosine recombinase XerD [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 287

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 118/291 (40%), Positives = 167/291 (57%), Gaps = 12/291 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S+NTL +Y+RDL++  +FL  + IS+  A++  +  YL  L+ RKL  +S  R
Sbjct: 9   LLLEKGFSLNTLLSYRRDLEKFVSFLEKRNISIIDATSKDIKLYLQDLA-RKLKPASVAR 67

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ IR FY +L  E +  +NP+  ++ PK    LP+ L  + I  LL+           
Sbjct: 68  NLAAIRSFYKYLLREKIVGENPALDVDGPKLGLKLPEILSYEEIDLLLKAP-------DL 120

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
             W+ VR   ++ELLYATG+RVSELV L    L L ER + I GKG K R+V     A H
Sbjct: 121 STWEGVRDRAMLELLYATGLRVSELVNLELPNLYLDERYVKILGKGAKMRIVPFGEVAAH 180

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L  Y    +  K     L++     K    +RQ F + LK    +AGI  KN++PH+IR
Sbjct: 181 YLNQYLALRAKRKSNSLKLFITR---KGSGFTRQGFWKMLKRYGQKAGI-VKNLTPHLIR 236

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE GADLR +Q LLGH+ I TTQIYTHL   KL+++ +  HP A
Sbjct: 237 HSFATHLLENGADLRIVQELLGHSFIETTQIYTHLTTRKLREVFRKAHPRA 287


>gi|163792809|ref|ZP_02186786.1| integrase/recombinase XerD [alpha proteobacterium BAL199]
 gi|159182514|gb|EDP67023.1| integrase/recombinase XerD [alpha proteobacterium BAL199]
          Length = 314

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 123/293 (41%), Positives = 181/293 (61%), Gaps = 6/293 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MM++ER ++ NTL AY RDL   + +LN +  SL  A  + L +YL+      ++  +  
Sbjct: 20  MMAAERGAARNTLDAYGRDLMHAELWLNERGGSLETADVDGLRAYLSAAEAGGVMPRTAA 79

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S  RQF+ FL  EG R D+P+ TL+ P++   LPK L +  +  LL+ A        
Sbjct: 80  RRLSAQRQFFRFLYAEGRRADDPTATLDAPRRGRPLPKILSEADVDALLDAAC------D 133

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               + +R+  L+E+LYATG+RVSELV L    +      +I++GKG KER+V L+ +A+
Sbjct: 134 RPGPEGLRLICLLEVLYATGLRVSELVGLPFAAVARDPHVLIVRGKGGKERMVPLTAAAM 193

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  YK        T     LFPS +  GHL+R+ F + L   A  AGI    +SPH++
Sbjct: 194 DAIAAYKAVRGVFLTTKASPHLFPSRSAQGHLTRRRFGQLLDETAILAGIDPAKVSPHVL 253

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           RHAFA+HLL+ GADLR++Q +LGH DISTTQIYTH+L ++L+ LV+ +HPLA+
Sbjct: 254 RHAFATHLLDHGADLRSVQQMLGHADISTTQIYTHVLAERLRALVETHHPLAR 306


>gi|145634691|ref|ZP_01790400.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           PittAA]
 gi|145268236|gb|EDK08231.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           PittAA]
          Length = 297

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 97/289 (33%), Positives = 163/289 (56%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+  ++SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNDLSLETLDAVDLQGFLGERLEKGYKATSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  +++LL    +E        
Sbjct: 76  SAMRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTPDVEV------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + +      +   S +   ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFMLYGRPVLLNRQSSDVVFPSQRAQQMTRQTFWHRVKHYAILADIDADTLSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|228476153|ref|ZP_04060861.1| tyrosine recombinase XerD [Staphylococcus hominis SK119]
 gi|314936376|ref|ZP_07843723.1| tyrosine recombinase XerD [Staphylococcus hominis subsp. hominis
           C80]
 gi|228269976|gb|EEK11456.1| tyrosine recombinase XerD [Staphylococcus hominis SK119]
 gi|313654995|gb|EFS18740.1| tyrosine recombinase XerD [Staphylococcus hominis subsp. hominis
           C80]
          Length = 295

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 95/293 (32%), Positives = 151/293 (51%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDL + + ++   +I  +       +   L +L  +     S 
Sbjct: 11  FIQIEKGLSDNTIGAYRRDLAKYEEYMKEHKIAHIDFIDRQVIQECLGYLIDQGASAKSM 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  +E PK    LP  L  + +  LLE         
Sbjct: 71  ARFISTIRNFHQFALREKYAAKDPTVLIETPKYEKKLPDVLEVEEVLQLLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSEL+ ++   +NL    + + GKGNKER++ L  + 
Sbjct: 124 DLNKKNGYRDRTILELLYATGMRVSELIQINIEDINLIMGFVRVFGKGNKERIIPLGDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +      +      +   +     L+RQ   + +K    +A I  K ++PH 
Sbjct: 184 IEFLDTYLEKVRPQLLKKTITNVLFLNMHGRPLTRQGIWKMIKQYGLKANIN-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++++   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRQMYNQFHPRA 295


>gi|218778680|ref|YP_002429998.1| tyrosine recombinase XerD [Desulfatibacillum alkenivorans AK-01]
 gi|218760064|gb|ACL02530.1| tyrosine recombinase XerD [Desulfatibacillum alkenivorans AK-01]
          Length = 298

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 158/291 (54%), Gaps = 9/291 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+  S NTL AY +DL    +FL  ++I  L+ A T  ++ +L  L  + L   ++ 
Sbjct: 15  LLVEKGLSQNTLEAYGKDLGVFTDFLQKRKIDDLTKADTPDIVQHLIDLRAQGLGARTRA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +  IR  ++FL  E + K NP+  ++LPK    LP  +    I  LLE          
Sbjct: 75  RHLVAIRGLFSFLEQEKIIKHNPAKLVDLPKTGLHLPDVISVVEIEQLLEAPNEM----- 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   ++EL YA+G+RVSEL+ +    ++L    + + GKG+KER+V +   A 
Sbjct: 130 --DILGARDRAMMELAYASGLRVSELINVRVQDIHLDAGFVRVMGKGSKERIVPMGRQAR 187

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             ++ Y      + + G              ++RQ F + LK  A +AGI  KNI+PH +
Sbjct: 188 EKIKTYMDHDRPILLKGKPGEYLFVVRGGRPMTRQAFWKLLKKYALKAGI-AKNITPHTL 246

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           RH+FASHLLEGGADLR +Q +LGH DISTTQIYTH+  ++L ++ + YHP 
Sbjct: 247 RHSFASHLLEGGADLRVVQEMLGHVDISTTQIYTHVARERLIEIHERYHPR 297


>gi|308174137|ref|YP_003920842.1| site-specific tyrosine recombinase [Bacillus amyloliquefaciens DSM
           7]
 gi|307607001|emb|CBI43372.1| site-specific tyrosine recombinase for chromosome partitioning
           [Bacillus amyloliquefaciens DSM 7]
 gi|328554079|gb|AEB24571.1| site-specific tyrosine recombinase XerD [Bacillus amyloliquefaciens
           TA208]
 gi|328912472|gb|AEB64068.1| site-specific tyrosine recombinase for chromosome partitioning
           [Bacillus amyloliquefaciens LL3]
          Length = 296

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 161/292 (55%), Gaps = 10/292 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNN--KEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
             ER  S NT+ +Y+RDLK    FL    +  S +  +  H+I YL HL        +  
Sbjct: 13  RVERGLSQNTMMSYERDLKSYSLFLTETLQITSWNDVTRLHIIQYLKHLKDSGKSGKTSA 72

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ IR F+ FL  E     +PS  +E  K    LPK L    +  LL+  K+++    
Sbjct: 73  RHLASIRSFHQFLLREKAADKDPSVHIETQKTERALPKVLALQEVERLLDTPKLDSPF-- 130

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++ELLYATG+RVSE++ L    ++LT   +   GKG KER+V +  +A 
Sbjct: 131 -----GLRDKAMLELLYATGIRVSEMIELKLSDVHLTMGFVRCFGKGRKERIVPIGEAAS 185

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           HA++ Y +      +  N       +     +SRQ F ++LK +A  AGI KK ++PH +
Sbjct: 186 HAIEAYIEKARGKLLKKNVTEALFLNHHGRQISRQGFWKNLKKIALEAGI-KKELTPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + YHP A
Sbjct: 245 RHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQYHPRA 296


>gi|227890931|ref|ZP_04008736.1| site-specific DNA tyrosine recombinase, XerD [Lactobacillus
           salivarius ATCC 11741]
 gi|227867340|gb|EEJ74761.1| site-specific DNA tyrosine recombinase, XerD [Lactobacillus
           salivarius ATCC 11741]
          Length = 290

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 105/292 (35%), Positives = 159/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+++Y  DLK    +L   EI S    +   +++Y+          SS  
Sbjct: 7   LKVERGLSENTINSYGIDLKLFLEYLRENEIPSFKQVNKEVIVNYMQAEKNNNKANSSIL 66

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R+F+ +L  E + + +P   ++ PKK   LP+ L K+ +  LL           
Sbjct: 67  RSVSSLRKFFQYLAQEKIIEKDPMLLIDTPKKKQHLPQVLTKEEVEKLLHSPN------- 119

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            GQ   +R   ++EL+YATG+R+SE++ L    L+LT  T+   GKG+KER+V +   A+
Sbjct: 120 TGQVLGLRDRAMLELMYATGLRISEIINLKLEDLHLTMGTLQTLGKGHKERIVPVGDEAI 179

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +  Y +      +          +    +L+RQ   ++LKA   +AGIQ KNI+PH +
Sbjct: 180 KWVNRYLEEARPKLLKQKRSNYLFLNFHGNNLTRQGVWKNLKAEVRKAGIQ-KNITPHTL 238

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+H+LE GADLR +Q LLGH DISTTQIYTHL   +L  +    HP A
Sbjct: 239 RHSFATHILENGADLRIVQELLGHADISTTQIYTHLSNKQLTDIYNRAHPRA 290


>gi|227889862|ref|ZP_04007667.1| integrase-recombinase [Lactobacillus johnsonii ATCC 33200]
 gi|227849726|gb|EEJ59812.1| integrase-recombinase [Lactobacillus johnsonii ATCC 33200]
          Length = 296

 Score =  192 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 95/292 (32%), Positives = 156/292 (53%), Gaps = 10/292 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT+ +Y+ DL+E  ++L ++  +        + S+L     +   T+S  R 
Sbjct: 13  QVERGLSPNTIVSYRTDLEEYLSYLEDQNETSWEVDYLVVDSFLATQKDKGKATTSISRM 72

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           IS +R+FY +L  + + + +P   ++ PK    LP  L ++ +  LL+            
Sbjct: 73  ISSLRKFYQWLLRQDIIERDPLVKIDSPKSERRLPTALSEEEVTKLLDAP-------DTN 125

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
               +R   ++E+LYATGMRVSEL+ L    ++   + + + GKG+KERLV ++  AL  
Sbjct: 126 TSLGIRDRAMLEVLYATGMRVSELINLRTGDIHSELKIIRVLGKGSKERLVPITEVALSW 185

Query: 183 LQMYKKTCSSMKMTGNDLWLF--PSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           L+ Y+K     ++  +  +      +     L+RQ   + +K      GI  KN++PH +
Sbjct: 186 LEKYQKDVRENQVLKSGQFTDVIFLNNHGHQLTRQAVWQKIKKYCQLIGIT-KNVTPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH FA+HLLE GADLR +Q +LGH+DI+TTQIYT+L    + ++    HP A
Sbjct: 245 RHTFATHLLENGADLRVVQEILGHSDITTTQIYTNLTQKHILEVYNQAHPRA 296


>gi|222087381|ref|YP_002545918.1| tyrosine site-specific integrase/recombinase protein [Agrobacterium
           radiobacter K84]
 gi|221724829|gb|ACM27985.1| tyrosine site-specific integrase/recombinase protein [Agrobacterium
           radiobacter K84]
          Length = 319

 Score =  192 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 160/304 (52%), Positives = 219/304 (72%), Gaps = 5/304 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER +++NTL +Y+RDL ++ +FL+ + + L+ A +N L +YL+ LS++    SSQ 
Sbjct: 16  MMSAERGAAVNTLQSYERDLDDLHSFLSERSVRLTEAGSNDLGAYLSGLSRQGFKPSSQA 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQFY FL  EGLR D+P+  L+ PKK   LPKT+  + +  LL QA+ EA   +
Sbjct: 76  RRLSAMRQFYKFLYAEGLRTDDPTGILDAPKKGRALPKTMGVEEVTRLLTQAEKEAAEES 135

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           P Q +R+R+ +L+ELLYATGMRVSELVTL A  L+   R ++I+GKGNKERLV LS SA+
Sbjct: 136 PDQLQRLRMLVLLELLYATGMRVSELVTLPAKVLDQEGRFLMIRGKGNKERLVPLSQSAI 195

Query: 181 HALQMY-----KKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
            AL+ Y     +   ++ +      WLFP+++K G+L RQVFARDLK LA RAG+    I
Sbjct: 196 AALKTYGKLQTQVAANTKQPAPESAWLFPAASKQGYLPRQVFARDLKDLAIRAGLTPSLI 255

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           SPH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH+L ++L +LVQ +HPLAK+ 
Sbjct: 256 SPHVMRHAFASHLLANGADLRVVQELLGHSDISTTQIYTHVLEERLHQLVQMHHPLAKQG 315

Query: 296 KKHY 299
           KK  
Sbjct: 316 KKQE 319


>gi|268319602|ref|YP_003293258.1| tyrosine recombinase xerD [Lactobacillus johnsonii FI9785]
 gi|262397977|emb|CAX66991.1| tyrosine recombinase xerD [Lactobacillus johnsonii FI9785]
          Length = 302

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 94/292 (32%), Positives = 155/292 (53%), Gaps = 10/292 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT+ +Y+ DL+E  ++L ++           + ++L     +   T+S  R 
Sbjct: 19  QVERGLSPNTIVSYRTDLEEYLSYLEDQNEKSWEVDYLVVDAFLATQKDKGKATTSISRM 78

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           IS +R+FY +L  + + + +P   ++ PK    LP  L ++ +  LL+            
Sbjct: 79  ISSLRKFYQWLLRQDIIERDPLVKIDSPKSERRLPTALSEEEVTKLLDAP-------DTN 131

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
               +R   ++E+LYATGMRVSEL+ L    ++   + + + GKG+KERLV ++  AL  
Sbjct: 132 TRLGIRDRAMLEVLYATGMRVSELINLRTGDIHSELKIIRVLGKGSKERLVPITEVALSW 191

Query: 183 LQMYKKTCSSMKMTGNDLWLF--PSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           L+ Y+K     ++  +  +      +     L+RQ   + +K      GI  KN++PH +
Sbjct: 192 LEKYQKDVRENQVLKSGQFTDVIFLNNHGHQLTRQAVWQKIKKYCQLIGIT-KNVTPHTL 250

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH FA+HLLE GADLR +Q +LGH+DI+TTQIYT+L    + ++    HP A
Sbjct: 251 RHTFATHLLENGADLRVVQEILGHSDITTTQIYTNLTQKHILEVYNQAHPRA 302


>gi|114566153|ref|YP_753307.1| recombinase [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
 gi|114337088|gb|ABI67936.1| tyrosine recombinase XerD subunit [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 296

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 104/293 (35%), Positives = 162/293 (55%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNN--KEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           ++ E+  + N+  AYKRDL + Q FL    + +S    S + ++++L     +    SS 
Sbjct: 12  LNFEKGLAANSRIAYKRDLLKFQQFLQENSRALSPQNISKHDIMAFLAWQLDQGAAHSSI 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R +S I+ +Y FL  EG    NPS  LE PK    LP+ L  + +  L+EQ        
Sbjct: 72  ARSLSSIKSYYKFLILEGELDKNPSSDLETPKIKRKLPQVLSIEEVDKLMEQPN------ 125

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
            P     +R   ++EL+Y TG+RVSEL++L    LN T   +   GKG KER++ ++ ++
Sbjct: 126 -PVVPLGIRDRAMLELMYGTGIRVSELLSLQVEDLNPTAGFLRCMGKGRKERIIPVNQTS 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  +Q Y     +  +          + +   LSRQ F + L     +A ++K+ ++PH 
Sbjct: 185 IDWVQRYLARVRNSLVKNPLERTLFLNARGRPLSRQGFFKILGNYVEKAELEKE-VTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTHL   +L+++ Q YHP +
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHLTKSRLREVYQQYHPRS 296


>gi|323489648|ref|ZP_08094875.1| tyrosine recombinase xerD [Planococcus donghaensis MPA1U2]
 gi|323396779|gb|EGA89598.1| tyrosine recombinase xerD [Planococcus donghaensis MPA1U2]
          Length = 300

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 108/295 (36%), Positives = 166/295 (56%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI--SLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  + NTLS+Y+RDLK    +L   E   SL      H++++L HL +      +
Sbjct: 14  FLRVERQLADNTLSSYERDLKVYLQYLKEVEQLESLKKVERVHILNHLRHLKETTKTPRT 73

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R IS IR F+ F+  E + + +P+  LE+P+ +  LP  L  + +  L++        
Sbjct: 74  VARHISSIRSFHQFMIRERIVETDPTVHLEMPQMDKKLPNILSIEEVDALIQVP------ 127

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
            A  +   +R   ++ELLYA+GMRVSE + L    ++LT   +   GKG KER++ L  S
Sbjct: 128 -ATNKANGLRDQAMLELLYASGMRVSECINLDIEDVHLTMGFVRCTGKGGKERIIPLGKS 186

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           AL + Q Y +     +  +G        + +   L+RQ F + LK  A +AGIQK+ ++P
Sbjct: 187 ALTSCQTYLEQGRIDLVKSGEKTDALFINQRGKRLTRQGFWKLLKQHAQKAGIQKE-LTP 245

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GAD+R +Q +LGH DISTTQIYTH+   +L+ +   +HP A
Sbjct: 246 HTLRHSFATHLLENGADIRAVQEMLGHADISTTQIYTHVSKTRLKDVYSQFHPRA 300


>gi|288933626|ref|YP_003437685.1| tyrosine recombinase XerD [Klebsiella variicola At-22]
 gi|288888355|gb|ADC56673.1| tyrosine recombinase XerD [Klebsiella variicola At-22]
          Length = 298

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 112/291 (38%), Positives = 171/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L+++ +SL++  ++ L + L          +S  R
Sbjct: 15  LWLERNLAENTLSAYRRDLTMLVEWLHHRGLSLASVGSDDLQALLAERQTGGYKATSTAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            IS +R+F+  L  E +R D+PS  L  PK    LPK L +  +  LL+   +E      
Sbjct: 75  LISAVRRFFQHLYREKIRPDDPSALLASPKLPQRLPKDLSEAQVERLLQAPLVE------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A+ 
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVLRVIGKGNKERLVPLGEEAVM 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   S +   ++RQ F   +K  A  AGI    +SPH++R
Sbjct: 188 WVENYLEYGRPWLLNGVASDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSAKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|332799166|ref|YP_004460665.1| Tyrosine recombinase xerC [Tepidanaerobacter sp. Re1]
 gi|332696901|gb|AEE91358.1| Tyrosine recombinase xerC [Tepidanaerobacter sp. Re1]
          Length = 300

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 95/295 (32%), Positives = 153/295 (51%), Gaps = 12/295 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS---LSAASTNHLISYLNHLSQRKLVTSS 58
           + + + +S NT+ AY  DL +   +L  K++S   L  A+  H+  +L +L ++K+   +
Sbjct: 13  LRATKTASQNTIKAYSEDLSQFLEYLKQKKLSEPILVNATHLHIRGFLAYLQEKKISKRT 72

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             RK+S +R FY +L  EG  ++N + ++  PK +  LP  L+   I  LL         
Sbjct: 73  AARKLSALRSFYKYLVVEGFVQENIAKSISTPKTSKKLPLFLYPGEIEVLLSAP------ 126

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++ELLYATGMRV ELV L    +N     +I+ GKG+KER+V     
Sbjct: 127 --KNDVLGIRDKAIMELLYATGMRVGELVLLKTSDINFGSNYIIVFGKGSKERVVFFGQK 184

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A  +L+ Y K          +      +     +S +   R +      A +  + +SPH
Sbjct: 185 AEESLEKYLKESRPFLTKDINCDSLFLNKNGTAISARSIRRIIDKYVKIATLNSE-VSPH 243

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
            +RH FA+H+L  GADL+T+Q LLGH+ +STTQIYTH+  ++L+++     P  K
Sbjct: 244 TLRHTFATHMLNNGADLKTVQELLGHSSLSTTQIYTHVTKERLKEVYDKTFPHNK 298


>gi|206900840|ref|YP_002251182.1| tyrosine recombinase XerD [Dictyoglomus thermophilum H-6-12]
 gi|206739943|gb|ACI19001.1| tyrosine recombinase XerD [Dictyoglomus thermophilum H-6-12]
          Length = 296

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 106/296 (35%), Positives = 157/296 (53%), Gaps = 11/296 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S  T+ +Y+RDL++  NFL  + I++          YL  L ++     S  R
Sbjct: 12  LKFEKNMSSATIDSYRRDLEDFINFLQKEGINIKNLKREEWQRYLVALYKK-YKIKSIAR 70

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           KIS IR F  FL  EG    N S+ + +PK    LP+ L    I + L+        P P
Sbjct: 71  KISSIRSFIKFLLREGYINKNYSNFMLIPKIPMYLPEVLDPKEIESFLK-------IPDP 123

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E  YATG+RVSELV L+   ++L E+ +   GKG KER+V L   A+ 
Sbjct: 124 LSPLGIRNMAILETFYATGIRVSELVNLNIQNVDLEEKYVRCFGKGEKERIVPLGDYAVE 183

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           +L+ Y            +      + K   ++RQ     +KA +   G+ KK +SPH  R
Sbjct: 184 SLKRYLSVRHLFNPKDKEA--LFLNKKGERITRQGVWFIIKAYSKILGLPKK-VSPHTFR 240

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           H+FA+HLL  GAD+R +Q LLGH+DI+TTQIYTH++  KL ++ Q  HPL ++  K
Sbjct: 241 HSFATHLLSNGADIRIVQELLGHSDIATTQIYTHIVSSKLHEVYQRAHPLMRRNTK 296


>gi|116492850|ref|YP_804585.1| tyrosine recombinase XerD subunit [Pediococcus pentosaceus ATCC
           25745]
 gi|116103000|gb|ABJ68143.1| tyrosine recombinase XerD subunit [Pediococcus pentosaceus ATCC
           25745]
          Length = 295

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 99/292 (33%), Positives = 159/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+ +Y+++L+ + ++L  ++I  +       ++ YL+ L +     SS  
Sbjct: 12  LKVERGLSDNTIISYRQELRHLNDYLTKEKITDIKKIDRYAILDYLDELKKTGRARSSSI 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
             IS +R+F+ +L        +P   ++ PK+ H LP  L    +  LL+          
Sbjct: 72  HTISSLRKFFKYLLIVDKIDVDPMVNIDPPKRAHHLPSVLTTAEVEKLLQVPN------- 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATG+RVSEL+TL+ + L+L    +   GKGNK+R++ +   A+
Sbjct: 125 TNEPLGMRDRTILEVMYATGLRVSELITLNLNELHLEMGLIETIGKGNKKRIIPIGDVAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L  Y      + +          +     L+RQ   ++LKA   +AGI+ KNI+PH +
Sbjct: 185 KWLNRYINGPRRILLGDKKYNEIFLNQHGHPLTRQGIWKNLKAQVKKAGIE-KNITPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   +L  +   YHP A
Sbjct: 244 RHSFATHLLENGADLRIVQELLGHADISTTQIYTHITQQRLVDVYDKYHPRA 295


>gi|73662564|ref|YP_301345.1| site-specific recombinase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82582339|sp|Q49XU5|XERD_STAS1 RecName: Full=Tyrosine recombinase xerD
 gi|72495079|dbj|BAE18400.1| site-specific recombinase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 295

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 104/293 (35%), Positives = 157/293 (53%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+   FL  ++IS +       +   L +L        S 
Sbjct: 11  FIQLEKGLSSNTIGAYRRDLKKYNTFLELQKISHIDFIDRASIQQCLGYLHDNGASAKSL 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  +E PK +  LP  L  + +  LLE   +     
Sbjct: 71  ARFISTIRSFHQFALREKYAAKDPTVLIETPKYDRKLPDVLEINEVLALLETPNL----- 125

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSEL+ +    +NL    + + GKGNKER+V L  + 
Sbjct: 126 --AKINGYRDRTMLELLYATGMRVSELIQIELEDVNLIMGFVKVFGKGNKERIVPLGDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L+ Y +T     +          +     LSRQ   + +K  A +A I  K+++PH 
Sbjct: 184 IEYLKTYIETIRPQLLKKTVTNTLFLNMHGKPLSRQAIWKMIKQNAIKANIT-KSLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+  ++HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNEFHPRA 295


>gi|292487142|ref|YP_003530012.1| tyrosine recombinase xerD [Erwinia amylovora CFBP1430]
 gi|292900477|ref|YP_003539846.1| integrase/recombinase [Erwinia amylovora ATCC 49946]
 gi|291200325|emb|CBJ47453.1| integrase/recombinase [Erwinia amylovora ATCC 49946]
 gi|291552559|emb|CBA19604.1| Tyrosine recombinase xerD [Erwinia amylovora CFBP1430]
 gi|312171246|emb|CBX79505.1| Tyrosine recombinase xerD [Erwinia amylovora ATCC BAA-2158]
          Length = 297

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 171/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NT+ +Y+ DL+ + ++L ++++SL      +L  +L    +     SS  R
Sbjct: 14  LWIERNLAQNTVDSYRLDLRSLGDWLAHQQLSLLNVEVANLQEFLAQRLEGGYKASSSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR D+PS  L  PK    LPK L +  +  LL+   ++      
Sbjct: 74  LLSAMRRLFQYLYREKLRDDDPSALLSSPKLPQRLPKDLSEAQVERLLQAPCLDL----- 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RV+ELV L+   ++L +  + + GKGNKERLV +   A+H
Sbjct: 129 --PIELRDKAMLELLYATGLRVTELVGLTLSDISLRQGVVRVMGKGNKERLVPMGEEAVH 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ + +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 187 WIEQFIEYGRPWLLNGQTIDVLFPSNRAKQMTRQTFWHRIKHYATLAGIDSEKLSPHVLR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 247 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 297


>gi|238754564|ref|ZP_04615918.1| Tyrosine recombinase xerD [Yersinia ruckeri ATCC 29473]
 gi|238707195|gb|EEP99558.1| Tyrosine recombinase xerD [Yersinia ruckeri ATCC 29473]
          Length = 299

 Score =  191 bits (485), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL+ +  +L     SL  A    L S+L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLQALAGWLQRHNKSLLLADPLDLQSFLAERIEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+ +L  E LR+D+P+  L  PK    LPK L +  +  LL    ++      
Sbjct: 76  LLSAMRRFFQYLYREKLREDDPTALLSSPKLPQRLPKDLSEAQVDALLNSPNVDI----- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 131 --PLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYMEYGRPWLINGQALDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|206890528|ref|YP_002247908.1| tyrosine recombinase XerD [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742466|gb|ACI21523.1| tyrosine recombinase XerD [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 294

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 98/292 (33%), Positives = 170/292 (58%), Gaps = 11/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           + +E+A SINT+ +Y+ DLK    +L  + I +     + ++ YL +L ++   ++S  R
Sbjct: 14  LLTEKALSINTVKSYENDLKNFLKWLTEQNILVLNCKKDDIVQYLLNLKEKAYSSTSIAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S ++QF+ F+ ++ +   +P++ L+ PK    LPK L  D +  LL            
Sbjct: 74  ILSSLKQFFRFMIFDSIINHDPTEGLKSPKLWLRLPKALEIDEVKRLLSVMLESKYY--- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++EL+YA+G+RVSELV L    +N     + ++GKG+KER+V ++  ++ 
Sbjct: 131 -----LRDIAMLELMYASGLRVSELVRLKLSDINFEAGFIRVKGKGDKERVVPIAQRSID 185

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y      + +          + +   ++RQ F +++KA+   AG+    ++PH+IR
Sbjct: 186 KIKNYLVKLRPVLLKKKASEYVFLNNRGQPMTRQRFWQNIKAIGRIAGVN---VTPHMIR 242

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           H+FA+HLLEGGADLR++Q +LGH+DISTTQIYT +  D+L+K    +HP AK
Sbjct: 243 HSFATHLLEGGADLRSLQKMLGHSDISTTQIYTKVSMDRLRKEYLKHHPRAK 294


>gi|320540116|ref|ZP_08039771.1| site-specific tyrosine recombinase [Serratia symbiotica str.
           Tucson]
 gi|320029782|gb|EFW11806.1| site-specific tyrosine recombinase [Serratia symbiotica str.
           Tucson]
          Length = 299

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL +Y+ DL+ +  +LN++ I+L  A    L ++L          +S  R
Sbjct: 16  LWLERNLAENTLVSYRLDLQALVAWLNHQNITLLQAQALDLQAFLAERVDGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR D+P+  L  PK    LPK L +  I  LL+   ++      
Sbjct: 76  LLSAMRRLFQYLYREKLRADDPTTRLASPKLPQRLPKDLSEAQIDALLKAPCVD------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPIELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      +    L +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYLEHGRPWLVNSQALDVLFPSQRCQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|229846398|ref|ZP_04466506.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           7P49H1]
 gi|229810491|gb|EEP46209.1| site-specific tyrosine recombinase XerD [Haemophilus influenzae
           7P49H1]
          Length = 297

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 96/289 (33%), Positives = 163/289 (56%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L+  ++SL       L  +L    ++    +S  R +
Sbjct: 16  IEKGLSENTVQSYRLDLTALCDWLDKNDLSLETLDAVDLQGFLGERLEKGYKVTSTARML 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  +++LL    ++        
Sbjct: 76  SAMRKLFQYLYREKYRVDDPSAVLSSPKLPSRLPKYLTEQQVSDLLNTPDVDV------- 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELV+L+   +++ +  + + GKGNKER+V +   A + +
Sbjct: 129 PLELRDKAMLELLYATGLRVTELVSLTIENMSVQQGVVRVIGKGNKERIVPMGEEAAYWV 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + +      + +      +   S +   ++RQ F   +K  A  A I    +SPH++RHA
Sbjct: 189 RQFMLYGRPVLLNRQSSDVVFPSQRAQQMTRQTFWHRVKHYAILADIDADALSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGHTD+STTQIYTH+  ++L++L + +HP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHTDLSTTQIYTHVAKERLKRLHERFHPRG 297


>gi|53802409|ref|YP_112927.1| tyrosine recombinase XerD [Methylococcus capsulatus str. Bath]
 gi|53756170|gb|AAU90461.1| tyrosine recombinase XerD [Methylococcus capsulatus str. Bath]
          Length = 309

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 104/292 (35%), Positives = 156/292 (53%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN-NKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E   S +TL AY  DL+    +L  N+   L+A +   + +YL     RK  + +  
Sbjct: 26  LWVEEGLSPHTLKAYGSDLRLFAAWLATNRCAELTALTGEDIEAYLGWRHSRKSKSRTSA 85

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S IR F  +    G    +P   +  PK    LP TL +  +  LL    ++     
Sbjct: 86  RVLSSIRHFCAYRLRRGEITGDPCALIAPPKLGRFLPDTLTESEVEALLAAPDVD----- 140

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   ++E+LYATG+RVSELV LS   ++L +  + I GKG+K+RLV +   AL
Sbjct: 141 --TPLGFRDRAMLEMLYATGLRVSELVGLSFGQISLRQGVVRISGKGDKDRLVPVGEEAL 198

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y      + + G        + + G ++RQ F   +K  A +AGI K  +SPH +
Sbjct: 199 DWLERYLDKVRPVTLKGRQSDFLFVTDRGGAMTRQAFWHLIKRYAGQAGISKP-LSPHTL 257

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RHAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L   +HP  
Sbjct: 258 RHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVAQERLKELHTRFHPRG 309


>gi|196034794|ref|ZP_03102201.1| integrase/recombinase XerD [Bacillus cereus W]
 gi|195992333|gb|EDX56294.1| integrase/recombinase XerD [Bacillus cereus W]
          Length = 296

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 110/293 (37%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  S    +  H++++L HL +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYVKYLQKVEQAKSFHEVTRLHIVNFLQHLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSVDEVEALLQTPKMTSVF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GVRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCVGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|289550957|ref|YP_003471861.1| Site-specific tyrosine recombinase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315658459|ref|ZP_07911331.1| tyrosine recombinase XerC [Staphylococcus lugdunensis M23590]
 gi|289180489|gb|ADC87734.1| Site-specific tyrosine recombinase [Staphylococcus lugdunensis
           HKU09-01]
 gi|315496788|gb|EFU85111.1| tyrosine recombinase XerC [Staphylococcus lugdunensis M23590]
          Length = 297

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 100/296 (33%), Positives = 155/296 (52%), Gaps = 10/296 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S +T+ +Y  DL +   FL  + ++LS        +YL++L  + L  ++  
Sbjct: 11  MLKVERNFSDHTIKSYHDDLMQFNEFLAQEMLTLSTFEYKDARNYLSYLYNKNLKRTTVS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY +   +     NP   L  PKK   LP+  ++  +  L E    +A+   
Sbjct: 71  RKISTLRSFYEYWMTQDETVINPFVQLVHPKKEQYLPQFFYEAEMDALFETVLHDAK--- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  +++ELLY+TGMRVSELV +    ++LT   + + GKG+KER +       
Sbjct: 128 ----KGLRDRVILELLYSTGMRVSELVHIKKMDIDLTLPGVKVLGKGSKERFLPFGEFCK 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y      +K   +  +L  +        R V       +   AG+    I PH +
Sbjct: 184 QSIEQYLLEFGPVKQ-NDHPFLLVNMNGQPITERGVRYVLNDIVKRTAGVTD--IHPHKL 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+  D+L+K+  + HP AKKE+
Sbjct: 241 RHTFATHLLNQGADLRTVQSLLGHVNLSTTGRYTHVSKDQLRKVYLNAHPRAKKER 296


>gi|300024678|ref|YP_003757289.1| tyrosine recombinase XerD [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526499|gb|ADJ24968.1| tyrosine recombinase XerD [Hyphomicrobium denitrificans ATCC 51888]
          Length = 309

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 129/296 (43%), Positives = 188/296 (63%), Gaps = 4/296 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER +S NT+ AY+ DL+   ++L++  ++  +  T ++  Y+  ++      +S+ 
Sbjct: 17  MLTAERGASPNTIEAYRGDLEGFLDYLSDGSVAPLSVGTQNIQGYIAAMANAGQAPTSRS 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S I+Q+Y FL  EGL   +P+  L+ PKK   LPK L    +  LL+ ++   E   
Sbjct: 77  RRLSAIKQYYRFLFAEGLIGADPTSGLQGPKKQRSLPKVLSIAEVDRLLDASQKRCEGVE 136

Query: 121 -PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
               ++ +R   L+ELLYATGMRVSELV L    L   +R   I+GKG +ERLV L+  A
Sbjct: 137 GRAMFRALRFHCLLELLYATGMRVSELVGLPRTVLRGDKRVFSIKGKGGRERLVPLNAEA 196

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             AL  + +         N  WLFPS + +GH++RQ FA+DLK +AA AGI    ISPH+
Sbjct: 197 RAALDRFLEVSGRF---DNSPWLFPSKSASGHMTRQRFAQDLKDVAAEAGIGGDRISPHV 253

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           +RHAFASHLL+ GADLRT+Q LLGH DISTT+IYTH+L ++L+ LV  +HPLAK +
Sbjct: 254 LRHAFASHLLDRGADLRTVQQLLGHADISTTEIYTHVLQERLKALVNTHHPLAKTK 309


>gi|323137229|ref|ZP_08072308.1| integrase family protein [Methylocystis sp. ATCC 49242]
 gi|322397587|gb|EFY00110.1| integrase family protein [Methylocystis sp. ATCC 49242]
          Length = 316

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 118/296 (39%), Positives = 180/296 (60%), Gaps = 4/296 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER ++ NT  AY+RDL +  +FL  +  +    +++ + +YL  L  R +  ++  
Sbjct: 15  MLAAERGAAQNTQDAYRRDLADYIDFLRGQGTNPDDVTSDGVRAYLASLEPRGMSAATVA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKI---EAE 117
           R+IS IRQF+ FL  +  R D+P+  LE P++    P  +    +  LL  A+    + +
Sbjct: 75  RRISAIRQFHKFLYVDRHRGDDPAAALEGPRRVRSAPGVMSVAEVDRLLSVAREGLDDEK 134

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
            P   + +  R++ L+E LYATG+RVSELV+L        +  + I+GKG +ERL  L+ 
Sbjct: 135 RPLRERLRAARLYALLETLYATGLRVSELVSLPKSAARARDPFITIRGKGGRERLAPLTD 194

Query: 178 SALHALQMYKKTCSSMKMT-GNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            A  AL  Y+K   +         +LFP+ + +GHL+RQ FARDLK L   AG+    + 
Sbjct: 195 RAKSALADYRKLLDATAPGLAEGPFLFPADSDSGHLTRQAFARDLKMLGVVAGLSAAQVH 254

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           PH +RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++++ +V+D HPL+
Sbjct: 255 PHALRHAFASHLLQNGADLRVVQELLGHADISTTQIYTHVLDERMRAMVRDLHPLS 310


>gi|261868581|ref|YP_003256503.1| site-specific tyrosine recombinase XerD [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413913|gb|ACX83284.1| tyrosine recombinase XerD [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 297

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 100/287 (34%), Positives = 163/287 (56%), Gaps = 7/287 (2%)

Query: 6   RASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKISV 65
           +  S NT+ +Y+ DL  + ++L  + +SL       L ++L    ++    +S  R +S 
Sbjct: 18  KGLSPNTVESYRLDLTALCDWLEARHLSLLGLDAVDLQAFLGERVEQGYKATSTARLLSA 77

Query: 66  IRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQWK 125
           +R+ + +L  E  R D+PS  L  PK    LPK L +  + +LL          +  Q  
Sbjct: 78  MRKLFQYLYQEKYRTDDPSAVLSSPKLPSRLPKYLTEQQVTDLLNV-------QSLEQPI 130

Query: 126 RVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQM 185
            +R   ++ELLYATG+RV+ELV+L+  ++NL +  + + GKG KER+V +   A H ++ 
Sbjct: 131 ELRDKAMLELLYATGLRVTELVSLNTDSINLNQGVVRVIGKGKKERIVPMGEEATHWVKQ 190

Query: 186 YKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAFA 245
           +      M + G    +   S +   ++RQ F   +K  A  A I  + +SPH++RHAFA
Sbjct: 191 FMLFARPMLLDGQSSDVLFPSRRGTQMTRQTFWHRIKHYAVLAEIDSEMLSPHVLRHAFA 250

Query: 246 SHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +HL+  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L + YHP  
Sbjct: 251 THLVNHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKRLHERYHPRG 297


>gi|298505931|gb|ADI84654.1| integrase/recombinase XerD [Geobacter sulfurreducens KN400]
          Length = 295

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 104/292 (35%), Positives = 159/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNK-EISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+  + N++ +Y RDL     ++        +A    H+  +L HL +  L   S+ 
Sbjct: 12  LVVEKGLARNSVESYARDLSRYLGYVEQHAGGDPAAIRPLHVADFLAHLKESGLGARSRA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R F+ FL  EG  + NP+  +E P+    LP+ L    +  LL     +A    
Sbjct: 72  RALSAVRMFHRFLLVEGYAETNPTSIIEAPRVLAKLPQVLTGREVEMLLAAPAGDA---- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 VR   ++ELLYATG+RVSELV L    +N +   ++  GKG KERLV +  SA 
Sbjct: 128 ---PIEVRDRAMLELLYATGLRVSELVGLRTRDVNTSAGYLMTVGKGEKERLVPMGESAC 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+ +Y  +  +    G +      S     ++RQ F   +K  + +AGI  K ISPH +
Sbjct: 185 AAVVLYLSSARTQLGRGGESPFLFLSRLGERMTRQAFWNIIKKRSRQAGI-LKGISPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++Q +LGH D+STTQIYTH+  ++L++L + +HP  
Sbjct: 244 RHSFATHLLENGADLRSVQAMLGHADLSTTQIYTHVTRERLKRLHEQFHPRG 295


>gi|317489856|ref|ZP_07948349.1| tyrosine recombinase XerD [Eggerthella sp. 1_3_56FAA]
 gi|325829949|ref|ZP_08163407.1| tyrosine recombinase XerD [Eggerthella sp. HGA1]
 gi|316911011|gb|EFV32627.1| tyrosine recombinase XerD [Eggerthella sp. 1_3_56FAA]
 gi|325488116|gb|EGC90553.1| tyrosine recombinase XerD [Eggerthella sp. HGA1]
          Length = 297

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 101/293 (34%), Positives = 146/293 (49%), Gaps = 8/293 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER SS  T+SAY  DLK+   FL  + + SL       +++Y + L  R    S+  
Sbjct: 12  LRVERGSSPLTVSAYAADLKDYAQFLEKRGVESLDDVDREVIVAYESDLFGRGYAASTVD 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +SV++ F+ FL  EG  + NP+DT++LPK    LP  L    +  +L +   E     
Sbjct: 72  RHVSVLKGFHRFLVREGYARRNPADTIQLPKAPDRLPDVLSVAQVDAMLSRPLDEG---- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++E+LY  G+RVSE   L      L E  + I GKGNKER+  +S +AL
Sbjct: 128 ---PLALRNQAILEVLYGCGLRVSECTGLDLGDAILEEGYLHILGKGNKERIAPISGAAL 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            AL+ Y +      +                      +       A   I   N+ PH +
Sbjct: 185 RALRDYLERGRPELVRSYAKSTSAVFLNARGGRLTRQSVHSLVAEAGRFIGVANLHPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           RH+FA+H+L GGADLR IQ +LGH+DISTTQIYTH+    +++     HP AK
Sbjct: 245 RHSFATHMLAGGADLRVIQEILGHSDISTTQIYTHVNRTHIREEYLSAHPRAK 297


>gi|39996918|ref|NP_952869.1| integrase/recombinase XerD [Geobacter sulfurreducens PCA]
 gi|39983806|gb|AAR35196.1| integrase/recombinase XerD [Geobacter sulfurreducens PCA]
          Length = 295

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 104/292 (35%), Positives = 158/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNK-EISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+  + N++ +Y RDL     ++        +A    H+  +L HL +  L   S+ 
Sbjct: 12  LVVEKGLARNSVESYARDLSRYLGYVEQHAGGDPAAIRPLHVADFLAHLKESGLGARSRA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R F+ FL  EG  + NP+  +E P+    LP+ L    +  LL     +A    
Sbjct: 72  RALSAVRMFHRFLLVEGYAETNPTSIIEAPRVLAKLPQVLTGREVEMLLAAPAGDA---- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 VR   ++ELLYATG+RVSELV L    +N +   ++  GKG KERLV +  SA 
Sbjct: 128 ---PIEVRDRAMLELLYATGLRVSELVGLRTRDVNTSAGYLMTVGKGEKERLVPMGESAC 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+ +Y  +       G +      S     ++RQ F   +K  + +AGI  K ISPH +
Sbjct: 185 AAVVLYLSSARIQLGRGGESPFLFLSRLGERMTRQAFWNIIKKRSRQAGI-LKGISPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++Q +LGH D+STTQIYTH+  ++L++L + +HP  
Sbjct: 244 RHSFATHLLENGADLRSVQAMLGHADLSTTQIYTHVTRERLKRLHEQFHPRG 295


>gi|229192302|ref|ZP_04319267.1| Tyrosine recombinase xerD [Bacillus cereus ATCC 10876]
 gi|228591252|gb|EEK49106.1| Tyrosine recombinase xerD [Bacillus cereus ATCC 10876]
          Length = 296

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 106/293 (36%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  +    +  H++++L +L +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYVKYLQNVEQTKTFHEVTRLHIVNFLQYLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSVDEVEALLQTPKMTSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GIRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      +    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELIGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|315633750|ref|ZP_07889040.1| tyrosine recombinase XerD [Aggregatibacter segnis ATCC 33393]
 gi|315477792|gb|EFU68534.1| tyrosine recombinase XerD [Aggregatibacter segnis ATCC 33393]
          Length = 297

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 100/287 (34%), Positives = 165/287 (57%), Gaps = 7/287 (2%)

Query: 6   RASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKISV 65
           +  S NT+ +Y+ DL  + ++L+ +++SL    +  L ++L    ++    +S  R +S 
Sbjct: 18  KGLSPNTVQSYRLDLTALCDWLSERKLSLLDLDSVDLQTFLGERVEQGYKATSTARLLSA 77

Query: 66  IRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQWK 125
           IR+ + +L  E  R D+PS  L  PK    LPK L +  + +LL          +  Q  
Sbjct: 78  IRKLFQYLYQEKYRTDDPSAVLSSPKLPSRLPKYLTEQQVTDLLNV-------QSLEQPI 130

Query: 126 RVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQM 185
            +R   ++ELLYATG+RV+ELV+L   +++L +  + + GKGNKER+V +   A H ++ 
Sbjct: 131 ELRDKAMLELLYATGLRVTELVSLHTDSISLNQGVVRVIGKGNKERIVPMGEEATHWVKQ 190

Query: 186 YKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAFA 245
           +      + + G    +   S +   ++RQ F   +K  A  A I    +SPH++RHAFA
Sbjct: 191 FMLFARPILLNGQSSDVLFPSRRGTQMTRQTFWHRIKHYAVLAEIDSNMLSPHVLRHAFA 250

Query: 246 SHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +HL+  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L + YHP  
Sbjct: 251 THLVNHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKRLHERYHPRG 297


>gi|330997435|ref|ZP_08321286.1| tyrosine recombinase XerD [Paraprevotella xylaniphila YIT 11841]
 gi|329570809|gb|EGG52525.1| tyrosine recombinase XerD [Paraprevotella xylaniphila YIT 11841]
          Length = 317

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 110/295 (37%), Positives = 169/295 (57%), Gaps = 9/295 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NTL AY  DL+++ +F +++E+   A S + L  ++  L+   +   S  R
Sbjct: 27  LKLERGLSENTLDAYTEDLRKLLDFFSDEELDFRAVSLDDLHQFMAELADVGISPRSMAR 86

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR FY FL  E   + +P++ LE PK    LP+ L    I  ++E           
Sbjct: 87  ILSGIRSFYRFLYVEKEIEQDPTELLESPKIGRRLPEVLTVAEIDAMIEGI-------DL 139

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q +  R   ++E+LY+ G+RVSEL  L    L L E  + ++GKG KERLV +S  A+H
Sbjct: 140 SQPEGQRNRAILEMLYSCGLRVSELCGLRISDLFLEEGFIRVKGKGEKERLVPISGRAVH 199

Query: 182 ALQMYKKTCSSMKMT-GNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            L+ +    + +++  G++ ++F S  +   LSR      +K LA  AGIQ K ISPH  
Sbjct: 200 ELENWFLCRNLIRIKPGHEDFVFLSLRRGTALSRITIFYWVKELAVAAGIQ-KTISPHTF 258

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           RH+FA+HLLEGGA+LR IQ +LGH  ISTT+IYTH+   +L++ + ++HP   ++
Sbjct: 259 RHSFATHLLEGGANLRVIQAMLGHESISTTEIYTHIDRSRLRREIMEHHPRNIRD 313


>gi|294634844|ref|ZP_06713366.1| tyrosine recombinase XerD [Edwardsiella tarda ATCC 23685]
 gi|291091717|gb|EFE24278.1| tyrosine recombinase XerD [Edwardsiella tarda ATCC 23685]
          Length = 299

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 167/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL++Y++DL+ +  +L   ++SL  AS   L ++           SS  R
Sbjct: 16  LWLEKNLAENTLASYRQDLRTLAEWLAYHDLSLLTASPGDLQNFFAQRVDGGYKASSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ Y +L  E LR D+PS  L  PK    LPK L +  +  LL+         A 
Sbjct: 76  LLSALRRCYQYLYRETLRTDDPSAQLAAPKLPQRLPKDLSEAQVDALLQAP-------AI 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RVSELV L    ++L +  + + GKGNKERLV L   A++
Sbjct: 129 DNPLELRDKAMLELLYATGLRVSELVGLGQEDVSLRQGVVRVIGKGNKERLVPLGEEAIY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  +     S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIEYYLEYGRPWLVNGQTVAALFPSNRARQMTRQTFWHRIKHYAVLAGIDTQRLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 299


>gi|311278186|ref|YP_003940417.1| tyrosine recombinase XerD [Enterobacter cloacae SCF1]
 gi|308747381|gb|ADO47133.1| tyrosine recombinase XerD [Enterobacter cloacae SCF1]
          Length = 298

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 111/291 (38%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTLSAY+RDL  +  +L ++ +SL  A    L + L          +S  R
Sbjct: 15  LWLEKNLAENTLSAYRRDLTMVAAWLQHRGLSLETAQPGDLQNLLAERVDGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ +  L  E +R D+PS  L  PK    LPK L +  +  LL+   ++      
Sbjct: 75  LLSAMRRLFQHLYREKIRPDDPSAQLASPKLPQRLPKDLSEAQVDRLLQAPLVD------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV LS   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLSMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLENYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYARLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|229019302|ref|ZP_04176128.1| Tyrosine recombinase xerD [Bacillus cereus AH1273]
 gi|229025548|ref|ZP_04181956.1| Tyrosine recombinase xerD [Bacillus cereus AH1272]
 gi|228735730|gb|EEL86317.1| Tyrosine recombinase xerD [Bacillus cereus AH1272]
 gi|228741987|gb|EEL92161.1| Tyrosine recombinase xerD [Bacillus cereus AH1273]
          Length = 296

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 107/293 (36%), Positives = 164/293 (55%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  +    +  H++++L +L +    + + 
Sbjct: 12  MIVEKGLAKNTVVSYERDLKSYVKYLQNVEQTKTFHEVTRIHIVNFLQYLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K  +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSIDEVEALLQTPKAVSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GIRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKAVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKARLKDVYKQFHPRA 296


>gi|257791851|ref|YP_003182457.1| tyrosine recombinase XerD [Eggerthella lenta DSM 2243]
 gi|257475748|gb|ACV56068.1| tyrosine recombinase XerD [Eggerthella lenta DSM 2243]
          Length = 297

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 101/293 (34%), Positives = 146/293 (49%), Gaps = 8/293 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER SS  T+SAY  DLK+   FL  + + SL       +++Y + L  R    S+  
Sbjct: 12  LRVERGSSPLTVSAYAADLKDYAQFLEKRGVESLDDVDREVIVAYESDLFGRGYAASTVD 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +SV++ F+ FL  EG  + NP+DT++LPK    LP  L    +  +L +   E     
Sbjct: 72  RHVSVLKGFHRFLVREGYARRNPADTIQLPKAPDRLPDVLSVAQVDAMLSRPLDEG---- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++E+LY  G+RVSE   L      L E  + I GKGNKER+  +S +AL
Sbjct: 128 ---PLALRNRAILEVLYGCGLRVSECTGLDLGDAILEEGYLHILGKGNKERIAPISGAAL 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            AL+ Y +      +                      +       A   I   N+ PH +
Sbjct: 185 RALRDYLERGRPELVRSYAKSTSAVFLNARGGRLTRQSVHSLVAEAGRFIGVANLHPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           RH+FA+H+L GGADLR IQ +LGH+DISTTQIYTH+    +++     HP AK
Sbjct: 245 RHSFATHMLAGGADLRVIQEILGHSDISTTQIYTHVNRTHIREEYLSAHPRAK 297


>gi|30264167|ref|NP_846544.1| site-specific tyrosine recombinase XerD [Bacillus anthracis str.
           Ames]
 gi|47778274|ref|YP_020956.2| site-specific tyrosine recombinase XerD [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49186997|ref|YP_030249.1| site-specific tyrosine recombinase XerD [Bacillus anthracis str.
           Sterne]
 gi|49480325|ref|YP_038149.1| site-specific tyrosine recombinase XerD [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|65321483|ref|ZP_00394442.1| COG4974: Site-specific recombinase XerD [Bacillus anthracis str.
           A2012]
 gi|118479292|ref|YP_896443.1| site-specific tyrosine recombinase XerD [Bacillus thuringiensis
           str. Al Hakam]
 gi|165871247|ref|ZP_02215897.1| integrase/recombinase XerD [Bacillus anthracis str. A0488]
 gi|167633747|ref|ZP_02392071.1| integrase/recombinase XerD [Bacillus anthracis str. A0442]
 gi|167639424|ref|ZP_02397695.1| integrase/recombinase XerD [Bacillus anthracis str. A0193]
 gi|170687265|ref|ZP_02878483.1| integrase/recombinase XerD [Bacillus anthracis str. A0465]
 gi|170705812|ref|ZP_02896275.1| integrase/recombinase XerD [Bacillus anthracis str. A0389]
 gi|177652642|ref|ZP_02935058.1| integrase/recombinase XerD [Bacillus anthracis str. A0174]
 gi|190565945|ref|ZP_03018864.1| integrase/recombinase XerD [Bacillus anthracis Tsiankovskii-I]
 gi|196038584|ref|ZP_03105892.1| integrase/recombinase XerD [Bacillus cereus NVH0597-99]
 gi|196047216|ref|ZP_03114432.1| integrase/recombinase XerD [Bacillus cereus 03BB108]
 gi|218905229|ref|YP_002453063.1| integrase/recombinase XerD [Bacillus cereus AH820]
 gi|225866075|ref|YP_002751453.1| integrase/recombinase XerD [Bacillus cereus 03BB102]
 gi|227816868|ref|YP_002816877.1| integrase/recombinase XerD [Bacillus anthracis str. CDC 684]
 gi|228929139|ref|ZP_04092166.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228947809|ref|ZP_04110096.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|229093151|ref|ZP_04224269.1| Tyrosine recombinase xerD [Bacillus cereus Rock3-42]
 gi|229123612|ref|ZP_04252807.1| Tyrosine recombinase xerD [Bacillus cereus 95/8201]
 gi|229186335|ref|ZP_04313500.1| Tyrosine recombinase xerD [Bacillus cereus BGSC 6E1]
 gi|229604915|ref|YP_002868390.1| integrase/recombinase XerD [Bacillus anthracis str. A0248]
 gi|254683858|ref|ZP_05147718.1| site-specific tyrosine recombinase XerD [Bacillus anthracis str.
           CNEVA-9066]
 gi|254721693|ref|ZP_05183482.1| site-specific tyrosine recombinase XerD [Bacillus anthracis str.
           A1055]
 gi|254736205|ref|ZP_05193911.1| site-specific tyrosine recombinase XerD [Bacillus anthracis str.
           Western North America USA6153]
 gi|254744094|ref|ZP_05201777.1| site-specific tyrosine recombinase XerD [Bacillus anthracis str.
           Kruger B]
 gi|254754126|ref|ZP_05206161.1| site-specific tyrosine recombinase XerD [Bacillus anthracis str.
           Vollum]
 gi|254758184|ref|ZP_05210211.1| site-specific tyrosine recombinase XerD [Bacillus anthracis str.
           Australia 94]
 gi|301055587|ref|YP_003793798.1| tyrosine recombinase [Bacillus anthracis CI]
 gi|30258812|gb|AAP28030.1| integrase/recombinase XerD [Bacillus anthracis str. Ames]
 gi|47551979|gb|AAT33431.2| integrase/recombinase XerD [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49180924|gb|AAT56300.1| integrase/recombinase XerD [Bacillus anthracis str. Sterne]
 gi|49331881|gb|AAT62527.1| integrase/recombinase (tyrosine recombinase) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|118418517|gb|ABK86936.1| tyrosine recombinase XerD subunit [Bacillus thuringiensis str. Al
           Hakam]
 gi|164713166|gb|EDR18693.1| integrase/recombinase XerD [Bacillus anthracis str. A0488]
 gi|167512483|gb|EDR87858.1| integrase/recombinase XerD [Bacillus anthracis str. A0193]
 gi|167531153|gb|EDR93840.1| integrase/recombinase XerD [Bacillus anthracis str. A0442]
 gi|170129352|gb|EDS98216.1| integrase/recombinase XerD [Bacillus anthracis str. A0389]
 gi|170668882|gb|EDT19627.1| integrase/recombinase XerD [Bacillus anthracis str. A0465]
 gi|172081977|gb|EDT67045.1| integrase/recombinase XerD [Bacillus anthracis str. A0174]
 gi|190562864|gb|EDV16830.1| integrase/recombinase XerD [Bacillus anthracis Tsiankovskii-I]
 gi|196021965|gb|EDX60656.1| integrase/recombinase XerD [Bacillus cereus 03BB108]
 gi|196030307|gb|EDX68906.1| integrase/recombinase XerD [Bacillus cereus NVH0597-99]
 gi|218535959|gb|ACK88357.1| integrase/recombinase XerD [Bacillus cereus AH820]
 gi|225786005|gb|ACO26222.1| integrase/recombinase XerD [Bacillus cereus 03BB102]
 gi|227002405|gb|ACP12148.1| integrase/recombinase XerD [Bacillus anthracis str. CDC 684]
 gi|228597129|gb|EEK54784.1| Tyrosine recombinase xerD [Bacillus cereus BGSC 6E1]
 gi|228659747|gb|EEL15392.1| Tyrosine recombinase xerD [Bacillus cereus 95/8201]
 gi|228690125|gb|EEL43919.1| Tyrosine recombinase xerD [Bacillus cereus Rock3-42]
 gi|228811796|gb|EEM58130.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228830429|gb|EEM76039.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229269323|gb|ACQ50960.1| integrase/recombinase XerD [Bacillus anthracis str. A0248]
 gi|300377756|gb|ADK06660.1| tyrosine recombinase [Bacillus cereus biovar anthracis str. CI]
          Length = 296

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 110/293 (37%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  S    +  H++++L HL +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYVKYLQKVEQAKSFHEVTRLHIVNFLQHLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSVDEVEALLQTPKMTSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GVRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCVGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|228916729|ref|ZP_04080294.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228935411|ref|ZP_04098229.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228824163|gb|EEM69977.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228842916|gb|EEM87999.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 296

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 109/293 (37%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  S    +  H++++L HL +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYVKYLQKVEQAKSFHEVTRLHIVNFLQHLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  + +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSVNEVEALLQTPKMTSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GVRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCVGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|270264904|ref|ZP_06193168.1| DNA integration/recombination/invertion protein [Serratia odorifera
           4Rx13]
 gi|270041202|gb|EFA14302.1| DNA integration/recombination/invertion protein [Serratia odorifera
           4Rx13]
          Length = 299

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 172/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL+ +  +LN++  SL  A    L ++L          +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLQALSAWLNHQNTSLLQAQALDLQAFLAERVAGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+P+  L  PK    LPK L +  +  LL+   ++      
Sbjct: 76  LLSAMRRLFQYLYREKLREDDPTALLASPKLPQRLPKDLSEAQVDALLQAPCVD------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYLEHGRPWMVNGQALDVLFPSNRCQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|254466241|ref|ZP_05079652.1| phage integrase [Rhodobacterales bacterium Y4I]
 gi|206687149|gb|EDZ47631.1| phage integrase [Rhodobacterales bacterium Y4I]
          Length = 313

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 126/303 (41%), Positives = 179/303 (59%), Gaps = 13/303 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +   ++E  +S NTL AY RDLK++  +L ++ +  S AS + + +YL     + L  S
Sbjct: 14  FLDAQAAETGASQNTLLAYGRDLKDLTAWLEHRSLDFSTASQDDIEAYLISCDAQGLARS 73

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           ++ R++S ++Q Y F   EG R+DNP+  +  P +   LPKTL    +  LLE A+    
Sbjct: 74  TRARRLSAVKQIYRFAFEEGWRQDNPAIQIRGPGREKRLPKTLEVIEVDRLLEAARQTG- 132

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                +  R+R   L+ELLYATGMRV+ELV+L         R ++I GKG KER+V LSP
Sbjct: 133 ---RSEADRLRNTCLMELLYATGMRVTELVSLPVSAARGDPRMLLILGKGGKERMVPLSP 189

Query: 178 SALHALQMYKKTC------SSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ 231
            A  AL  +            +K      +LFPS  K+GHL+R  F   +K LA   G+ 
Sbjct: 190 PAREALAQWLLVRDAAEDERELKGNPASRFLFPSRGKSGHLTRHRFYLLIKELAVTGGLS 249

Query: 232 KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
              ++PH +RHAFA+HLL  GADLR IQ LLGH DI+TT+IYTH+L  +LQ+LV ++HPL
Sbjct: 250 PDKVTPHTLRHAFATHLLANGADLRAIQALLGHADIATTEIYTHVLDARLQELVLEHHPL 309

Query: 292 AKK 294
           AK+
Sbjct: 310 AKR 312


>gi|19552635|ref|NP_600637.1| site-specific tyrosine recombinase XerD [Corynebacterium glutamicum
           ATCC 13032]
 gi|62390303|ref|YP_225705.1| site-specific tyrosine recombinase XerD [Corynebacterium glutamicum
           ATCC 13032]
 gi|34222909|sp|Q8NQL5|XERD_CORGL RecName: Full=Tyrosine recombinase xerD
 gi|21324187|dbj|BAB98812.1| Integrase [Corynebacterium glutamicum ATCC 13032]
 gi|41325640|emb|CAF21429.1| INTEGRASE/RECOMBINASE XERD [Corynebacterium glutamicum ATCC 13032]
          Length = 304

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 99/297 (33%), Positives = 151/297 (50%), Gaps = 12/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLS-----QRKLV 55
           ++ ER  S NTLS Y+RD++   ++L    +  +   +T H+ SY+  L      Q+ L 
Sbjct: 14  LAVERGLSANTLSNYRRDVERYCDWLEAAGLDDIRDITTAHVESYVKDLRRGIDGQQALS 73

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
            SS  R + V R  + F   EG    + +  +  P     LP TL  + +A L++     
Sbjct: 74  ASSAGRALIVARGLHKFALMEGEVAADVAADVSPPAMGRHLPDTLSINEVALLIDAIP-- 131

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
             +        +R   L+ELLY TG R+SE + L+   ++     + I GKG+K+R+V  
Sbjct: 132 --HSDIATPVDLRDRALVELLYGTGARISEAIGLAVDDVSEMPEVLRITGKGSKQRIVPF 189

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
              A  A++ Y          G    LF +         Q     LK    RAG+  K+I
Sbjct: 190 GSMAQQAVREYLVRARPALSKGKSHALFLNQRGGPLSR-QSAWAVLKKTVERAGLD-KDI 247

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH +RH+FA+HLLEGGAD+R +Q LLGH+ ++TTQIYTH+  D L+++ +  HP A
Sbjct: 248 SPHTLRHSFATHLLEGGADVRVVQELLGHSSVTTTQIYTHITADSLREVWRGAHPRA 304


>gi|113461426|ref|YP_719495.1| site-specific tyrosine recombinase XerD [Haemophilus somnus 129PT]
 gi|170718469|ref|YP_001783684.1| site-specific tyrosine recombinase XerD [Haemophilus somnus 2336]
 gi|112823469|gb|ABI25558.1| tyrosine recombinase XerD subunit [Haemophilus somnus 129PT]
 gi|168826598|gb|ACA31969.1| tyrosine recombinase XerD [Haemophilus somnus 2336]
          Length = 297

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 99/291 (34%), Positives = 160/291 (54%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT+ +Y+ DL  +  +L  + +SL       L ++L     +    +S  R
Sbjct: 14  LWLEKGLSENTVQSYRLDLTALSQWLEPQGLSLETLDVVDLQTFLGERLTQGYKATSTAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R D+PS  L  PK    LPK L +  + +LL     E      
Sbjct: 74  MLSALRKLFQYLYREKYRSDDPSAVLSSPKLPSRLPKYLTEQQVTDLLNTPNTEI----- 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RV+ELV+LS  ++N+ +  + + GKG KER+V +   A +
Sbjct: 129 --PLELRDKAMLEMLYATGLRVTELVSLSLDSININQGVVRVIGKGKKERIVPMGEEANY 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ +     S  + G    +   S +   ++RQ F   +K  A  A I    +SPH++R
Sbjct: 187 WLRQFILYGRSFLLAGQSSDVVFPSRRGTQMTRQTFWHRVKYYAILAEIDTSALSPHVLR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HL+  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L + +HP  
Sbjct: 247 HAFATHLVNHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKILHERFHPRG 297


>gi|162147966|ref|YP_001602427.1| tyrosine recombinase xerD [Gluconacetobacter diazotrophicus PAl 5]
 gi|209542583|ref|YP_002274812.1| integrase family protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786543|emb|CAP56125.1| putative tyrosine recombinase xerD [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530260|gb|ACI50197.1| integrase family protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 304

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 113/293 (38%), Positives = 174/293 (59%), Gaps = 6/293 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER ++ NTL AY RDL +          SL  A +  L  Y+  L++  L   +Q 
Sbjct: 11  MLAAERGAAANTLKAYGRDLDDFAAHARQAGRSLHDADSALLRDYMGSLARAGLSPRTQA 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S ++QF+ FL  EG+R+DNP++ L+ P+    LP+ L +D +  LL       +  A
Sbjct: 71  RRLSCLKQFHLFLAREGVRQDNPAELLDTPRLPATLPRFLTEDEVDALLAACVPPPDGGA 130

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +W   R    +E+LYA+G+R+SEL+ L    L    + ++++GKG +ERLV LS +A 
Sbjct: 131 ARRWLVAR--AALEMLYASGLRISELLALPRRGLGRDAQMLMVRGKGGRERLVPLSAAAR 188

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A +                +LFP       L+RQ F R L  +A RAG+    +SPH++
Sbjct: 189 AAAEALIAH----DGPRRSPYLFPGRAPDRPLTRQGFDRILHDVALRAGLDPARLSPHVL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           RH+FA+H+L  GADLR +Q+LLGH DI+TTQIYTH+L ++L++ V+ YHPLA+
Sbjct: 245 RHSFATHMLARGADLRALQVLLGHADIATTQIYTHVLAERLRQAVEAYHPLAR 297


>gi|42783204|ref|NP_980451.1| site-specific tyrosine recombinase XerD [Bacillus cereus ATCC
           10987]
 gi|206976263|ref|ZP_03237171.1| integrase/recombinase XerD [Bacillus cereus H3081.97]
 gi|217961583|ref|YP_002340153.1| site-specific tyrosine recombinase XerD [Bacillus cereus AH187]
 gi|229140825|ref|ZP_04269370.1| Tyrosine recombinase xerD [Bacillus cereus BDRD-ST26]
 gi|229198213|ref|ZP_04324921.1| Tyrosine recombinase xerD [Bacillus cereus m1293]
 gi|42739132|gb|AAS43059.1| integrase/recombinase XerD [Bacillus cereus ATCC 10987]
 gi|206745459|gb|EDZ56858.1| integrase/recombinase XerD [Bacillus cereus H3081.97]
 gi|217064224|gb|ACJ78474.1| integrase/recombinase XerD [Bacillus cereus AH187]
 gi|228585232|gb|EEK43342.1| Tyrosine recombinase xerD [Bacillus cereus m1293]
 gi|228642615|gb|EEK98901.1| Tyrosine recombinase xerD [Bacillus cereus BDRD-ST26]
 gi|324327997|gb|ADY23257.1| site-specific tyrosine recombinase XerD [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 296

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 110/293 (37%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  S    +  H++++L HL +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYVKYLQNVEQAKSFHEVTRLHIVNFLQHLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSVDEVEALLQTPKMTSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GVRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|315658225|ref|ZP_07911097.1| tyrosine recombinase XerD [Staphylococcus lugdunensis M23590]
 gi|315496554|gb|EFU84877.1| tyrosine recombinase XerD [Staphylococcus lugdunensis M23590]
          Length = 295

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 97/293 (33%), Positives = 151/293 (51%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDL + + +L  + I  +       +   L +L  +     S 
Sbjct: 11  FIQIEKGLSPNTIGAYRRDLDKYKLYLETRHIEHIDFIDRQTIQECLGYLIDQGSSAKSL 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  LE PK    LP  L  D +  LLE         
Sbjct: 71  ARFISTIRSFHQFALREKYAAKDPTVLLETPKYEKKLPDVLEIDEVVRLLEAP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++EL+YATG+RVSELV +    +N+    + + GKG+KER++ L  + 
Sbjct: 124 DLSKKNGYRDRTILELMYATGIRVSELVHIEIENINVIMGFVRVFGKGDKERIIPLGDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L+ Y K      +      +   +     LSRQ   + +K    ++ I  K ++PH 
Sbjct: 184 IDYLKTYMKEIRPQLLKSTVTNVLFLNMHGKPLSRQGIWKMIKQYGIKSNIT-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++++   YHP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKAQIRQIYNQYHPRA 295


>gi|52141402|ref|YP_085426.1| site-specific tyrosine recombinase XerD [Bacillus cereus E33L]
 gi|228987282|ref|ZP_04147403.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229157674|ref|ZP_04285749.1| Tyrosine recombinase xerD [Bacillus cereus ATCC 4342]
 gi|51974871|gb|AAU16421.1| integrase/recombinase (tyrosine recombinase) [Bacillus cereus E33L]
 gi|228625631|gb|EEK82383.1| Tyrosine recombinase xerD [Bacillus cereus ATCC 4342]
 gi|228772511|gb|EEM20956.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 296

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 110/293 (37%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  S    +  H++++L HL +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYVKYLQKVEQAKSFHEVTRLHIVNFLQHLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSVDEVEALLQTPKMTSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GVRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|145295553|ref|YP_001138374.1| site-specific tyrosine recombinase XerD [Corynebacterium glutamicum
           R]
 gi|140845473|dbj|BAF54472.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 304

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 99/297 (33%), Positives = 151/297 (50%), Gaps = 12/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLS-----QRKLV 55
           ++ ER  S NTLS Y+RD++   ++L    +  +   +T H+ SY+  L      Q+ L 
Sbjct: 14  LAVERGLSANTLSNYRRDVERYCDWLEAAGLDDIRDITTAHVESYVKDLRRGIDGQQALS 73

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
            SS  R + V R  + F   EG    + +  +  P     LP TL  + +A L++     
Sbjct: 74  ASSAGRALIVARGLHKFALMEGEVAADVAADVSPPAMGRHLPDTLSINEVALLIDAIP-- 131

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
             +        +R   L+ELLY TG R+SE + L+   ++     + I GKG+K+R+V  
Sbjct: 132 --HSDIATPVDLRDRALVELLYGTGARISEAIGLAVDDVSEMPEVLRITGKGSKKRIVPF 189

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
              A  A++ Y          G    LF +         Q     LK    RAG+  K+I
Sbjct: 190 GSMAQQAVREYLIRARPALSKGKSHALFLNQRGGPLSR-QSAWAVLKKTVERAGLD-KDI 247

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH +RH+FA+HLLEGGAD+R +Q LLGH+ ++TTQIYTH+  D L+++ +  HP A
Sbjct: 248 SPHTLRHSFATHLLEGGADVRVVQELLGHSSVTTTQIYTHITADSLREVWRGAHPRA 304


>gi|205373757|ref|ZP_03226559.1| site-specific tyrosine recombinase XerD [Bacillus coahuilensis
           m4-4]
          Length = 297

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 99/294 (33%), Positives = 154/294 (52%), Gaps = 9/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI--SLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S NTL +Y+RDLK   N L N E    L+     ++I +L  L  +   + +
Sbjct: 11  FLQIERGLSSNTLVSYERDLKSYCNHLKNTEQIEDLNHVVRGNIIEFLAFLKDQGKSSKT 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ IR F+ FL  E +   +P+  ++ PK    LPK L  D +  LL+   ++   
Sbjct: 71  IARHIASIRSFHQFLLREKITDHDPTVHIDTPKAERSLPKVLSLDEVETLLDSPNLQ--- 127

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
               +   +R   ++E+LYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   
Sbjct: 128 ----KPSGIRDKAMLEILYATGIRVSELIELNLEDVHLTMGFVRCIGKGNKERIIPLGNH 183

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A+  L+ Y +       +             G+   +     +    A     +K ++PH
Sbjct: 184 AITILKEYLEKARPKLRSSKYRTDALFLNHHGNRLTRQGFWKILKGLATKANIQKELTPH 243

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+++   +HP A
Sbjct: 244 TLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKEVYSKFHPRA 297


>gi|229524404|ref|ZP_04413809.1| tyrosine recombinase XerD [Vibrio cholerae bv. albensis VL426]
 gi|229337985|gb|EEO03002.1| tyrosine recombinase XerD [Vibrio cholerae bv. albensis VL426]
          Length = 302

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 104/291 (35%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           M  ER  + NT+++Y+ DL ++  ++   +  L   S   L  Y + LS++    +S+ R
Sbjct: 19  MWFERGLAENTVTSYRNDLSKLLEWMAQNQYRLDFISFAGLQEYQSWLSEQNYKPTSKAR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LL           P
Sbjct: 79  MLSAIRRLFQYLYREKVRADDPSALLISPKLPTRLPKDLSEAQVEALLSAP-------DP 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+ 
Sbjct: 132 QSPLELRDKAMLELLYATGLRVTELVSLTMENMSLRQGVVRVMGKGGKERLVPMGENAIE 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ + +   S+ +      +   S++   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 192 WIETFLQQGRSLLLGEQTSDIVFPSSRGQQMTRQTFWHRIKHYAVIAGIDVEKLSPHVLR 251

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 252 HAFATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHNEHHPRA 302


>gi|242373798|ref|ZP_04819372.1| tyrosine recombinase XerD [Staphylococcus epidermidis M23864:W1]
 gi|242348535|gb|EES40137.1| tyrosine recombinase XerD [Staphylococcus epidermidis M23864:W1]
          Length = 295

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 101/293 (34%), Positives = 153/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDL + + +L  ++I+ +       +   L HL      + S 
Sbjct: 11  FIQIEKGLSSNTIGAYRRDLNKYKTYLEERKITHIDFVDRQVIQECLGHLIDLGQSSKSL 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  +E PK    LP  L    + +LLE         
Sbjct: 71  ARFISTIRSFHQFALREKYAAKDPTVLIETPKYEKKLPDVLEVQEVLDLLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSE++ L    +NL    + + GKGNKER+V L  + 
Sbjct: 124 DLTKNNGYRDRTMLELLYATGMRVSEIIQLEVEDVNLMMGFVRVFGKGNKERIVPLGDAV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +      +   +     LSRQ   + +K    +A I  K ++PH 
Sbjct: 184 IEYLTTYIETVRPQLLKQTVTHVLFLNMHGKPLSRQGIWKMIKQNGIKANIN-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQFHPRA 295


>gi|229174766|ref|ZP_04302290.1| Tyrosine recombinase xerD [Bacillus cereus MM3]
 gi|228608756|gb|EEK66054.1| Tyrosine recombinase xerD [Bacillus cereus MM3]
          Length = 296

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 110/293 (37%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  S    +  H++++L HL +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYVKYLQNVEQAKSFHEVTRLHIVNFLQHLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSIDEVEALLQTPKMTSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GVRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKARLKDVYKQFHPRA 296


>gi|257784281|ref|YP_003179498.1| tyrosine recombinase XerD [Atopobium parvulum DSM 20469]
 gi|257472788|gb|ACV50907.1| tyrosine recombinase XerD [Atopobium parvulum DSM 20469]
          Length = 302

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 156/291 (53%), Gaps = 10/291 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           + ER  S+NTL AY RDL+    +L+ K+I S +  + + +  Y+  L    +  +S  R
Sbjct: 15  AVERGLSVNTLDAYTRDLEGYLFWLSGKKITSPNQVTRSDVEEYIGSLRDLGMAPASVER 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
             + IR F+ F+  E + + +P++ L    +   LP  + ++    LL+Q         P
Sbjct: 75  HTAAIRNFHKFMAVEQICESSPAEDLPTTARIQRLPDVISQEKAEELLDQPF-------P 127

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLY  G+RVSEL  L    + L +  + + GKG+KER+V +  SA  
Sbjct: 128 NSPLGIRDKAILELLYGCGLRVSELCDLEVRGVLLEDELLRVFGKGSKERVVPVLGSAYR 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           AL+ Y     S+ +    +     + + G +SRQ   + +       GI+   + PH +R
Sbjct: 188 ALKTYLFEARSLLLKHGQVSEVFVNARGGRISRQSVHKLVANYGRVVGIEG--LHPHTLR 245

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLEGGADLR++Q LLGH DISTTQ+YTH+    ++ +  + HP A
Sbjct: 246 HSFATHLLEGGADLRSVQELLGHVDISTTQLYTHVDRSHIRDVYLEAHPRA 296


>gi|226227035|ref|YP_002761141.1| tyrosine recombinase XerD [Gemmatimonas aurantiaca T-27]
 gi|226090226|dbj|BAH38671.1| tyrosine recombinase XerD [Gemmatimonas aurantiaca T-27]
          Length = 312

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 97/292 (33%), Positives = 157/292 (53%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E  +S  T+ AY+RD+      +    I+     +   L  ++ HL    L  SS R
Sbjct: 29  LQIEEGASPRTIEAYRRDVIRCAAQMRAMGITQAKDITPAALREFVYHLKDLGLAGSSIR 88

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R ++  +  EGL   +P++ L+ P++   LP+ L  D +  LL    ++     
Sbjct: 89  RNISALRTWFRIMVAEGLVTTDPTERLDSPQRWRTLPEVLSVDEVTRLLAAPGLD----- 143

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +    R   ++EL Y  G+RVSE + +S   + L +  + + GKGNKERLV +  SA+
Sbjct: 144 --ERLAFRDRAMLELAYGAGLRVSEWIGMSVKDVMLEDSLVRVLGKGNKERLVPIGRSAI 201

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+ +Y +    +   G    +   + +   LSR    + ++     AGI+K  +SPH +
Sbjct: 202 GAVAVYLRELRPVLERGGGKGILFLNGRGAPLSRMGAWKLVRKYVGMAGIEKP-VSPHTL 260

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLEGGADLR +Q +LGH DI+TTQIYTH+  + L+ + + +HP A
Sbjct: 261 RHSFATHLLEGGADLRAVQEMLGHADIATTQIYTHVDREYLRSVHRQFHPRA 312


>gi|289550729|ref|YP_003471633.1| Site-specific recombinase XerD [Staphylococcus lugdunensis
           HKU09-01]
 gi|289180261|gb|ADC87506.1| Site-specific recombinase XerD [Staphylococcus lugdunensis
           HKU09-01]
          Length = 295

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 98/293 (33%), Positives = 151/293 (51%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDL + + +L  + I  +       +   L +L  +     S 
Sbjct: 11  FIQIEKGLSPNTIGAYRRDLDKYKLYLETRHIEHIDFIDRQTIQECLGYLIDQGSSAKSL 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  LE PK    LP  L  D +  LLE         
Sbjct: 71  ARFISTIRSFHQFALREKYAAKDPTVLLETPKYEKKLPDVLEIDEVVRLLEAP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++EL+YATGMRVSELV +    +N+    + + GKG+KER++ L  + 
Sbjct: 124 DLSKKNGYRDRTILELMYATGMRVSELVHIEIENINVIMGFVRVFGKGDKERIIPLGDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L+ Y K      +      +   +     LSRQ   + +K    ++ I  K ++PH 
Sbjct: 184 IDYLKTYMKEIRPQLLKSTVTNVLFLNMHGKPLSRQGIWKMIKQYGIKSNIT-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++++   YHP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKAQIRQIYNQYHPRA 295


>gi|325299547|ref|YP_004259464.1| Tyrosine recombinase xerC [Bacteroides salanitronis DSM 18170]
 gi|324319100|gb|ADY36991.1| Tyrosine recombinase xerC [Bacteroides salanitronis DSM 18170]
          Length = 316

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 103/295 (34%), Positives = 158/295 (53%), Gaps = 8/295 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER+ S NT+ AY  DL ++  +L  + I ++  +   L ++   L    +   SQ R
Sbjct: 28  LKLERSLSGNTIDAYLTDLDKLLAYLTLEGIGITDVTLQDLENFSAGLHDIGIHPRSQAR 87

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR F+ FL  +   + +PS+ LE P+    LP  L  + I  L+            
Sbjct: 88  ILSGIRSFFRFLTLDDYIRQDPSELLESPQIGKHLPDVLTVEEIDALIGAI-------DE 140

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
              +  R   ++E LY+ G+RVSEL  L    L L E  + ++GKG+K+RLV +SP A++
Sbjct: 141 TTPEGQRNRAILETLYSCGLRVSELCNLKLSDLYLDEGFIKVEGKGSKQRLVPISPRAVN 200

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y       K+          S    ++SR +    +K LA R G+ KK ISPH  R
Sbjct: 201 ELKNYFTERGYAKIKPGYEDFVFISRFGKNISRIMVFHIIKELAERIGL-KKTISPHTFR 259

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           H+FA+HLLEGGA+LR IQ +LGH  I TT+IYTH+    L++ + ++HP  KK++
Sbjct: 260 HSFATHLLEGGANLRAIQAMLGHESIGTTEIYTHIDRSMLRQEIIEHHPRNKKKR 314


>gi|228922841|ref|ZP_04086139.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228836896|gb|EEM82239.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 296

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 107/293 (36%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  +    +  H++++L +L +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYIKYLQNVEQTKTFHEVTRLHIVNFLQYLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSVDEVEALLQTPKMTSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GIRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|153214077|ref|ZP_01949211.1| tyrosine recombinase XerD [Vibrio cholerae 1587]
 gi|124115503|gb|EAY34323.1| tyrosine recombinase XerD [Vibrio cholerae 1587]
          Length = 302

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 171/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           M  ER  + NT+++Y+ DL ++  ++   +  L   S   L  Y + LS++    +S+ R
Sbjct: 19  MWFERGLAENTVASYRNDLSKLLEWMAQNQYRLDFISFAGLQEYQSWLSEQNYKPTSKAR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LL           P
Sbjct: 79  MLSAIRRLFQYLHREKVRADDPSALLVSPKLPTRLPKDLSEAQVEALLSAP-------DP 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+ 
Sbjct: 132 QSPLELRDKAMLELLYATGLRVTELVSLTMENMSLRQGVVRVMGKGGKERLVPMGENAIE 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ + +   S+ +      +   S++   ++RQ F   +K  AA AGI  + +SPH++R
Sbjct: 192 WIETFLQQGRSLLLGEQTSDIVFPSSRGQQMTRQTFWHRIKHYAAIAGIDVEKLSPHVLR 251

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 252 HAFATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHNEHHPRA 302


>gi|283788448|ref|YP_003368313.1| tyrosine recombinase [Citrobacter rodentium ICC168]
 gi|282951902|emb|CBG91620.1| tyrosine recombinase [Citrobacter rodentium ICC168]
          Length = 298

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTLSAY+RDL  +  +L +++ SL  A +  L + L          +S  R
Sbjct: 15  LWLEKNLAENTLSAYRRDLTMLVEWLAHRKASLETAQSEDLQALLAERMDGGYKATSTAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ +  L  E +R D+PS  L  PK    LPK L +  +  LL+   ++      
Sbjct: 75  LLSAVRRLFQHLYREKIRPDDPSAALASPKLPQRLPKDLSEAQVERLLQAPVVD------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEILYATGLRVSELVGLTMSDVSLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|228992829|ref|ZP_04152754.1| Tyrosine recombinase xerD [Bacillus pseudomycoides DSM 12442]
 gi|228998874|ref|ZP_04158459.1| Tyrosine recombinase xerD [Bacillus mycoides Rock3-17]
 gi|228760890|gb|EEM09851.1| Tyrosine recombinase xerD [Bacillus mycoides Rock3-17]
 gi|228766878|gb|EEM15516.1| Tyrosine recombinase xerD [Bacillus pseudomycoides DSM 12442]
          Length = 296

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 106/293 (36%), Positives = 164/293 (55%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  +    +  H++++L +L +    + + 
Sbjct: 12  MIVEKGLAKNTVVSYERDLKSYVKYLQHVEQIKTFHEVTRIHIVNFLQYLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E + + +PS  +E P+    LPK L    +  LL+  K  +   
Sbjct: 72  ARHIASIRSFHQFLLRERVVEHDPSVHIETPQGERKLPKVLSVSEVEALLQTPKETSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GIRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCVGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQRYIEKGRKELMGKKTVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKARLKDVYKQFHPRA 296


>gi|30022176|ref|NP_833807.1| site-specific tyrosine recombinase XerD [Bacillus cereus ATCC
           14579]
 gi|206971233|ref|ZP_03232184.1| integrase/recombinase XerD [Bacillus cereus AH1134]
 gi|218235095|ref|YP_002368894.1| site-specific tyrosine recombinase XerD [Bacillus cereus B4264]
 gi|218899252|ref|YP_002447663.1| integrase/recombinase XerD [Bacillus cereus G9842]
 gi|228902600|ref|ZP_04066751.1| Tyrosine recombinase xerD [Bacillus thuringiensis IBL 4222]
 gi|228909920|ref|ZP_04073741.1| Tyrosine recombinase xerD [Bacillus thuringiensis IBL 200]
 gi|228941242|ref|ZP_04103795.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228954374|ref|ZP_04116400.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228960355|ref|ZP_04122008.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228974174|ref|ZP_04134744.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980765|ref|ZP_04141070.1| Tyrosine recombinase xerD [Bacillus thuringiensis Bt407]
 gi|229047783|ref|ZP_04193363.1| Tyrosine recombinase xerD [Bacillus cereus AH676]
 gi|229071595|ref|ZP_04204813.1| Tyrosine recombinase xerD [Bacillus cereus F65185]
 gi|229081347|ref|ZP_04213850.1| Tyrosine recombinase xerD [Bacillus cereus Rock4-2]
 gi|229111564|ref|ZP_04241115.1| Tyrosine recombinase xerD [Bacillus cereus Rock1-15]
 gi|229129370|ref|ZP_04258341.1| Tyrosine recombinase xerD [Bacillus cereus BDRD-Cer4]
 gi|229146665|ref|ZP_04275032.1| Tyrosine recombinase xerD [Bacillus cereus BDRD-ST24]
 gi|229152292|ref|ZP_04280485.1| Tyrosine recombinase xerD [Bacillus cereus m1550]
 gi|229180370|ref|ZP_04307713.1| Tyrosine recombinase xerD [Bacillus cereus 172560W]
 gi|296504585|ref|YP_003666285.1| site-specific tyrosine recombinase XerD [Bacillus thuringiensis
           BMB171]
 gi|29897733|gb|AAP11008.1| DNA integration/recombination/invertion protein [Bacillus cereus
           ATCC 14579]
 gi|206734005|gb|EDZ51176.1| integrase/recombinase XerD [Bacillus cereus AH1134]
 gi|218163052|gb|ACK63044.1| integrase/recombinase XerD [Bacillus cereus B4264]
 gi|218543889|gb|ACK96283.1| integrase/recombinase XerD [Bacillus cereus G9842]
 gi|228603117|gb|EEK60595.1| Tyrosine recombinase xerD [Bacillus cereus 172560W]
 gi|228631254|gb|EEK87890.1| Tyrosine recombinase xerD [Bacillus cereus m1550]
 gi|228636835|gb|EEK93298.1| Tyrosine recombinase xerD [Bacillus cereus BDRD-ST24]
 gi|228653975|gb|EEL09842.1| Tyrosine recombinase xerD [Bacillus cereus BDRD-Cer4]
 gi|228671946|gb|EEL27239.1| Tyrosine recombinase xerD [Bacillus cereus Rock1-15]
 gi|228701969|gb|EEL54452.1| Tyrosine recombinase xerD [Bacillus cereus Rock4-2]
 gi|228711531|gb|EEL63488.1| Tyrosine recombinase xerD [Bacillus cereus F65185]
 gi|228723575|gb|EEL74940.1| Tyrosine recombinase xerD [Bacillus cereus AH676]
 gi|228778934|gb|EEM27196.1| Tyrosine recombinase xerD [Bacillus thuringiensis Bt407]
 gi|228785514|gb|EEM33523.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228799379|gb|EEM46343.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228805306|gb|EEM51899.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228818401|gb|EEM64473.1| Tyrosine recombinase xerD [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228849755|gb|EEM94588.1| Tyrosine recombinase xerD [Bacillus thuringiensis IBL 200]
 gi|228857041|gb|EEN01550.1| Tyrosine recombinase xerD [Bacillus thuringiensis IBL 4222]
 gi|296325637|gb|ADH08565.1| site-specific tyrosine recombinase XerD [Bacillus thuringiensis
           BMB171]
 gi|326941864|gb|AEA17760.1| site-specific tyrosine recombinase XerD [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 296

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 107/293 (36%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  +    +  H++++L +L +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYVKYLQNVEQTKTFHEVTRLHIVNFLQYLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSVDEVEALLQTPKMTSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GIRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|15642416|ref|NP_232049.1| site-specific tyrosine recombinase XerD [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121587637|ref|ZP_01677401.1| tyrosine recombinase XerD [Vibrio cholerae 2740-80]
 gi|121728363|ref|ZP_01681392.1| tyrosine recombinase XerD [Vibrio cholerae V52]
 gi|147673043|ref|YP_001217919.1| site-specific tyrosine recombinase XerD [Vibrio cholerae O395]
 gi|153802800|ref|ZP_01957386.1| tyrosine recombinase XerD [Vibrio cholerae MZO-3]
 gi|153818418|ref|ZP_01971085.1| tyrosine recombinase XerD [Vibrio cholerae NCTC 8457]
 gi|153822226|ref|ZP_01974893.1| tyrosine recombinase XerD [Vibrio cholerae B33]
 gi|153826869|ref|ZP_01979536.1| tyrosine recombinase XerD [Vibrio cholerae MZO-2]
 gi|227082540|ref|YP_002811091.1| integrase/recombinase XerD [Vibrio cholerae M66-2]
 gi|229507521|ref|ZP_04397026.1| tyrosine recombinase XerD [Vibrio cholerae BX 330286]
 gi|229512283|ref|ZP_04401762.1| tyrosine recombinase XerD [Vibrio cholerae B33]
 gi|229514045|ref|ZP_04403507.1| tyrosine recombinase XerD [Vibrio cholerae TMA 21]
 gi|229519419|ref|ZP_04408862.1| tyrosine recombinase XerD [Vibrio cholerae RC9]
 gi|229521248|ref|ZP_04410668.1| tyrosine recombinase XerD [Vibrio cholerae TM 11079-80]
 gi|229528596|ref|ZP_04417986.1| tyrosine recombinase XerD [Vibrio cholerae 12129(1)]
 gi|229607027|ref|YP_002877675.1| site-specific tyrosine recombinase XerD [Vibrio cholerae MJ-1236]
 gi|254226633|ref|ZP_04920213.1| tyrosine recombinase XerD [Vibrio cholerae V51]
 gi|254291785|ref|ZP_04962570.1| tyrosine recombinase XerD [Vibrio cholerae AM-19226]
 gi|254849542|ref|ZP_05238892.1| tyrosine recombinase XerD [Vibrio cholerae MO10]
 gi|255746910|ref|ZP_05420855.1| site-specific recombinase XerD [Vibrio cholera CIRS 101]
 gi|262161547|ref|ZP_06030657.1| site-specific recombinase XerD [Vibrio cholerae INDRE 91/1]
 gi|262168398|ref|ZP_06036095.1| site-specific recombinase XerD [Vibrio cholerae RC27]
 gi|262190652|ref|ZP_06048886.1| site-specific recombinase XerD [Vibrio cholerae CT 5369-93]
 gi|297581043|ref|ZP_06942968.1| tyrosine recombinase xerD [Vibrio cholerae RC385]
 gi|298500223|ref|ZP_07010028.1| tyrosine recombinase XerD [Vibrio cholerae MAK 757]
 gi|34223076|sp|Q9KPE9|XERD_VIBCH RecName: Full=Tyrosine recombinase xerD
 gi|9656993|gb|AAF95562.1| integrase/recombinase XerD [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121548147|gb|EAX58220.1| tyrosine recombinase XerD [Vibrio cholerae 2740-80]
 gi|121629354|gb|EAX61785.1| tyrosine recombinase XerD [Vibrio cholerae V52]
 gi|124121665|gb|EAY40408.1| tyrosine recombinase XerD [Vibrio cholerae MZO-3]
 gi|125620852|gb|EAZ49206.1| tyrosine recombinase XerD [Vibrio cholerae V51]
 gi|126511051|gb|EAZ73645.1| tyrosine recombinase XerD [Vibrio cholerae NCTC 8457]
 gi|126520236|gb|EAZ77459.1| tyrosine recombinase XerD [Vibrio cholerae B33]
 gi|146314926|gb|ABQ19465.1| tyrosine recombinase XerD [Vibrio cholerae O395]
 gi|149739285|gb|EDM53541.1| tyrosine recombinase XerD [Vibrio cholerae MZO-2]
 gi|150422297|gb|EDN14259.1| tyrosine recombinase XerD [Vibrio cholerae AM-19226]
 gi|227010428|gb|ACP06640.1| integrase/recombinase XerD [Vibrio cholerae M66-2]
 gi|227014311|gb|ACP10521.1| integrase/recombinase XerD [Vibrio cholerae O395]
 gi|229332370|gb|EEN97856.1| tyrosine recombinase XerD [Vibrio cholerae 12129(1)]
 gi|229341780|gb|EEO06782.1| tyrosine recombinase XerD [Vibrio cholerae TM 11079-80]
 gi|229344108|gb|EEO09083.1| tyrosine recombinase XerD [Vibrio cholerae RC9]
 gi|229349226|gb|EEO14183.1| tyrosine recombinase XerD [Vibrio cholerae TMA 21]
 gi|229352248|gb|EEO17189.1| tyrosine recombinase XerD [Vibrio cholerae B33]
 gi|229355026|gb|EEO19947.1| tyrosine recombinase XerD [Vibrio cholerae BX 330286]
 gi|229369682|gb|ACQ60105.1| tyrosine recombinase XerD [Vibrio cholerae MJ-1236]
 gi|254845247|gb|EET23661.1| tyrosine recombinase XerD [Vibrio cholerae MO10]
 gi|255735312|gb|EET90712.1| site-specific recombinase XerD [Vibrio cholera CIRS 101]
 gi|262023290|gb|EEY41994.1| site-specific recombinase XerD [Vibrio cholerae RC27]
 gi|262028858|gb|EEY47512.1| site-specific recombinase XerD [Vibrio cholerae INDRE 91/1]
 gi|262033466|gb|EEY51970.1| site-specific recombinase XerD [Vibrio cholerae CT 5369-93]
 gi|297534869|gb|EFH73705.1| tyrosine recombinase xerD [Vibrio cholerae RC385]
 gi|297540916|gb|EFH76970.1| tyrosine recombinase XerD [Vibrio cholerae MAK 757]
 gi|327484912|gb|AEA79319.1| Tyrosine recombinase XerD [Vibrio cholerae LMA3894-4]
          Length = 302

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 104/291 (35%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           M  ER  + NT+++Y+ DL ++  ++   +  L   S   L  Y + LS++    +S+ R
Sbjct: 19  MWFERGLAENTVASYRNDLSKLLEWMAQNQYRLDFISFAGLQEYQSWLSEQNYKPTSKAR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LL           P
Sbjct: 79  MLSAIRRLFQYLHREKVRADDPSALLVSPKLPTRLPKDLSEAQVEALLSAP-------DP 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+ 
Sbjct: 132 QSPLELRDKAMLELLYATGLRVTELVSLTMENMSLRQGVVRVMGKGGKERLVPMGENAIE 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ + +   S+ +      +   S++   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 192 WIETFLQQGRSLLLGEQTSDIVFPSSRGQQMTRQTFWHRIKHYAVIAGIDVEKLSPHVLR 251

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 252 HAFATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHNEHHPRA 302


>gi|332637865|ref|ZP_08416728.1| site-specific recombinase XerD [Weissella cibaria KACC 11862]
          Length = 303

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 97/293 (33%), Positives = 149/293 (50%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFL--NNKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           ++ ER  S NT ++Y++DL     +L    K + L+      ++++L  +  +    +S 
Sbjct: 19  LTVERGLSANTRTSYRQDLTHFFTYLIDKEKSLPLTQVDRFTIMAFLGEMETQGKSRNSV 78

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
              +S +R+F+ F    G    +P   ++ PKK   LP  L    +  LL          
Sbjct: 79  IHMVSTLRKFFQFATDSGWTTTDPMTQVDPPKKAQHLPAVLTLSEVEALLAVP------- 131

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++E++YATG+RVSELV L    L+L    +   GKG+KER++ +   A
Sbjct: 132 DTNTTLGLRNRTMLEVMYATGLRVSELVNLRLDNLHLDLGLIQTIGKGDKERIIPIGDVA 191

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
            H LQ Y            D  +   +     L+RQ   + +K     AGI  K++SPH 
Sbjct: 192 THWLQRYLADGRPFLGRQQDEQVIFLNDHGHQLTRQGVWKLIKQWVIAAGIT-KDVSPHT 250

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+H+LE GADLR +Q LLGH DISTTQIYTH+   +L ++ Q  HP A
Sbjct: 251 LRHSFATHILENGADLRIVQELLGHADISTTQIYTHISNKRLTEVYQKSHPRA 303


>gi|149181661|ref|ZP_01860154.1| site-specific tyrosine recombinase XerD [Bacillus sp. SG-1]
 gi|148850639|gb|EDL64796.1| site-specific tyrosine recombinase XerD [Bacillus sp. SG-1]
          Length = 297

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 92/294 (31%), Positives = 146/294 (49%), Gaps = 9/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI--SLSAASTNHLISYLNHLSQRKLVTSS 58
            +  E+  + N++ +Y+RDLK    F+ N +   S +     ++  +L HL        +
Sbjct: 11  FLIVEKGLAKNSVDSYQRDLKNYMKFIQNVDSAESWNDVQRVNITGFLGHLKNEGKSAKT 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R ++ IR F+ FL  E +   +PS  +E PK    LPK L  D +  LLE  +     
Sbjct: 71  VARHVASIRSFHQFLLREKVTDQDPSIHIESPKMERSLPKVLSIDEVEALLEAPQE---- 126

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RVSEL+ L    ++L    +   GKGNKER++ +  +
Sbjct: 127 ---SSALGIRDKAMLEVLYATGIRVSELIRLKMDDVHLKMGFVRCIGKGNKERIIPIGKA 183

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A+  L+ Y        ++             G    +     +    A      K ++PH
Sbjct: 184 AITVLEKYLLEGRPKLVSKKHKDDSLFLNHHGKGLSRQGFWKILKGLAAEAKITKELTPH 243

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +++ +   +HP A
Sbjct: 244 TLRHSFATHLLENGADLRAVQEMLGHVDISTTQIYTHVTKTRMKDVYSKFHPRA 297


>gi|283835346|ref|ZP_06355087.1| tyrosine recombinase XerD [Citrobacter youngae ATCC 29220]
 gi|291068511|gb|EFE06620.1| tyrosine recombinase XerD [Citrobacter youngae ATCC 29220]
          Length = 298

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 114/291 (39%), Positives = 174/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L+++ +SL+ A ++ L + L          +S  R
Sbjct: 15  LWLERNLAENTLSAYRRDLSMLVEWLHHRGVSLATAQSDDLQALLAERMDGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R+F+  L  E  R+D+PS +L  PK    LPK L +  +  LL+   IE      
Sbjct: 75  LLSATRRFFQHLYREKYREDDPSASLASPKLPQRLPKDLSEAQVERLLQAPLIE------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDVSLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|229031733|ref|ZP_04187726.1| Tyrosine recombinase xerD [Bacillus cereus AH1271]
 gi|228729617|gb|EEL80604.1| Tyrosine recombinase xerD [Bacillus cereus AH1271]
          Length = 296

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 110/293 (37%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  S    +  H++++L HL +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYVKYLQNVEQAKSFHEVTRLHIVNFLQHLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSIDEVEALLQTPKMTSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GVRDKAMLELLYATGLRVSELIALNLEDIHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKRVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKARLKDVYKQFHPRA 296


>gi|306836032|ref|ZP_07469022.1| tyrosine recombinase XerD [Corynebacterium accolens ATCC 49726]
 gi|304568059|gb|EFM43634.1| tyrosine recombinase XerD [Corynebacterium accolens ATCC 49726]
          Length = 296

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 96/292 (32%), Positives = 156/292 (53%), Gaps = 11/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NTLS Y+RD++   ++L +  +  L   +   + +YL  L ++ +  SS  
Sbjct: 15  LAVERGVSANTLSNYRRDIRRYVDWLADNGVQDLRQVTRPMVEAYLKDLREK-MAVSSAN 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R + V R  + F   EG    + +  +  P     LP+TL  D ++ L+E    E     
Sbjct: 74  RALIVARGLHKFAVAEGEVDSDVAAEVSPPSTGQHLPETLSVDEVSRLIESTPTE----- 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   L+E+LY TG R+SE+++L+   +   +  +++ GKG+KERLV L   A 
Sbjct: 129 --TPVDLRDRALLEVLYGTGARISEVISLNVDDVATADDVLMLHGKGDKERLVPLGSHAR 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  Y      +   G    LF ++       +  ++      AA+     K+ISPH +
Sbjct: 187 QAIDAYLVRARPVLGKGKTAALFLNTRGGALSRQSAWSIIKT--AAQRSQLDKSISPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLEGGAD+RT+Q LLGH+ ++TTQIYTH+  D L+++ +  HP A
Sbjct: 245 RHSFATHLLEGGADVRTVQELLGHSSVTTTQIYTHVTADSLREVWRTAHPRA 296


>gi|16127236|ref|NP_421800.1| integrase/recombinase XerD [Caulobacter crescentus CB15]
 gi|221236037|ref|YP_002518474.1| integrase/recombinase [Caulobacter crescentus NA1000]
 gi|34223000|sp|Q9A437|XERD_CAUCR RecName: Full=Tyrosine recombinase xerD
 gi|13424644|gb|AAK24968.1| integrase/recombinase XerD [Caulobacter crescentus CB15]
 gi|220965210|gb|ACL96566.1| integrase/recombinase (XerD/RipX family) [Caulobacter crescentus
           NA1000]
          Length = 305

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 124/297 (41%), Positives = 177/297 (59%), Gaps = 8/297 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MM+ ERA++ NTL+AY +DL++ + FL+     L  A    + +Y   L  R L  ++  
Sbjct: 14  MMAVERAAARNTLTAYGKDLEDARGFLSRSGHDLHDADAETIEAYFQDLGARGLSPATAA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+ S +RQFY F+  EG R D+PS  +  PK    LPK L +D I  LL  A       A
Sbjct: 74  RRRSAVRQFYRFVLGEGWRTDDPSRRVAAPKAGRPLPKVLERDEIERLLAAAS------A 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               + +R+  +IEL+YA+G+R+SEL+ L    L      +I++GKG KERL  L+ +A 
Sbjct: 128 KDSAQGLRLACMIELIYASGLRISELLALPLLALARDPAYLIVKGKGGKERLAPLNDAAR 187

Query: 181 HALQMYKKTCSSMKMTG--NDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            A++ Y     +    G  +  WLFPS   TG L+ +   + L+  A  AGI ++ +SPH
Sbjct: 188 AAVKAYLVERPAFLPKGQKDSPWLFPSRGATGRLTPRRVGQLLEDAAIAAGIDRQKVSPH 247

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           ++RHAFA+HLLEGGADLR IQ LLGH DI+TTQIYTH+  + L  +VQ  HPL +K+
Sbjct: 248 VLRHAFATHLLEGGADLRVIQTLLGHADIATTQIYTHVAGEHLAHIVQTKHPLGRKK 304


>gi|116491033|ref|YP_810577.1| tyrosine recombinase XerD subunit [Oenococcus oeni PSU-1]
 gi|290890513|ref|ZP_06553588.1| hypothetical protein AWRIB429_0978 [Oenococcus oeni AWRIB429]
 gi|116091758|gb|ABJ56912.1| tyrosine recombinase XerD subunit [Oenococcus oeni PSU-1]
 gi|290479909|gb|EFD88558.1| hypothetical protein AWRIB429_0978 [Oenococcus oeni AWRIB429]
          Length = 302

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 93/292 (31%), Positives = 151/292 (51%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           + +E+    N++ +YK+DL E   ++  + I L       ++ +LN+L       +S   
Sbjct: 19  LRTEQGLLENSIKSYKQDLSEFGAYIQKENILLVKVDRFTILDWLNYLQNSGKSNNSIVH 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+ +L  +   + +P   +  PKKN  LP+ L    I  +L            
Sbjct: 79  MVSSLRKFFAYLSDDQQIQIDPMLKVTTPKKNSHLPQVLTATEIEAVLAVP-------DI 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   L+E +YATG RVSE+  L    L+     +   GKG K+R+V +   +L 
Sbjct: 132 STTLGLRNRALLETMYATGFRVSEICNLKLADLHDELGLITTIGKGQKQRIVPIGEMSLL 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            +  Y K    + +   +      +     +SRQ   + +K +A +AGI  K+ISPH +R
Sbjct: 192 YISKYFKESRPILLKDKESPYLFLNDHGHRISRQGIFKLVKEIAIKAGID-KDISPHTLR 250

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           H+FA++LLE GADLR +Q LLGH+DISTTQIYTH+    +++    +HP AK
Sbjct: 251 HSFATNLLENGADLRIVQELLGHSDISTTQIYTHVSQKHIREQYNRFHPRAK 302


>gi|188534907|ref|YP_001908704.1| Tyrosine recombinase XerD [Erwinia tasmaniensis Et1/99]
 gi|188029949|emb|CAO97833.1| Tyrosine recombinase XerD [Erwinia tasmaniensis Et1/99]
          Length = 297

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 172/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NT+++Y+ DL+ + ++L  + +SL  A    L ++L    +     SS  R
Sbjct: 14  LWIERNLAQNTVASYRLDLRSLCDWLACQPLSLLNAQAIDLRAFLAQRLEGGYKASSSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+PS  L  PK    LPK L +  +  LL+   +E      
Sbjct: 74  LLSAMRRLFQYLYREKLREDDPSALLSSPKLPQRLPKDLSEAQVERLLQSPCLE------ 127

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++ELLYATG+RV+ELV L+   ++L +  + + GKGNKERLV +   A+H
Sbjct: 128 -QPIELRDKAMLELLYATGLRVTELVGLTLSDISLRQGVVRVLGKGNKERLVPMGEEAVH 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ + +      + G  L +   S +   ++RQ F   +K  A  AGI    +SPH++R
Sbjct: 187 WIEQFIEYGRPWLLNGQTLDVLFPSNRAKQMTRQTFWHRIKHYATLAGIDSDKLSPHVLR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 247 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 297


>gi|220921142|ref|YP_002496443.1| tyrosine recombinase XerD [Methylobacterium nodulans ORS 2060]
 gi|219945748|gb|ACL56140.1| tyrosine recombinase XerD [Methylobacterium nodulans ORS 2060]
          Length = 308

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 112/292 (38%), Positives = 153/292 (52%), Gaps = 3/292 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER +S NTL+AY+RDL +    L  + +  +A     + +Y+  L  R L  SS  
Sbjct: 18  MLAAERGASANTLAAYRRDLDDYLAHLAAEGLDPAAVEAPMIRAYMADLDARGLKASSAA 77

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S IR F+ FL  EG    +P+  +  PK+   LPK L    +  LL  A  EA   A
Sbjct: 78  RRLSCIRGFHRFLYAEGYAPTDPTAPVSGPKRGRALPKVLSVAEVDRLLSVA-KEAVAQA 136

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           P   +  R   L+ LL         +  L A                 K     L P   
Sbjct: 137 PNLSEAARAQRLLCLLELLYATGLRVSELVALPRAAALTRERYLVVRGKGGRERLVPLTE 196

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A        + +   G  L+   S   +GHL+RQ FARDLK  AA AGI+   +SPH++
Sbjct: 197 AARAAMAAHLTMLAAPGPWLFPADSE--SGHLTRQAFARDLKLAAAAAGIRADRVSPHVL 254

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L+ +V+D HPLA
Sbjct: 255 RHAFASHLLQNGADLRVVQELLGHADISTTQIYTHVLDERLKSMVRDLHPLA 306


>gi|146312952|ref|YP_001178026.1| site-specific tyrosine recombinase XerD [Enterobacter sp. 638]
 gi|145319828|gb|ABP61975.1| tyrosine recombinase XerD subunit [Enterobacter sp. 638]
          Length = 298

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTLSAY+RDL  +  +L ++ +SL  A  + L + L          +S  R
Sbjct: 15  LWLEKNLAENTLSAYRRDLTMLAEWLAHRGLSLEQAQRDDLQTLLAERMDGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ +  L  E LR D+PS  L  PK    LPK L +  +  LL+   ++      
Sbjct: 75  LLSAMRRLFQHLYREKLRADDPSALLASPKLPQRLPKDLSEAQVDRLLQSPTVDV----- 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 --PLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WVETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYATLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|78222639|ref|YP_384386.1| tyrosine recombinase XerD subunit [Geobacter metallireducens GS-15]
 gi|78193894|gb|ABB31661.1| tyrosine recombinase XerD subunit [Geobacter metallireducens GS-15]
          Length = 295

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 105/292 (35%), Positives = 158/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+  + N+L +Y RD+    +FL  +     SA     +  +L HL    L   S+ 
Sbjct: 12  LLVEKGLAKNSLDSYGRDMIRYLDFLEKRNCGEPSAVRPVDVADFLAHLKDCGLAPRSRA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R F+ FL  EG  + NP+  +E PK    LP+ L    +  LL     ++    
Sbjct: 72  RALSAVRMFHRFLLVEGYAEANPTAIIEAPKTLAKLPQILAGREVEALLAAPGSDS---- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               + +R   ++ELLYATG+RVSELV L    +N+T   ++  GKG KERLV +  SA 
Sbjct: 128 ---AQDMRDRAMLELLYATGLRVSELVGLGLRDVNVTAGYLMAFGKGGKERLVPMGESAC 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  Y            D      +     ++RQ F   +K  A  AGI +K ISPH +
Sbjct: 185 AAVSRYLAEARPEMDRNGDNAYLFLTRLGDRMTRQAFWNIIKKRAIEAGI-RKTISPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++Q +LGH D++TTQIYTH+  ++L+++ ++YHP  
Sbjct: 244 RHSFATHLLENGADLRSVQAMLGHADLATTQIYTHVTRERLKRIHEEYHPRG 295


>gi|283479632|emb|CAY75548.1| Tyrosine recombinase xerD [Erwinia pyrifoliae DSM 12163]
          Length = 316

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 172/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NT+ +Y+ DL+ + ++L ++++SL      +L  +L    +     +S  R
Sbjct: 33  LWIERNLAQNTVDSYRLDLRSLGDWLAHQQLSLLNVEVFNLQEFLAQRLEGGYKATSSAR 92

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+PS  L  PK    LPK L +  +  LL+   +E      
Sbjct: 93  LLSAMRRLFQYLYREKLREDDPSALLSSPKLPQRLPKDLSEAQVERLLQAPCLE------ 146

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++ELLYATG+RV+ELV L+   ++L +  + + GKGNKERLV +   A+H
Sbjct: 147 -QPIELRDKAMLELLYATGLRVTELVGLTLSDISLRQGVVRVIGKGNKERLVPMGEEAVH 205

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  + +   S +   ++RQ F   +K  A  AGI    +SPH++R
Sbjct: 206 WIEQYIEYGRPWLLNGQTIDVLFPSNRAKQMTRQTFWHRIKHYATLAGIDSDKLSPHVLR 265

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 266 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 316


>gi|259909555|ref|YP_002649911.1| Tyrosine recombinase [Erwinia pyrifoliae Ep1/96]
 gi|224965177|emb|CAX56709.1| Tyrosine recombinase [Erwinia pyrifoliae Ep1/96]
          Length = 309

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 172/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NT+ +Y+ DL+ + ++L ++++SL      +L  +L    +     +S  R
Sbjct: 26  LWIERNLAQNTVDSYRLDLRSLGDWLAHQQLSLLNVEVFNLQEFLAQRLEGGYKATSSAR 85

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+PS  L  PK    LPK L +  +  LL+   +E      
Sbjct: 86  LLSAMRRLFQYLYREKLREDDPSALLSSPKLPQRLPKDLSEAQVERLLQAPCLE------ 139

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++ELLYATG+RV+ELV L+   ++L +  + + GKGNKERLV +   A+H
Sbjct: 140 -QPIELRDKAMLELLYATGLRVTELVGLTLSDISLRQGVVRVIGKGNKERLVPMGEEAVH 198

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  + +   S +   ++RQ F   +K  A  AGI    +SPH++R
Sbjct: 199 WIEQYIEYGRPWLLNGQTIDVLFPSNRAKQMTRQTFWHRIKHYATLAGIDSDKLSPHVLR 258

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 259 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 309


>gi|253699136|ref|YP_003020325.1| tyrosine recombinase XerC [Geobacter sp. M21]
 gi|251773986|gb|ACT16567.1| tyrosine recombinase XerC [Geobacter sp. M21]
          Length = 293

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 98/295 (33%), Positives = 146/295 (49%), Gaps = 15/295 (5%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISL--SAASTNHLISYLNHLSQRKLVTSSQ 59
           + +ER  S +TL+AY+ DL++  +FL  +             +  YL  L  +    SS 
Sbjct: 12  LETERNVSPHTLAAYRSDLEQFLSFLAKEREEPRAEEVDHLAIRRYLAQLH-KGCAKSSI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            RK+S IR  Y +L  EG  + NP++ +  PK+   LP  L+ D ++ L+          
Sbjct: 71  GRKLSAIRALYRYLMREGKLEKNPAELVSTPKREKRLPFHLNIDQVSALVTAP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
           A G    +R   ++E LY+ G+RVSEL  ++   ++L      + GKG KERLV +   A
Sbjct: 124 AGGSELPLRDRAILETLYSCGIRVSELTGMNVGDMDLAAGLARVMGKGGKERLVPVGSCA 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             AL  Y    +        +        T     ++    +  +A       + +SPH 
Sbjct: 184 GSALAAYLAERADPGPAEPLILNARGGRLTRRSVARIVDAHMLMIATM-----RKVSPHT 238

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           +RH FA+HLLEGGADLR IQ LLGH  +STTQ YTH+  DKL ++    HP A+K
Sbjct: 239 LRHTFATHLLEGGADLRAIQELLGHASLSTTQKYTHVSIDKLMEVYDKSHPKARK 293


>gi|300767490|ref|ZP_07077402.1| tyrosine recombinase XerD [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|300495309|gb|EFK30465.1| tyrosine recombinase XerD [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
          Length = 305

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 93/294 (31%), Positives = 149/294 (50%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  ER    NT+ +Y +DL     +L +++I          L++YL +L +     ++ 
Sbjct: 20  FLRVERGLVENTIKSYSQDLTTFSEYLMSQQITDYRVVDRYVLLNYLQYLDEAGKSRNTI 79

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
              +S +R+F+ +L        +P   ++ PK+   LP+ L    +  LL          
Sbjct: 80  IHSVSSLRKFFQYLAQMHAIDTDPMLKIDTPKRAQHLPQVLSPREVERLLAVP------- 132

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP-S 178
                  +R   L+E++YATG+RVSE + L+   L+L    +   GKG+KER++ +   +
Sbjct: 133 KLNTPLGLRDRTLLEVMYATGLRVSETINLTMDDLHLDLGLIQTIGKGDKERIIPIGDVA 192

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
                +  K     +            +   G LSRQ   ++LKA    AGI+ KN++PH
Sbjct: 193 IDFITRYLKTARPKLVSAKRRNSYLFINNHGGKLSRQGVWKNLKAEVKAAGIE-KNVTPH 251

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+H+LE GADLR +Q LLGH DISTTQIYTH+   +L ++   YHP A
Sbjct: 252 TLRHSFATHILENGADLRVVQELLGHADISTTQIYTHISKKRLAEVYNKYHPRA 305


>gi|28378545|ref|NP_785437.1| integrase/recombinase [Lactobacillus plantarum WCFS1]
 gi|254556759|ref|YP_003063176.1| integrase/recombinase [Lactobacillus plantarum JDM1]
 gi|308180702|ref|YP_003924830.1| integrase/recombinase [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|28271381|emb|CAD64286.1| integrase/recombinase [Lactobacillus plantarum WCFS1]
 gi|254045686|gb|ACT62479.1| integrase/recombinase [Lactobacillus plantarum JDM1]
 gi|308046193|gb|ADN98736.1| integrase/recombinase [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 296

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 93/294 (31%), Positives = 149/294 (50%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  ER    NT+ +Y +DL     +L +++I          L++YL +L +     ++ 
Sbjct: 11  FLRVERGLVENTIKSYSQDLTTFSEYLMSQQITDYRVVDRYVLLNYLQYLDEAGKSRNTI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
              +S +R+F+ +L        +P   ++ PK+   LP+ L    +  LL          
Sbjct: 71  IHSVSSLRKFFQYLAQMHAIDTDPMLKIDTPKRAQHLPQVLSPREVERLLAVP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP-S 178
                  +R   L+E++YATG+RVSE + L+   L+L    +   GKG+KER++ +   +
Sbjct: 124 KLNTPLGLRDRTLLEVMYATGLRVSETINLTMDDLHLDLGLIQTIGKGDKERIIPIGDVA 183

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
                +  K     +            +   G LSRQ   ++LKA    AGI+ KN++PH
Sbjct: 184 IDFITRYLKTARPKLVSAKRRNSYLFINNHGGKLSRQGVWKNLKAEVKAAGIE-KNVTPH 242

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+H+LE GADLR +Q LLGH DISTTQIYTH+   +L ++   YHP A
Sbjct: 243 TLRHSFATHILENGADLRVVQELLGHADISTTQIYTHISKKRLAEVYNKYHPRA 296


>gi|229061434|ref|ZP_04198779.1| Tyrosine recombinase xerC [Bacillus cereus AH603]
 gi|228717857|gb|EEL69505.1| Tyrosine recombinase xerC [Bacillus cereus AH603]
          Length = 301

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 153/294 (52%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L  +KL   S  
Sbjct: 16  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDQKLARKSVA 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG +KDNP     LPKK   +PK L+ + +  L E          
Sbjct: 76  RKVSSLRSLYRFLMREGYQKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            G     R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 129 TGAPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 188

Query: 181 HALQMYKKTCSSM--KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +       + T     +   + K   L+ Q     L  L  +A +  + ISPH
Sbjct: 189 DALITYIENGRKQLAQKTEEQSHMVFLNAKGKPLTDQGVRYVLNELIKKASLTMR-ISPH 247

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 248 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 301


>gi|163941569|ref|YP_001646453.1| site-specific tyrosine recombinase XerC [Bacillus
           weihenstephanensis KBAB4]
 gi|229013014|ref|ZP_04170179.1| Tyrosine recombinase xerC [Bacillus mycoides DSM 2048]
 gi|229134638|ref|ZP_04263448.1| Tyrosine recombinase xerC [Bacillus cereus BDRD-ST196]
 gi|229168570|ref|ZP_04296293.1| Tyrosine recombinase xerC [Bacillus cereus AH621]
 gi|163863766|gb|ABY44825.1| tyrosine recombinase XerC [Bacillus weihenstephanensis KBAB4]
 gi|228614976|gb|EEK72078.1| Tyrosine recombinase xerC [Bacillus cereus AH621]
 gi|228648899|gb|EEL04924.1| Tyrosine recombinase xerC [Bacillus cereus BDRD-ST196]
 gi|228748268|gb|EEL98128.1| Tyrosine recombinase xerC [Bacillus mycoides DSM 2048]
          Length = 301

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 153/294 (52%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L  +KL   S  
Sbjct: 16  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDQKLARKSVA 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG +KDNP     LPKK   +PK L+ + +  L E          
Sbjct: 76  RKVSSLRSLYRFLMREGYQKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            G     R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 129 TGAPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 188

Query: 181 HALQMYKKTCSSM--KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +       + T     +   + K   L+ Q     L  L  +A +  + ISPH
Sbjct: 189 DALITYIENGRKQLAQKTEEQSHMVFLNAKGKPLTDQGVRYVLNELIKKASLTMR-ISPH 247

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 248 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 301


>gi|313837516|gb|EFS75230.1| tyrosine recombinase XerD [Propionibacterium acnes HL037PA2]
 gi|314927276|gb|EFS91107.1| tyrosine recombinase XerD [Propionibacterium acnes HL044PA1]
 gi|314972722|gb|EFT16819.1| tyrosine recombinase XerD [Propionibacterium acnes HL037PA3]
 gi|328907874|gb|EGG27637.1| site-specific tyrosine recombinase XerD [Propionibacterium sp. P08]
          Length = 306

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 92/297 (30%), Positives = 150/297 (50%), Gaps = 13/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+ AY+RDL   Q +L+++ I SL+  +   +  +  +L Q  L  +S  
Sbjct: 16  LVVERGLSDNTVQAYRRDLLRYQKYLDSRGIRSLAEVTRVDVEEFRRYLDQLGLAPASVT 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +  +R  ++F    G  K + +  +    ++  LPK L  + +  LL           
Sbjct: 76  RCVVAVRNLHHFAVESGQAKTDVTAGISPGTRSRRLPKALTMEQVEALLAAP-------D 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTM----IIQGKGNKERLVILS 176
               + +R   L+ELLY TG RVSE+  L    +            + GKG+KER+V L 
Sbjct: 129 TSTVEGLRDTALLELLYGTGARVSEVCALDVDDIRPVLDDPDLGLRLIGKGDKERIVPLG 188

Query: 177 PSALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
             A  A+  +      +    GN       +T+   LSRQ     ++     AG+  +++
Sbjct: 189 SYAAQAVDAWLVRGRPAWAQLGNGEHALLLNTRGRRLSRQSAWTVIRRAGEAAGLDVEHL 248

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH +RH++A+HLL+GGAD+R +Q LLGH+ ++TTQIYT +  D L+++ +  HP A
Sbjct: 249 SPHSLRHSYATHLLDGGADIRVVQELLGHSSVTTTQIYTLVTADHLREVYRSSHPRA 305


>gi|251791941|ref|YP_003006661.1| site-specific tyrosine recombinase XerD [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533328|gb|ACS96574.1| tyrosine recombinase XerD [Aggregatibacter aphrophilus NJ8700]
          Length = 297

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 105/289 (36%), Positives = 164/289 (56%), Gaps = 7/289 (2%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ +Y+ DL  + ++L   ++SL       L ++L    Q+    +S  R +
Sbjct: 16  IEKGLSPNTVQSYRLDLTALCDWLEVHKLSLLTLDAVDLQTFLGERLQQGYKATSTARLL 75

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
           S +R+ + +L  E  R D+PS  L  PK    LPK L +  + +LL          +  Q
Sbjct: 76  SAMRKLFQYLYKEKYRTDDPSAVLSSPKLPSRLPKYLTEQQVTDLLNV-------QSLEQ 128

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYATG+RV+ELVTL   ++NL +  + + GKGNKER+V +   A H +
Sbjct: 129 PVELRDKAMLELLYATGLRVTELVTLGTDSINLNQGVVRVIGKGNKERIVPMGEEATHWI 188

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
           + Y      + + G    +   S +   ++RQ F   +K  A RA I    +SPH++RHA
Sbjct: 189 KQYILFVRPILLDGQSSDVLFPSRRGTQMTRQTFWHRIKHYAVRAEIDSDMLSPHVLRHA 248

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FA+HL+  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L + YHP  
Sbjct: 249 FATHLVNHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKRLHERYHPRG 297


>gi|327440847|dbj|BAK17212.1| site-specific recombinase XerD [Solibacillus silvestris StLB046]
          Length = 300

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 99/294 (33%), Positives = 152/294 (51%), Gaps = 9/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFL--NNKEISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S NTL +YKRDL      +    + +        H++ YL+ L      + +
Sbjct: 14  FIKVERQLSDNTLQSYKRDLVAYARHIHYEQQIMEFDNVMREHILLYLDSLRSVGKSSKT 73

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R+IS IR F+ FL  E +   +P+  LE+PKK   LPK L  + I  LL    +E   
Sbjct: 74  ISRQISSIRSFHQFLLREKVTNQDPTVHLEMPKKELSLPKVLSIEEIDALLTAPSVE--- 130

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
               + +  R   ++E++Y +GMR+SEL+ L+   ++LT   + + GKG KER++ L  S
Sbjct: 131 ----KPQGTRDIAILEMMYGSGMRISELIDLNLEDVHLTMGFVRVFGKGGKERIIPLGRS 186

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A+ A   Y +      +           T+ G    +     +    A      K I+PH
Sbjct: 187 AIQACINYLEQARPQLLGDALKNDAFFITQRGKRFTRQGCWKIIKEHAATAGISKEITPH 246

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH+FA+HL+E GADLR +Q LLGH DISTTQIYTH+   +L ++ + +HP A
Sbjct: 247 VLRHSFATHLIENGADLRAVQELLGHADISTTQIYTHVSKTRLSEVYKQFHPRA 300


>gi|331701395|ref|YP_004398354.1| Tyrosine recombinase xerC [Lactobacillus buchneri NRRL B-30929]
 gi|329128738|gb|AEB73291.1| Tyrosine recombinase xerC [Lactobacillus buchneri NRRL B-30929]
          Length = 296

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 96/291 (32%), Positives = 151/291 (51%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT+ +Y++DL+E   F +    S++      ++ YL  L ++    ++  R
Sbjct: 13  LRVERGLSDNTIKSYRQDLQEAGAFFDKHAKSIADIDQFVILDYLETLQRQHKARNTVIR 72

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+ +L    +  D+P   ++ PKK   LP  L    +  LL         P  
Sbjct: 73  VVSTLRRFFQYLVQFHVIVDDPMLKVDSPKKAQTLPDVLTVAQVNQLLS-------MPDT 125

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +   +R   ++E LYATG+RVSELV L    L+L    +   GKG+KER++ +S  A+ 
Sbjct: 126 HKKLGLRDRAILETLYATGLRVSELVNLKLGDLHLPMNLLQTIGKGDKERIIPISDVAID 185

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L  Y ++     ++G     F      GH   +     +          K++++PH +R
Sbjct: 186 WLNQYIQSTRVQLLSGRPNSEFLFLNAHGHQLTRQAIWQMIKKYVNQAGIKRHVTPHTLR 245

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE GADLR +Q LLGH+DISTTQIYTH+    L ++   YHP A
Sbjct: 246 HSFATHLLENGADLRIVQELLGHSDISTTQIYTHVSHKHLTEVYNKYHPRA 296


>gi|261820181|ref|YP_003258287.1| site-specific tyrosine recombinase XerD [Pectobacterium wasabiae
           WPP163]
 gi|261604194|gb|ACX86680.1| tyrosine recombinase XerD [Pectobacterium wasabiae WPP163]
          Length = 299

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 108/291 (37%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL+ +  +L +++          L ++L          +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLRTLAEWLAHRDNDFLQVQALDLQAFLADRVDGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+ +L  E LR D+PS  L  PK    LPK L +  +  LL+   IE      
Sbjct: 76  LLSAMRRFFQYLYREKLRSDDPSAVLSSPKLPLRLPKDLSEAQVGALLDAPSIE------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDVSLRQGVVRVLGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S +   ++RQ F   +K  A +A I  + +SPH++R
Sbjct: 189 WIEYYLEHGRPWLLNGQTLDVLFPSNRARQMTRQTFWHRIKHYAVQASIDSEKLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|229086384|ref|ZP_04218560.1| Tyrosine recombinase xerC [Bacillus cereus Rock3-44]
 gi|228696900|gb|EEL49709.1| Tyrosine recombinase xerC [Bacillus cereus Rock3-44]
          Length = 302

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 149/294 (50%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 17  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYVDVRLYLTTLHDEKLARKSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG R+DNP     LPKK   +PK L+ + +  L E          
Sbjct: 77  RKVSSLRSLYRFLMREGYREDNPFALASLPKKEWSIPKFLYVEELEKLFEV-------SD 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V+L    ++ +  T+++ GKG K+R +     A 
Sbjct: 130 VKTPLGQRNQALLELMYATGIRVSECVSLQFTDIDFSVGTILVTGKGKKQRYIPFGSYAQ 189

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          +              L+ +     L  L  +A +  K ISPH
Sbjct: 190 DALTTYIENGRKQLAKKTEEHSQMVFLNAKGAPLTDRGVRYILNDLIKKASLTMK-ISPH 248

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 249 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 302


>gi|253732140|ref|ZP_04866305.1| site-specific recombinase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253724095|gb|EES92824.1| site-specific recombinase [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
          Length = 295

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 105/293 (35%), Positives = 156/293 (53%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ Q+++    IS +       +   L HL  +     S 
Sbjct: 11  FIQIEKGLSSNTIGAYRRDLKKYQDYMTEHHISHIDFIDRQLIQECLGHLIDQGQSAKSI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  L+ PK +  LP  L+ D +  LLE         
Sbjct: 71  ARFISTIRSFHQFAIREKYAVKDPTVLLDSPKYDKKLPDVLNVDEVLALLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSEL+ L    +NL    + + GKG+KER+V L  + 
Sbjct: 124 DLNKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIVPLGDAV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +      +   +     LSRQ   + +K    +A I KK ++PH 
Sbjct: 184 IEYLTTYIETIRPQLLKKTVTEVLFLNMHGKPLSRQAIWKMIKQNGVKANI-KKTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQFHPRA 295


>gi|94969888|ref|YP_591936.1| tyrosine recombinase XerD subunit [Candidatus Koribacter versatilis
           Ellin345]
 gi|94551938|gb|ABF41862.1| tyrosine recombinase XerD subunit [Candidatus Koribacter versatilis
           Ellin345]
          Length = 313

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 97/295 (32%), Positives = 167/295 (56%), Gaps = 4/295 (1%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S  ++SAY +D+++   FL  ++ SL AA    +  +L+ L   +L   +  R
Sbjct: 18  LRVEKGLSRLSVSAYSKDMQQFAEFLAKRKRSLDAAKRQDVRDFLDSLFSNQLDGRTVAR 77

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           K+S  RQFY +L  +   + +P+  +E P++  +LPK+L  D +   L+      +    
Sbjct: 78  KLSSSRQFYKYLLLDRRIEHDPTLNIESPRQWKVLPKSLSADEVLQTLQGPPRVLDT-KE 136

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+ YA  +RVSE++ +      L    M+++GKG+KER+V L  SAL 
Sbjct: 137 SQALALRDRAMLEVFYAGALRVSEMIGVRMEDAKLDLGYMMVRGKGDKERIVPLGQSALV 196

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           A++ Y ++   +   G    +         LSRQ   + + A +  +G   ++ SPH++R
Sbjct: 197 AVKSYLESGREVLCAGKTSPILFVGKGCRKLSRQRVWQMVSAASQASG---RHASPHMLR 253

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           H+ A+H++E GADLRT+Q +LGH DISTTQIYTHL  D+L+++ + +HP +K+  
Sbjct: 254 HSCATHMVENGADLRTVQTILGHADISTTQIYTHLALDRLKQVHRTFHPRSKRRN 308


>gi|229163028|ref|ZP_04290984.1| Tyrosine recombinase xerD [Bacillus cereus R309803]
 gi|228620434|gb|EEK77304.1| Tyrosine recombinase xerD [Bacillus cereus R309803]
          Length = 296

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 109/293 (37%), Positives = 165/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  +    +  H++++L HL +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYVKYLQNVEQTKTFHEVTRLHIVNFLQHLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSVDEVEALLQTPKMTSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GVRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|119026091|ref|YP_909936.1| tyrosine recombinase xerD [Bifidobacterium adolescentis ATCC 15703]
 gi|154488864|ref|ZP_02029713.1| hypothetical protein BIFADO_02172 [Bifidobacterium adolescentis
           L2-32]
 gi|118765675|dbj|BAF39854.1| tyrosine recombinase xerD [Bifidobacterium adolescentis ATCC 15703]
 gi|154083001|gb|EDN82046.1| hypothetical protein BIFADO_02172 [Bifidobacterium adolescentis
           L2-32]
          Length = 317

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 88/307 (28%), Positives = 149/307 (48%), Gaps = 14/307 (4%)

Query: 1   MMS---SERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVT 56
            ++    ER  +  T+ AY  DL++   +L  + I  L+A +T  +  Y+  L       
Sbjct: 11  FLAYIDVERGLAKATVRAYDSDLRKYNGWLATQGIQDLNAVTTQDVERYIAFLDDSGESA 70

Query: 57  SSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQA---- 112
            S+ R+++ I  F+ F   E +  ++ +  ++ PK    LP  L  D +A+LL+      
Sbjct: 71  RSKARRLASIHAFHRFALNEHVVSNDVAAQVKAPKGATTLPDVLTVDEVASLLDAIPVSQ 130

Query: 113 ---KIEAENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNK 169
              + E     P     +R   L+E +YATG RVSE    +   ++L      + GKG+K
Sbjct: 131 NRPQSEGMADMPDDPAMLRDKALLEFMYATGARVSEACGANLDDVDLESNVARLMGKGSK 190

Query: 170 ERLVILSPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAG 229
           +RLV +   A  A+  Y K       +         +       +++  + +  +   AG
Sbjct: 191 QRLVPVGSYACEAIARYLKNGRPQLESKAKGPTERRALFLNKRGKRLSRQSVWEIIRAAG 250

Query: 230 IQ---KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQ 286
            +    K + PH +RH+FA+HL++GGAD+RT+Q LLGH  ++TTQIYTH+ P+ L +   
Sbjct: 251 ERAHIDKPLHPHTLRHSFATHLIQGGADVRTVQELLGHASVTTTQIYTHVSPENLIETYL 310

Query: 287 DYHPLAK 293
             HP A+
Sbjct: 311 TSHPRAR 317


>gi|242242770|ref|ZP_04797215.1| tyrosine recombinase XerD [Staphylococcus epidermidis W23144]
 gi|242233906|gb|EES36218.1| tyrosine recombinase XerD [Staphylococcus epidermidis W23144]
          Length = 295

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 103/293 (35%), Positives = 154/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ +++L + +IS +       +   L HL      + S 
Sbjct: 11  FIQIEKGLSNNTIGAYRRDLKKYKDYLEDNKISHIDFIDRQIIQECLGHLIDMGQSSKSL 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  +E PK    LP  L  D +  LLE         
Sbjct: 71  ARFISTIRSFHQFALREKYAAKDPTVLIETPKYEKKLPDVLEIDEVIALLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRV+E++ L    +NL    + + GKGNKER+V L  + 
Sbjct: 124 DLAKNNGYRDRTMLELLYATGMRVTEIIQLDVEDVNLMMGFVRVFGKGNKERIVPLGDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +          +     LSRQ   + +K    +A I  K ++PH 
Sbjct: 184 IEYLTTYIETVRPQLLKQTTTQALFLNMHGKSLSRQGIWKIIKQYGLKANIN-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYTQFHPRA 295


>gi|217967906|ref|YP_002353412.1| integrase family protein [Dictyoglomus turgidum DSM 6724]
 gi|217337005|gb|ACK42798.1| integrase family protein [Dictyoglomus turgidum DSM 6724]
          Length = 300

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 101/297 (34%), Positives = 151/297 (50%), Gaps = 14/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NTL +Y RDL +   +   K++  +  +  ++ SY+  ++Q+    S+  R
Sbjct: 16  LRFERNYSPNTLRSYLRDLLDFYKYCKEKDLDFT--NKRNIRSYIQFIAQKGYKNSTFVR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           K+  +R F+ +L      K++ +  +  PK    LP+ L  D +  LL          + 
Sbjct: 74  KVISLRSFFEYLLTFEKIKEDLTVFIPTPKIEKKLPQFLSIDEVRKLLNSP-------SL 126

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   +IE LYATG+RVSELV ++   +N     + + GK  KER+VI+    L 
Sbjct: 127 DNLIGIRDRAIIETLYATGIRVSELVGINEEDINWNYGEIRVFGKRAKERVVIVGEETLK 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            LQ+YK       +   +   F ++       R V     K          K ISPH +R
Sbjct: 187 ILQLYKDYVRPKLLKKPEKAFFLNAKGGRISDRGVRMIIKKYTKEF----NKKISPHTLR 242

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA-KKEKK 297
           H FA+HLLEGGADLR +Q LLGH  ISTTQIYTHL  D++++     HP A KKE++
Sbjct: 243 HTFATHLLEGGADLRYVQELLGHVRISTTQIYTHLTTDQIRRTYTVSHPRAIKKERE 299


>gi|311068948|ref|YP_003973871.1| site-specific tyrosine recombinase XerD [Bacillus atrophaeus 1942]
 gi|310869465|gb|ADP32940.1| site-specific tyrosine recombinase XerD [Bacillus atrophaeus 1942]
          Length = 296

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 159/291 (54%), Gaps = 10/291 (3%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNN--KEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
            ER  S NT+ +Y+RDLK    FL    +  S +  +  H+I YL HL        +  R
Sbjct: 14  VERGLSQNTMMSYERDLKSYSLFLTETLQVTSWNEVTRIHIIQYLKHLKDSGKSGKTSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ IR F+ FL  E +   +PS  +E  K    LPK L    +  LL+  K+ +     
Sbjct: 74  HLASIRSFHQFLLREKVTDKDPSVHIETQKTERTLPKVLSLKEVELLLDTPKLTSPF--- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                 R   ++ELLYATG+RVSE++ L    ++L+   +   GKG KER+V +  +A H
Sbjct: 131 ----GYRDKAMLELLYATGIRVSEMIDLKTSDVHLSMGFVRCFGKGRKERIVPIGETAAH 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           A++ Y        +  N       +     +SRQ F ++LK +A  AGI KK ++PH +R
Sbjct: 187 AIEEYLAKARGKLLKKNVSDALFLNHHGKQISRQGFWKNLKKIALEAGI-KKELTPHTLR 245

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + YHP A
Sbjct: 246 HSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYKQYHPRA 296


>gi|319400839|gb|EFV89058.1| tyrosine recombinase XerD [Staphylococcus epidermidis FRI909]
          Length = 295

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 102/293 (34%), Positives = 154/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ +++L + +IS +       +   L HL      + S 
Sbjct: 11  FIQIEKGLSNNTIGAYRRDLKKYKDYLEDNKISHIDFIDRQIIQECLGHLIDMGQSSKSL 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  +E PK    LP  L  + +  LLE         
Sbjct: 71  ARFISTIRSFHQFALREKYAAKDPTVLIETPKYEKKLPDVLEINEVIALLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRV+E++ L    +NL    + + GKGNKER+V L  + 
Sbjct: 124 DLAKNNGYRDRTMLELLYATGMRVTEIIQLDVEDVNLMMGFVRVFGKGNKERIVPLGDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +          +     LSRQ   + +K    +A I  K ++PH 
Sbjct: 184 IEYLTTYIETVRPQLLKQTTTQALFLNMHGKSLSRQGIWKIIKQYGLKANIN-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYTQFHPRA 295


>gi|271499210|ref|YP_003332235.1| tyrosine recombinase XerD [Dickeya dadantii Ech586]
 gi|270342765|gb|ACZ75530.1| tyrosine recombinase XerD [Dickeya dadantii Ech586]
          Length = 299

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 164/291 (56%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLS+Y+ DL  +  +L + +  L  A  + L  +L    +     +S  R
Sbjct: 16  LWLERNLAENTLSSYRNDLSSLAEWLAHHDRHLLEAQPSDLQDFLAERLEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R D+PS  L  PK    LPK L +  +  LL     +      
Sbjct: 76  LLSAMRRLFQYLYREKRRTDDPSAPLSSPKLPQRLPKDLTEAQVEALLAAPVTD------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++ELLYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPIELRDKAMLELLYATGLRVSELVGLTMSDVSLRQGVVRVVGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  L +   S +   ++RQ F   +K  A  A I    +SPH++R
Sbjct: 189 WLEQYLEYSRPWLLNGQTLDVLFPSNRAQQMTRQTFWHRIKHYATLASIDSNKLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|229168834|ref|ZP_04296553.1| Tyrosine recombinase xerD [Bacillus cereus AH621]
 gi|228614682|gb|EEK71788.1| Tyrosine recombinase xerD [Bacillus cereus AH621]
          Length = 296

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 107/293 (36%), Positives = 160/293 (54%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  +    +  H++++L HL +    + + 
Sbjct: 12  MIVEKGLAKNTVVSYERDLKSYVKYLQNVEQTKTFHEVTRLHIVNFLQHLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+         
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSIDEVEALLQTP------- 124

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 125 KTASAFGIRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I  K ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKAVDALFLNHHGNRLSRQGFWKILKRLAKEANI-AKELTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKARLKDVYKQFHPRA 296


>gi|57866964|ref|YP_188637.1| tyrosine recombinase XerD [Staphylococcus epidermidis RP62A]
 gi|293366542|ref|ZP_06613219.1| integrase/recombinase XerD [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|81674519|sp|Q5HP53|XERD_STAEQ RecName: Full=Tyrosine recombinase xerD
 gi|57637622|gb|AAW54410.1| tyrosine recombinase XerD [Staphylococcus epidermidis RP62A]
 gi|291319311|gb|EFE59680.1| integrase/recombinase XerD [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329725406|gb|EGG61889.1| tyrosine recombinase XerD [Staphylococcus epidermidis VCU144]
 gi|329735284|gb|EGG71576.1| tyrosine recombinase XerD [Staphylococcus epidermidis VCU045]
          Length = 295

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 103/293 (35%), Positives = 154/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ +++L + +IS +       +   L HL      + S 
Sbjct: 11  FIQIEKGLSNNTIGAYRRDLKKYKDYLEDNKISHIDFIDRQIIQECLGHLIDMGQSSKSL 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  +E PK    LP  L  D +  LLE         
Sbjct: 71  ARFISTIRSFHQFALREKYAAKDPTVLIETPKYEKKLPDVLEIDEVIALLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRV+E++ L    +NL    + + GKGNKER+V L  + 
Sbjct: 124 DLTKNNGYRDRTMLELLYATGMRVTEIIQLDVEDVNLMMGFVRVFGKGNKERIVPLGDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +          +     LSRQ   + +K    +A I  K ++PH 
Sbjct: 184 IEYLTTYIETVRPQLLKQTTTQALFLNMHGKSLSRQGIWKIIKQYGLKANIN-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYTQFHPRA 295


>gi|229075797|ref|ZP_04208774.1| Tyrosine recombinase xerD [Bacillus cereus Rock4-18]
 gi|229098560|ref|ZP_04229501.1| Tyrosine recombinase xerD [Bacillus cereus Rock3-29]
 gi|229104696|ref|ZP_04235358.1| Tyrosine recombinase xerD [Bacillus cereus Rock3-28]
 gi|229117586|ref|ZP_04246958.1| Tyrosine recombinase xerD [Bacillus cereus Rock1-3]
 gi|228665906|gb|EEL21376.1| Tyrosine recombinase xerD [Bacillus cereus Rock1-3]
 gi|228678760|gb|EEL32975.1| Tyrosine recombinase xerD [Bacillus cereus Rock3-28]
 gi|228684882|gb|EEL38819.1| Tyrosine recombinase xerD [Bacillus cereus Rock3-29]
 gi|228707349|gb|EEL59545.1| Tyrosine recombinase xerD [Bacillus cereus Rock4-18]
          Length = 296

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 109/293 (37%), Positives = 166/293 (56%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L N E   +    +  H++++L +L +    + + 
Sbjct: 12  MIVEKGLAKNTVVSYERDLKSYVKYLQNVEQMKTFHEVTRLHIVNFLQYLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+  K+ +   
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSIDEVEALLQTPKMTSAF- 130

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 131 ------GIRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKVVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKARLKDVYKQFHPRA 296


>gi|218898984|ref|YP_002447395.1| tyrosine recombinase XerC [Bacillus cereus G9842]
 gi|228909656|ref|ZP_04073479.1| Tyrosine recombinase xerC [Bacillus thuringiensis IBL 200]
 gi|228940919|ref|ZP_04103478.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228973848|ref|ZP_04134424.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980438|ref|ZP_04140748.1| Tyrosine recombinase xerC [Bacillus thuringiensis Bt407]
 gi|218544580|gb|ACK96974.1| tyrosine recombinase XerC [Bacillus cereus G9842]
 gi|228779258|gb|EEM27515.1| Tyrosine recombinase xerC [Bacillus thuringiensis Bt407]
 gi|228785873|gb|EEM33876.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228818755|gb|EEM64821.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228849945|gb|EEM94776.1| Tyrosine recombinase xerC [Bacillus thuringiensis IBL 200]
 gi|326941600|gb|AEA17496.1| site-specific tyrosine recombinase XerC [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 299

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 152/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            G     R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TGTPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMK--MTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            +L  Y +         T  D  +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DSLITYIENGRKQLVNKTDEDSRMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|110598394|ref|ZP_01386667.1| Tyrosine recombinase XerD [Chlorobium ferrooxidans DSM 13031]
 gi|110340003|gb|EAT58505.1| Tyrosine recombinase XerD [Chlorobium ferrooxidans DSM 13031]
          Length = 304

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 107/292 (36%), Positives = 153/292 (52%), Gaps = 6/292 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S NT  +Y+ DL+    F+    ISL + + N +  ++  L    L  SS  
Sbjct: 19  ML-IERNFSENTRVSYRNDLERYLLFMQQNAISLESITPNQIREFITELYLTGLEASSLA 77

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS IR  + FL  E     NP++ L  PK+   LP  L  D    LLE   ++     
Sbjct: 78  RNISAIRSLHKFLLSERTTSINPAENLHQPKQARYLPTVLTIDETLRLLEAPLLQ----N 133

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           P     +R   ++ELLYATG+RVSEL+++    L L    + I GKG+KERLV +  +A 
Sbjct: 134 PQSKYFLRDKTIVELLYATGVRVSELISIQQQNLYLEAGFVRIFGKGSKERLVPVGSAAT 193

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +  Y++         N       + +   LSR      ++  A  AGI+ K ISPH  
Sbjct: 194 EWITRYQRELRQGLSGRNSGDYLFLNARGKPLSRMAIFSMVRQYAIIAGIE-KQISPHTF 252

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH FA+HLLEGGADLR +Q +LGH+ ISTTQIYTH+    ++++ + +HP  
Sbjct: 253 RHTFATHLLEGGADLRAVQEMLGHSSISTTQIYTHIDRSFVKEVHKTFHPRG 304


>gi|82751090|ref|YP_416831.1| site-specific recombinase [Staphylococcus aureus RF122]
 gi|82656621|emb|CAI81047.1| site-specific recombinase [Staphylococcus aureus RF122]
          Length = 295

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 105/293 (35%), Positives = 156/293 (53%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ Q+++    IS +       +   L HL  +     S 
Sbjct: 11  FIQIEKGLSSNTIGAYRRDLKKYQDYMTEHHISHIDFIDRQLIQECLGHLIDQGQSAKSI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  L+ PK +  LP  L+ D +  LLE         
Sbjct: 71  ARFISTIRSFHQFAIREKYAAKDPTVLLDSPKYDKKLPDVLNVDEVLALLETL------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSEL+ L    +NL    + + GKG+KER+V L  + 
Sbjct: 124 DLNKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIVPLGDAV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +      +   +     LSRQ   + +K    +A I KK ++PH 
Sbjct: 184 IEYLTTYIETIRPQLLKKTVTEVLFLNMHGKPLSRQAIWKMIKQNGVKANI-KKTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQFHPRA 295


>gi|73748515|ref|YP_307754.1| tyrosine recombinase XerC [Dehalococcoides sp. CBDB1]
 gi|147669296|ref|YP_001214114.1| tyrosine recombinase XerC subunit [Dehalococcoides sp. BAV1]
 gi|289432563|ref|YP_003462436.1| tyrosine recombinase XerC [Dehalococcoides sp. GT]
 gi|73660231|emb|CAI82838.1| tyrosine recombinase XerC [Dehalococcoides sp. CBDB1]
 gi|146270244|gb|ABQ17236.1| tyrosine recombinase XerC subunit [Dehalococcoides sp. BAV1]
 gi|288946283|gb|ADC73980.1| tyrosine recombinase XerC [Dehalococcoides sp. GT]
          Length = 307

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 104/296 (35%), Positives = 160/296 (54%), Gaps = 9/296 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +S E+  S  TL  Y+ DL    N+L  K++S         L  Y++ L  + +V  S  
Sbjct: 12  LSVEKNVSPYTLRNYRTDLIGFVNYLIEKKVSSFDRVDRYILRDYMSSLIAKGIVKGSIA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R FY +L  EGL + NP+     P+ +  LP+ L    +  LL           
Sbjct: 72  RKLSAVRSFYRYLMREGLIQKNPTLNASSPRLDKRLPEFLTVTEVNKLLRVP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               + +R    +ELLYA+G+RVSELV L    ++L    + + GKG+KER+V+    A+
Sbjct: 125 SSTPQGLRDKAFMELLYASGLRVSELVKLDIENMDLHSHQIRVWGKGSKERVVLAGLPAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            ++Q Y      +     +      +   G LS + F   L  LA +AGI+ K++ PH++
Sbjct: 185 QSIQNYLNLGRPLLKGKRNTPALFLNPTGGRLSARSFQERLDKLAKQAGIE-KHVHPHML 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           RH FA+HLL+GGADLR +Q LLGH+++STTQIYTH+   + +K+    HPLA+ + 
Sbjct: 244 RHTFATHLLDGGADLRVVQELLGHSNLSTTQIYTHVTKSQARKVYMSSHPLARPQN 299


>gi|27468099|ref|NP_764736.1| site-specific recombinase [Staphylococcus epidermidis ATCC 12228]
 gi|251810914|ref|ZP_04825387.1| integrase/recombinase XerD [Staphylococcus epidermidis BCM-HMP0060]
 gi|282876077|ref|ZP_06284944.1| tyrosine recombinase XerD [Staphylococcus epidermidis SK135]
 gi|34222791|sp|Q7ZAJ2|XERD_STAES RecName: Full=Tyrosine recombinase xerD
 gi|27315645|gb|AAO04780.1|AE016748_14 site-specific recombinase [Staphylococcus epidermidis ATCC 12228]
 gi|251805594|gb|EES58251.1| integrase/recombinase XerD [Staphylococcus epidermidis BCM-HMP0060]
 gi|281295102|gb|EFA87629.1| tyrosine recombinase XerD [Staphylococcus epidermidis SK135]
 gi|329737213|gb|EGG73467.1| tyrosine recombinase XerD [Staphylococcus epidermidis VCU028]
          Length = 295

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 103/293 (35%), Positives = 154/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ +++L + +IS +       +   L HL      + S 
Sbjct: 11  FIQIEKGLSNNTIGAYRRDLKKYKDYLEDNKISHIDFIDRQIIQECLGHLIDMGQSSKSL 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  +E PK    LP  L  D +  LLE         
Sbjct: 71  ARFISTIRSFHQFALREKYAAKDPTVLIETPKYEKKLPDVLEIDEVIALLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRV+E++ L    +NL    + + GKGNKER+V L  + 
Sbjct: 124 DLTKNNGYRDRTMLELLYATGMRVTEIIQLDVEDVNLIMGFVRVFGKGNKERIVPLGDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +          +     LSRQ   + +K    +A I  K ++PH 
Sbjct: 184 IEYLTTYIETVRPQLLKQTTTQALFLNMHGKSLSRQGIWKIIKQYGLKANIN-KTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYTQFHPRA 295


>gi|261342297|ref|ZP_05970155.1| tyrosine recombinase XerD [Enterobacter cancerogenus ATCC 35316]
 gi|288315638|gb|EFC54576.1| tyrosine recombinase XerD [Enterobacter cancerogenus ATCC 35316]
          Length = 298

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 168/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTLSAY+RDL  +  +L+ +++SL     + L + L          +S  R
Sbjct: 15  LWLEKNLAENTLSAYRRDLTMLVEWLSRRKLSLETVQHDDLQALLGERVDGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ +  L  E +R D+PS  L  PK    LPK L +  +  LL+         A 
Sbjct: 75  LLSAMRRLFQHLFREKIRADDPSALLASPKLPQRLPKDLSEAQVERLLQSP-------AV 127

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 128 DLPLELRDKAMLELLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYATLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|116625461|ref|YP_827617.1| tyrosine recombinase XerD subunit [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228623|gb|ABJ87332.1| tyrosine recombinase XerD subunit [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 302

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 100/295 (33%), Positives = 164/295 (55%), Gaps = 14/295 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +     E+  S N++SAY  DL     F  + +          +  Y++HL Q  L   
Sbjct: 19  FLNFCRIEKGLSPNSISAYSADLARFVQFTGDVQEPPG---VPEIRQYIDHLYQTGLSNR 75

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           S  R ++ +R FY FL  EG    +P++ L  P++   +PK L+ + I  +++       
Sbjct: 76  SVGRHLTTLRNFYGFLLREGKVATDPTEHLRTPRQWQTIPKYLNLEEIERIIQAP----- 130

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                +   +R   ++E+LYA+G+RVSEL  L    L+L  + +   GKGNK+RLV +  
Sbjct: 131 --DLAKPLGLRDRAMMEVLYASGLRVSELCKLGIGDLDLEYQVLRTTGKGNKQRLVPVGK 188

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           +A+ A++ Y ++     + G        + + G ++RQ F + L A   +AGI    ++P
Sbjct: 189 AAVLAVRAYLESGRPGLLKGRASRYLFVTARGGCMTRQGFWKLLAAYGRKAGIFH-GLTP 247

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H++RH+FA+HLLEGGADLR++Q++LGH DISTTQIYTH++  +L+  V+ +HP A
Sbjct: 248 HVLRHSFATHLLEGGADLRSVQVMLGHADISTTQIYTHVMRSRLRATVEKHHPRA 302


>gi|163941832|ref|YP_001646716.1| site-specific tyrosine recombinase XerD [Bacillus
           weihenstephanensis KBAB4]
 gi|229013300|ref|ZP_04170441.1| Tyrosine recombinase xerD [Bacillus mycoides DSM 2048]
 gi|229061763|ref|ZP_04199096.1| Tyrosine recombinase xerD [Bacillus cereus AH603]
 gi|163864029|gb|ABY45088.1| tyrosine recombinase XerD [Bacillus weihenstephanensis KBAB4]
 gi|228717509|gb|EEL69173.1| Tyrosine recombinase xerD [Bacillus cereus AH603]
 gi|228748067|gb|EEL97931.1| Tyrosine recombinase xerD [Bacillus mycoides DSM 2048]
          Length = 296

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 107/293 (36%), Positives = 160/293 (54%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  +    +  H++++L HL +    + + 
Sbjct: 12  MIVEKGLAKNTVVSYERDLKSYVKYLQNVEQTKTFHEVTRLHIVNFLQHLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+         
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSIDEVEALLQTP------- 124

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 125 KTASAFGIRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I  K ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKAVDALFLNHHGNRLSRQGFWKILKRLAKEANI-AKELTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|153830656|ref|ZP_01983323.1| tyrosine recombinase XerD [Vibrio cholerae 623-39]
 gi|148873865|gb|EDL72000.1| tyrosine recombinase XerD [Vibrio cholerae 623-39]
          Length = 302

 Score =  189 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 104/291 (35%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           M  ER  + NT+ +Y+ DL ++  ++   +  L   S   L  Y + LS++    +S+ R
Sbjct: 19  MWFERGLAENTVVSYRNDLSKLLEWMAQNQYRLDFISFAGLQEYQSWLSEQNYKPTSKAR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LL           P
Sbjct: 79  MLSAIRRLFQYLHREKVRADDPSALLVSPKLPTRLPKDLSEAQVEALLSAP-------DP 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+ 
Sbjct: 132 QSPLELRDKAMLELLYATGLRVTELVSLTMENMSLRQGVVRVMGKGGKERLVPMGENAIE 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ + +   S+ +      +   S++   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 192 WIETFLQQGRSLLLGEQTSDIVFPSSRGQQMTRQTFWHRIKHYAVIAGIDVEKLSPHVLR 251

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 252 HAFATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHNEHHPRA 302


>gi|154686593|ref|YP_001421754.1| site-specific tyrosine recombinase XerD [Bacillus amyloliquefaciens
           FZB42]
 gi|154352444|gb|ABS74523.1| XerD [Bacillus amyloliquefaciens FZB42]
          Length = 296

 Score =  189 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 109/292 (37%), Positives = 161/292 (55%), Gaps = 10/292 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNN--KEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
             ER  S NT+ +Y+RDLK    FL    +  S +  +  H+I YL H+        +  
Sbjct: 13  RVERGLSQNTMMSYERDLKSYSLFLTETLQITSWNDVTRLHIIQYLKHIKDSGKSGKTSA 72

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ IR F+ FL  E     +PS  +E  K    LPK L    +  LL+  K+++    
Sbjct: 73  RHLASIRSFHQFLLREKAADKDPSVHIETQKTERTLPKVLALHEVERLLDTPKLDSPF-- 130

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++ELLYATG+RVSE++ L    ++LT   +   GKG KER+V +  +A 
Sbjct: 131 -----GLRDKAMLELLYATGIRVSEMIELKLSDVHLTMGFVRCFGKGRKERIVPIGEAAS 185

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           HA++ Y +      +  N       +     +SRQ F ++LK +A  AGI KK ++PH +
Sbjct: 186 HAIEAYIEKARGKLLKKNVTEALFLNHHGRQISRQGFWKNLKKIALEAGI-KKELTPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + YHP A
Sbjct: 245 RHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYKQYHPRA 296


>gi|197116868|ref|YP_002137295.1| site-specific recombinase, XerC [Geobacter bemidjiensis Bem]
 gi|197086228|gb|ACH37499.1| site-specific recombinase, XerC [Geobacter bemidjiensis Bem]
          Length = 293

 Score =  189 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 97/295 (32%), Positives = 147/295 (49%), Gaps = 15/295 (5%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISL--SAASTNHLISYLNHLSQRKLVTSSQ 59
           + +ER  S +TL+AY+ DL++  +FL  +  +          +  YL  L  +    SS 
Sbjct: 12  LETERNVSPHTLAAYRSDLEQFLSFLAREREAPRAEEVDHLAIRRYLAQLH-KGCAKSSI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            RK+S IR  + +L  EG  + NP++ +  PKK   LP  L+ D ++ L+          
Sbjct: 71  GRKLSAIRALFRYLMREGKLEKNPAELVSTPKKEKRLPFHLNIDQVSALVTAP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
           A      +R   ++E LY+ G+RVSEL  ++   ++L      + GKG KERLV +   A
Sbjct: 124 AGSSGLPLRDRAVLETLYSCGIRVSELTGMNVGDMDLAAGLARVMGKGGKERLVPVGSCA 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             AL  Y    +        +        T     ++    +  +AA      + +SPH 
Sbjct: 184 RSALAAYLAERADPGPAEPLILNARGGRLTRRSVARIVDAHMLLIAAM-----RKVSPHT 238

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           +RH FA+HLLEGGADLR IQ LLGH  +STTQ YTH+  DKL ++    HP A++
Sbjct: 239 LRHTFATHLLEGGADLRAIQELLGHASLSTTQKYTHVSIDKLMEVYDKAHPKARE 293


>gi|15924487|ref|NP_372021.1| site-specific recombinase [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927078|ref|NP_374611.1| site-specific recombinase [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283180|ref|NP_646268.1| site-specific recombinase [Staphylococcus aureus subsp. aureus MW2]
 gi|49483747|ref|YP_040971.1| integrase/recombinase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49486335|ref|YP_043556.1| integrase/recombinase [Staphylococcus aureus subsp. aureus MSSA476]
 gi|57650453|ref|YP_186382.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus COL]
 gi|87160007|ref|YP_494143.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88195302|ref|YP_500106.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|148267981|ref|YP_001246924.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus JH9]
 gi|150394046|ref|YP_001316721.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus JH1]
 gi|151221617|ref|YP_001332439.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156979816|ref|YP_001442075.1| site-specific recombinase [Staphylococcus aureus subsp. aureus Mu3]
 gi|161509725|ref|YP_001575384.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221140082|ref|ZP_03564575.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|253314865|ref|ZP_04838078.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|253733255|ref|ZP_04867420.1| site-specific recombinase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006283|ref|ZP_05144884.2| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257425620|ref|ZP_05602044.1| tyrosine recombinase xerD [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428281|ref|ZP_05604679.1| tyrosine recombinase xerD [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430918|ref|ZP_05607298.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433607|ref|ZP_05609965.1| tyrosine recombinase xerD [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436520|ref|ZP_05612564.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           M876]
 gi|257793574|ref|ZP_05642553.1| tyrosine recombinase XerD [Staphylococcus aureus A9781]
 gi|258411126|ref|ZP_05681406.1| tyrosine recombinase xerD [Staphylococcus aureus A9763]
 gi|258419910|ref|ZP_05682871.1| tyrosine recombinase XerD [Staphylococcus aureus A9719]
 gi|258423151|ref|ZP_05686044.1| tyrosine recombinase XerD [Staphylococcus aureus A9635]
 gi|258437328|ref|ZP_05689312.1| tyrosine recombinase xerD [Staphylococcus aureus A9299]
 gi|258443533|ref|ZP_05691872.1| tyrosine recombinase xerD [Staphylococcus aureus A8115]
 gi|258446740|ref|ZP_05694894.1| tyrosine recombinase xerD [Staphylococcus aureus A6300]
 gi|258448655|ref|ZP_05696767.1| tyrosine recombinase xerD [Staphylococcus aureus A6224]
 gi|258451155|ref|ZP_05699190.1| tyrosine recombinase xerD [Staphylococcus aureus A5948]
 gi|258454271|ref|ZP_05702241.1| tyrosine recombinase xerD [Staphylococcus aureus A5937]
 gi|262049084|ref|ZP_06021961.1| site-specific recombinase [Staphylococcus aureus D30]
 gi|262051169|ref|ZP_06023393.1| site-specific recombinase [Staphylococcus aureus 930918-3]
 gi|269203124|ref|YP_003282393.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282892996|ref|ZP_06301230.1| tyrosine recombinase XerD [Staphylococcus aureus A8117]
 gi|282904077|ref|ZP_06311965.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           C160]
 gi|282905904|ref|ZP_06313759.1| tyrosine recombinase xerD [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908814|ref|ZP_06316632.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911133|ref|ZP_06318935.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914302|ref|ZP_06322088.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           M899]
 gi|282919271|ref|ZP_06327006.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           C427]
 gi|282924596|ref|ZP_06332264.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           C101]
 gi|282924746|ref|ZP_06332413.1| tyrosine recombinase XerD [Staphylococcus aureus A9765]
 gi|282928967|ref|ZP_06336554.1| tyrosine recombinase XerD [Staphylococcus aureus A10102]
 gi|283958259|ref|ZP_06375710.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284024557|ref|ZP_06378955.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus 132]
 gi|293503379|ref|ZP_06667226.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510394|ref|ZP_06669100.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           M809]
 gi|293530933|ref|ZP_06671615.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           M1015]
 gi|294848527|ref|ZP_06789273.1| tyrosine recombinase XerD [Staphylococcus aureus A9754]
 gi|295406617|ref|ZP_06816422.1| tyrosine recombinase XerD [Staphylococcus aureus A8819]
 gi|296276353|ref|ZP_06858860.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus MR1]
 gi|297207783|ref|ZP_06924218.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297245799|ref|ZP_06929664.1| tyrosine recombinase XerD [Staphylococcus aureus A8796]
 gi|297590959|ref|ZP_06949597.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus MN8]
 gi|300911864|ref|ZP_07129307.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304380916|ref|ZP_07363576.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|60416269|sp|P0A0N9|XERD_STAAM RecName: Full=Tyrosine recombinase xerD
 gi|60416270|sp|P0A0P0|XERD_STAAN RecName: Full=Tyrosine recombinase xerD
 gi|60416271|sp|P0A0P1|XERD_STAAW RecName: Full=Tyrosine recombinase xerD
 gi|60416272|sp|P0A0P2|XERD_STAAU RecName: Full=Tyrosine recombinase xerD
 gi|81649271|sp|Q6G967|XERD_STAAS RecName: Full=Tyrosine recombinase xerD
 gi|81651036|sp|Q6GGK1|XERD_STAAR RecName: Full=Tyrosine recombinase xerD
 gi|81694449|sp|Q5HFS5|XERD_STAAC RecName: Full=Tyrosine recombinase xerD
 gi|3747042|gb|AAC64162.1| tyrosine recombinase XerD [Staphylococcus aureus]
 gi|13701296|dbj|BAB42590.1| site-specific recombinase [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247268|dbj|BAB57659.1| site-specific recombinase [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21204620|dbj|BAB95316.1| site-specific recombinase [Staphylococcus aureus subsp. aureus MW2]
 gi|49241876|emb|CAG40569.1| integrase/recombinase [Staphylococcus aureus subsp. aureus MRSA252]
 gi|49244778|emb|CAG43214.1| integrase/recombinase [Staphylococcus aureus subsp. aureus MSSA476]
 gi|57284639|gb|AAW36733.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus COL]
 gi|87125981|gb|ABD20495.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87202860|gb|ABD30670.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|147741050|gb|ABQ49348.1| tyrosine recombinase XerD subunit [Staphylococcus aureus subsp.
           aureus JH9]
 gi|149946498|gb|ABR52434.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus JH1]
 gi|150374417|dbj|BAF67677.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156721951|dbj|BAF78368.1| site-specific recombinase [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368534|gb|ABX29505.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253728795|gb|EES97524.1| site-specific recombinase [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257271314|gb|EEV03460.1| tyrosine recombinase xerD [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275122|gb|EEV06609.1| tyrosine recombinase xerD [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278348|gb|EEV08984.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281700|gb|EEV11837.1| tyrosine recombinase xerD [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257283871|gb|EEV13994.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           M876]
 gi|257787546|gb|EEV25886.1| tyrosine recombinase XerD [Staphylococcus aureus A9781]
 gi|257840276|gb|EEV64740.1| tyrosine recombinase xerD [Staphylococcus aureus A9763]
 gi|257844095|gb|EEV68483.1| tyrosine recombinase XerD [Staphylococcus aureus A9719]
 gi|257846601|gb|EEV70622.1| tyrosine recombinase XerD [Staphylococcus aureus A9635]
 gi|257848533|gb|EEV72521.1| tyrosine recombinase xerD [Staphylococcus aureus A9299]
 gi|257850939|gb|EEV74882.1| tyrosine recombinase xerD [Staphylococcus aureus A8115]
 gi|257854315|gb|EEV77264.1| tyrosine recombinase xerD [Staphylococcus aureus A6300]
 gi|257857933|gb|EEV80822.1| tyrosine recombinase xerD [Staphylococcus aureus A6224]
 gi|257861210|gb|EEV84023.1| tyrosine recombinase xerD [Staphylococcus aureus A5948]
 gi|257863550|gb|EEV86308.1| tyrosine recombinase xerD [Staphylococcus aureus A5937]
 gi|259160806|gb|EEW45826.1| site-specific recombinase [Staphylococcus aureus 930918-3]
 gi|259162753|gb|EEW47318.1| site-specific recombinase [Staphylococcus aureus D30]
 gi|262075414|gb|ACY11387.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269940989|emb|CBI49373.1| integrase/recombinase [Staphylococcus aureus subsp. aureus TW20]
 gi|282313431|gb|EFB43826.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317081|gb|EFB47455.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           C427]
 gi|282321483|gb|EFB51808.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           M899]
 gi|282324828|gb|EFB55138.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327078|gb|EFB57373.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331196|gb|EFB60710.1| tyrosine recombinase xerD [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282589374|gb|EFB94465.1| tyrosine recombinase XerD [Staphylococcus aureus A10102]
 gi|282592753|gb|EFB97759.1| tyrosine recombinase XerD [Staphylococcus aureus A9765]
 gi|282595695|gb|EFC00659.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           C160]
 gi|282764314|gb|EFC04440.1| tyrosine recombinase XerD [Staphylococcus aureus A8117]
 gi|283470776|emb|CAQ49987.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283790408|gb|EFC29225.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817178|gb|ADC37665.1| Site-specific recombinase XerD [Staphylococcus aureus 04-02981]
 gi|290920201|gb|EFD97267.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095045|gb|EFE25310.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466758|gb|EFF09278.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824553|gb|EFG40976.1| tyrosine recombinase XerD [Staphylococcus aureus A9754]
 gi|294968364|gb|EFG44388.1| tyrosine recombinase XerD [Staphylococcus aureus A8819]
 gi|296887800|gb|EFH26698.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297177450|gb|EFH36702.1| tyrosine recombinase XerD [Staphylococcus aureus A8796]
 gi|297575845|gb|EFH94561.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus MN8]
 gi|298694781|gb|ADI98003.1| site-specific recombinase [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300886110|gb|EFK81312.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302751329|gb|ADL65506.1| site-specific recombinase XerD [Staphylococcus aureus subsp. aureus
           str. JKD6008]
 gi|304340643|gb|EFM06577.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312438035|gb|ADQ77106.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312829886|emb|CBX34728.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315129770|gb|EFT85760.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315195394|gb|EFU25781.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315198812|gb|EFU29140.1| integrase/recombinase XerD [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320140619|gb|EFW32473.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320144155|gb|EFW35924.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|329314175|gb|AEB88588.1| Tyrosine recombinase xerD [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329725291|gb|EGG61778.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           21189]
 gi|329727344|gb|EGG63800.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           21172]
          Length = 295

 Score =  189 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 105/293 (35%), Positives = 156/293 (53%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ Q+++    IS +       +   L HL  +     S 
Sbjct: 11  FIQIEKGLSSNTIGAYRRDLKKYQDYMTEHHISHIDFIDRQLIQECLGHLIDQGQSAKSI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  L+ PK +  LP  L+ D +  LLE         
Sbjct: 71  ARFISTIRSFHQFAIREKYAAKDPTVLLDSPKYDKKLPDVLNVDEVLALLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSEL+ L    +NL    + + GKG+KER+V L  + 
Sbjct: 124 DLNKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIVPLGDAV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +      +   +     LSRQ   + +K    +A I KK ++PH 
Sbjct: 184 IEYLTTYIETIRPQLLKKTVTEVLFLNMHGKPLSRQAIWKMIKQNGVKANI-KKTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQFHPRA 295


>gi|295690851|ref|YP_003594544.1| integrase family protein [Caulobacter segnis ATCC 21756]
 gi|295432754|gb|ADG11926.1| integrase family protein [Caulobacter segnis ATCC 21756]
          Length = 313

 Score =  189 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 122/300 (40%), Positives = 172/300 (57%), Gaps = 3/300 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MM+ ERA++ NTL+AY +DL++ + FL   +  L  A    + +Y   L  R L  ++  
Sbjct: 15  MMAVERAAARNTLTAYGKDLEDARGFLGRSKRDLDDADAEAVEAYFQDLGARGLSPATAA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+ S +RQFY F+  EG R D+PS  +  PK    LPK L +  I  LL  A        
Sbjct: 75  RRRSAVRQFYRFVLGEGWRTDDPSRRVAAPKAGRPLPKVLERAEIERLLAAATAPNTEMG 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               + +R+  +IEL+YA+G+R+SEL+ L    L      +I++GKG KERL  L+ +A 
Sbjct: 135 -DSAQGLRLACIIELIYASGLRISELLALPLTALARDPAYLIVKGKGGKERLAPLNDAAR 193

Query: 181 HALQMYKKTCSSMKMTG--NDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            A+  Y     +    G     WLFPS   +G L+ +   + L   A  AGI +  +SPH
Sbjct: 194 AAVNAYLAGRRTFLPKGAKESPWLFPSRGGSGRLTARRVGQLLDDAAIAAGIDRDKVSPH 253

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKH 298
           ++RHAFA+HLLEGGADLR IQ LLGH DI+TTQIYTH+  + L  +VQ  HPL +K+  H
Sbjct: 254 VLRHAFATHLLEGGADLRVIQTLLGHADIATTQIYTHVAGEHLAHVVQTKHPLGRKKTPH 313


>gi|296104556|ref|YP_003614702.1| site-specific tyrosine recombinase XerD [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
 gi|295059015|gb|ADF63753.1| site-specific tyrosine recombinase XerD [Enterobacter cloacae
           subsp. cloacae ATCC 13047]
          Length = 298

 Score =  189 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 111/291 (38%), Positives = 171/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTLSAY+RDL  +  +L ++ +SL +A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAQNTLSAYRRDLTMLVEWLAHRGLSLESAQSDDLQALLGERMEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ +  L  E +R D+PS  L  PK    LPK L +  +  LL+         A 
Sbjct: 75  LLSAMRRLFQHLYREKIRADDPSALLASPKLPQRLPKDLSEAQVERLLQSP-------AV 127

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 128 DLPLELRDKAMLELLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYATLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|295428073|ref|ZP_06820705.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|295128431|gb|EFG58065.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           EMRSA16]
          Length = 297

 Score =  189 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 105/293 (35%), Positives = 156/293 (53%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ Q+++    IS +       +   L HL  +     S 
Sbjct: 13  FIQIEKGLSSNTIGAYRRDLKKYQDYMTEHHISHIDFIDRQLIQECLGHLIDQGQSAKSI 72

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  L+ PK +  LP  L+ D +  LLE         
Sbjct: 73  ARFISTIRSFHQFAIREKYAAKDPTVLLDSPKYDKKLPDVLNVDEVLALLETP------- 125

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSEL+ L    +NL    + + GKG+KER+V L  + 
Sbjct: 126 DLNKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIVPLGDAV 185

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +      +   +     LSRQ   + +K    +A I KK ++PH 
Sbjct: 186 IEYLTTYIETIRPQLLKKTVTEVLFLNMHGKPLSRQAIWKMIKQNGVKANI-KKTLTPHT 244

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 245 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQFHPRA 297


>gi|291484781|dbj|BAI85856.1| site-specific tyrosine recombinase XerD [Bacillus subtilis subsp.
           natto BEST195]
          Length = 296

 Score =  189 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 157/291 (53%), Gaps = 10/291 (3%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNN--KEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
            ER  S NT+ +Y+RDLK    +L         +  +  H+I YL HL        +  R
Sbjct: 14  VERGLSQNTIVSYERDLKSYSLYLTETLHVTDWNHVTRIHIIQYLKHLKDSGKSGKTSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ IR F+ FL  E +   +PS  +E  K    LPK L  + +  LL+  K+ +     
Sbjct: 74  HLASIRSFHQFLLREKVTDKDPSVHIETQKTERALPKVLALNEVERLLDTPKLTSPF--- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                 R   ++ELLYATG+RVSE++ L    ++L+   +   GKG KER+V +  +A  
Sbjct: 131 ----GYRDKAMLELLYATGIRVSEMIELKTTDVHLSMGFVRCFGKGRKERIVPIGEAAAS 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           A++ Y        +  N       +     +SRQ F ++LK +A  AGI KK ++PH +R
Sbjct: 187 AIEEYMTKARGKLLKNNVSDALFLNHHGKQISRQGFWKNLKKIALEAGI-KKELTPHTLR 245

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 246 HSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYKQFHPRA 296


>gi|218701603|ref|YP_002409232.1| site-specific tyrosine recombinase XerD [Escherichia coli IAI39]
 gi|254037938|ref|ZP_04871996.1| site-specific tyrosine recombinase [Escherichia sp. 1_1_43]
 gi|218371589|emb|CAR19428.1| site-specific tyrosine recombinase [Escherichia coli IAI39]
 gi|226839562|gb|EEH71583.1| site-specific tyrosine recombinase [Escherichia sp. 1_1_43]
          Length = 298

 Score =  189 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 174/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+   ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATVQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|228922585|ref|ZP_04085885.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228837014|gb|EEM82355.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 299

 Score =  189 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 101/294 (34%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLIREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMK--MTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            +L  Y +         T  D  +   + K   L+ +     L  +  +A +  + ISPH
Sbjct: 187 DSLITYIENGRKQLVNKTDEDSHMVFLNAKGTPLTSRGVRYVLNEIIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|197285863|ref|YP_002151735.1| tyrosine recombinase [Proteus mirabilis HI4320]
 gi|227356364|ref|ZP_03840752.1| tyrosine recombinase [Proteus mirabilis ATCC 29906]
 gi|34222762|sp|O31206|XERD_PROMI RecName: Full=Tyrosine recombinase xerD
 gi|2645800|gb|AAB87499.1| site-specific recombinase [Proteus mirabilis]
 gi|194683350|emb|CAR44057.1| tyrosine recombinase [Proteus mirabilis HI4320]
 gi|227163474|gb|EEI48395.1| tyrosine recombinase [Proteus mirabilis ATCC 29906]
          Length = 313

 Score =  189 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 110/288 (38%), Positives = 169/288 (58%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           E+  S NTLSAY+ DL+ +  +L  ++++  + +T  L ++L          +S  R +S
Sbjct: 33  EQGLSANTLSAYRLDLQALSQWLVTQKLNWLSVTTLDLHAFLATRLDEGYKATSAARLLS 92

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            +R+F+ +L  E LR+D+PS  L  PK    LPK L +  + NLL    I+       + 
Sbjct: 93  TLRRFFQYLYREKLRQDDPSALLSTPKLPKRLPKDLSEQQVENLLSAPCID-------EP 145

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++E+LYA G+RVSELV LS   ++L +  + + GKG+KERLV L   A++ L+
Sbjct: 146 IELRDKAMLEVLYACGLRVSELVGLSLSDISLRQGVLRVIGKGDKERLVPLGEEAIYWLE 205

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            Y +      M G    +   S +   ++RQ F   +K  A  AGI  + +SPH++RHAF
Sbjct: 206 QYLQYGRPALMQGKTDDIVFPSLRGQKMTRQTFWHRIKHYAVIAGIDSEKLSPHVLRHAF 265

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L Q +HP  
Sbjct: 266 ATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKVLHQQHHPRG 313


>gi|237729834|ref|ZP_04560315.1| site-specific tyrosine recombinase XerD [Citrobacter sp. 30_2]
 gi|226908440|gb|EEH94358.1| site-specific tyrosine recombinase XerD [Citrobacter sp. 30_2]
          Length = 298

 Score =  189 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 114/291 (39%), Positives = 173/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L+++  SL+ A ++ L + L          +S  R
Sbjct: 15  LWLERNLAENTLSAYRRDLTMLVEWLHHRGASLATAQSDDLQALLAERMDGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R+F+  L  E  R+D+PS +L  PK    LPK L +  +  LL+   IE      
Sbjct: 75  LLSATRRFFQHLYREKYREDDPSASLASPKLPQRLPKDLSEAQVERLLQAPLIE------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDVSLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|170740412|ref|YP_001769067.1| tyrosine recombinase XerD [Methylobacterium sp. 4-46]
 gi|168194686|gb|ACA16633.1| tyrosine recombinase XerD [Methylobacterium sp. 4-46]
          Length = 309

 Score =  189 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 100/295 (33%), Positives = 145/295 (49%), Gaps = 3/295 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER +S NTL+AY+RDL +    L  + +  ++ +   + +Y+  L+ R L  SS  
Sbjct: 18  MLAAERGASANTLAAYRRDLDDYLAHLAAEGLDPASVAPAGVRAYVADLAARGLKPSSAA 77

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S IR F+ FL  EG    +P+  +  PK+   LPK L    +  LL  A  EA   A
Sbjct: 78  RRLSCIRGFHRFLYAEGHAPSDPTAPVSGPKRGRALPKVLSVAEVDTLLAVA-KEAVARA 136

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           P   +  R   L+ LL         +  L +                 K     L P   
Sbjct: 137 PNPGEAARAQRLLCLLELLYATGLRVSELVSLPRAAALTKERFLVVRGKGGRERLVPLTD 196

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A        + + + G  L+   S +               A AA  GI+   ISPH++
Sbjct: 197 IARAAMAAHLAHLAVPGPWLFPADSESGHLTRQAFARDLKAVAGAA--GIRADRISPHVL 254

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L+ +V+D HPLA + 
Sbjct: 255 RHAFASHLLQNGADLRVVQELLGHADISTTQIYTHILDERLKSMVRDLHPLADER 309


>gi|221310269|ref|ZP_03592116.1| site-specific tyrosine recombinase XerD [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221314592|ref|ZP_03596397.1| site-specific tyrosine recombinase XerD [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221319515|ref|ZP_03600809.1| site-specific tyrosine recombinase XerD [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323791|ref|ZP_03605085.1| site-specific tyrosine recombinase XerD [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|255767509|ref|NP_390232.2| site-specific tyrosine recombinase XerD [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|321311827|ref|YP_004204114.1| site-specific tyrosine recombinase XerD [Bacillus subtilis BSn5]
 gi|251757430|sp|P46352|XERD_BACSU RecName: Full=Tyrosine recombinase xerD
 gi|225185137|emb|CAB14283.2| site-specific tyrosine recombinase for chromosome partitioning
           [Bacillus subtilis subsp. subtilis str. 168]
 gi|320018101|gb|ADV93087.1| site-specific tyrosine recombinase XerD [Bacillus subtilis BSn5]
          Length = 296

 Score =  189 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 157/291 (53%), Gaps = 10/291 (3%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNN--KEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
            ER  S NT+ +Y+RDLK    +L         +  +  H+I YL HL        +  R
Sbjct: 14  VERGLSQNTIVSYERDLKSYSLYLTETLHVTDWNHVTRIHIIQYLKHLKDSGKSGKTSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ IR F+ FL  E +   +PS  +E  K    LPK L  + +  LL+  K+ +     
Sbjct: 74  HLASIRSFHQFLLREKVTDKDPSVHIETQKTERALPKVLALNEVERLLDTPKLTSPF--- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                 R   ++ELLYATG+RVSE++ L    ++L+   +   GKG KER+V +  +A  
Sbjct: 131 ----GYRDKAMLELLYATGIRVSEMIELKTADVHLSMGFIRCFGKGRKERIVPIGEAAAS 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           A++ Y        +  N       +     +SRQ F ++LK +A  AGI KK ++PH +R
Sbjct: 187 AIEEYMTKARGKLLKNNVSDALFLNHHGKQISRQGFWKNLKKIALEAGI-KKELTPHTLR 245

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 246 HSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYKQFHPRA 296


>gi|332289739|ref|YP_004420591.1| site-specific tyrosine recombinase XerD [Gallibacterium anatis
           UMN179]
 gi|330432635|gb|AEC17694.1| site-specific tyrosine recombinase XerD [Gallibacterium anatis
           UMN179]
          Length = 297

 Score =  189 bits (478), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 101/287 (35%), Positives = 161/287 (56%), Gaps = 7/287 (2%)

Query: 6   RASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKISV 65
           +  S NT+++Y+ DLK +  +L    ++L       L ++L    Q+    +S  R +S 
Sbjct: 18  KNLSQNTIASYRSDLKFLSEWLEKHHLTLQQVQYLDLQAFLGERLQQGYKATSYSRMLSA 77

Query: 66  IRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQWK 125
           +R+ + +L  E  R+DNP   L  PK    LPK L +  + +LL          A     
Sbjct: 78  MRKLFQYLYQEKYREDNPCSLLTSPKLPARLPKYLTESQVTDLLNTP-------ATENAL 130

Query: 126 RVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQM 185
            +R   ++ELLYATG+RVSELV+L+ + +NL +  + + GK +KERLV +   A + +Q 
Sbjct: 131 ELRDKAMLELLYATGLRVSELVSLTTNNINLQQGVVRVIGKADKERLVPIGEEANYWVQQ 190

Query: 186 YKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAFA 245
           +     +  + G    +   S +   ++RQ F   +K  A+ A I    +SPH++RHAFA
Sbjct: 191 FILYGRAELLGGQSSDVLFPSRQGKLMTRQTFWYRIKHYASLANIDADKLSPHVLRHAFA 250

Query: 246 SHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +HL+  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L   YHP  
Sbjct: 251 THLVNHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKQLHSKYHPRG 297


>gi|69248064|ref|ZP_00604609.1| Phage integrase:Phage integrase, N-terminal SAM-like [Enterococcus
           faecium DO]
 gi|68194583|gb|EAN09074.1| Phage integrase:Phage integrase, N-terminal SAM-like [Enterococcus
           faecium DO]
          Length = 284

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 106/292 (36%), Positives = 160/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+ ER  S NT  +Y+RDL++  +FL  ++I S        +I +L  L + K  T++  
Sbjct: 1   MNIERGLSANTRQSYERDLEQYLHFLQEQKIASWQDVDRFLVIRFLEKLHEEKKATATVT 60

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R+F+ FL  E +   +P   ++ PKK   LP TL    +  L+E          
Sbjct: 61  RMISSLRRFHQFLRQERITDHDPMQHIDTPKKAQKLPSTLTLTEVEKLIEAP-------D 113

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATGMRVSEL+ L    L+L+   +   GKG+KER++ L   A+
Sbjct: 114 TTKTLGIRDRAILEVMYATGMRVSELIGLKLGDLHLSLGLVQTVGKGDKERIIPLGDYAI 173

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y      + +          +     LSRQ   ++LK L   AGI  K ++PH +
Sbjct: 174 QWLERYLDEARPLLVKDASEMHVFVNNHGKGLSRQGIWKNLKQLVREAGI-YKEVTPHTL 232

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLRT+Q LLGH DISTTQIYTH+   ++  + + + P A
Sbjct: 233 RHSFATHLLENGADLRTVQELLGHADISTTQIYTHITKKRMTDVYKQHFPRA 284


>gi|222097276|ref|YP_002531333.1| site-specific tyrosine recombinase xerc [Bacillus cereus Q1]
 gi|229197941|ref|ZP_04324656.1| Tyrosine recombinase xerC [Bacillus cereus m1293]
 gi|221241334|gb|ACM14044.1| site-specific integrase/recombinase [Bacillus cereus Q1]
 gi|228585520|gb|EEK43623.1| Tyrosine recombinase xerC [Bacillus cereus m1293]
 gi|324327728|gb|ADY22988.1| site-specific tyrosine recombinase XerC [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 299

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 147/294 (50%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDITYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          +              L+ +     L  L  +A +  + ISPH
Sbjct: 187 DALITYIENGRKQLAKKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|152976499|ref|YP_001376016.1| site-specific tyrosine recombinase XerD [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152025251|gb|ABS23021.1| tyrosine recombinase XerD [Bacillus cytotoxicus NVH 391-98]
          Length = 296

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 106/293 (36%), Positives = 160/293 (54%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L   E   +    +   ++++L HL +    + + 
Sbjct: 12  MVVEKGLAKNTVVSYERDLKSYVKYLQKVEQMKTFHEVTRMQIVNFLQHLRENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L    +  LL+         
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSVSEVEALLQTP------- 124

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 125 KTTSAYGIRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCVGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I+K+ ++PH 
Sbjct: 185 TEAIQRYIEKGRKELMGKKAVDALFLNHHGNRLSRQGFWKILKRLAKEANIEKE-LTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|313771918|gb|EFS37884.1| tyrosine recombinase XerD [Propionibacterium acnes HL074PA1]
          Length = 306

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 85/297 (28%), Positives = 142/297 (47%), Gaps = 13/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+ AY+RDL   Q +L ++ I SL+  +   +  +  HL    L  +S  
Sbjct: 16  LVVERGLSDNTVQAYRRDLLRYQEYLGSRGIGSLAEVTRVDVEEFRRHLDHIGLAPASVT 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +  +R  + F    G  + + +  +    ++  LPK L  D + +LL           
Sbjct: 76  RCVVAVRNLHRFAVGSGQLQADVTAGMSPGTRSRRLPKALSMDQVESLLAAP-------D 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTM-----IIQGKGNKERLVIL 175
               + +R   L+ELLY TG RVSE+  L    +            +I     +  + + 
Sbjct: 129 TSTVEGLRDAALLELLYGTGARVSEVCALDVDDIRPVLDDPDLGLRLIGKGDKERIVPLG 188

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
           S +A        +   +    GN       +T+   LSRQ     ++     AG+  +++
Sbjct: 189 SYAAKAVDAWLIRGRPAWAEIGNGEHALLLNTRGRRLSRQSAWAVIRRAGEAAGLDVEHL 248

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH +RH++A+HLL+GGAD+R +Q LLGH+ ++TTQIYT +  D L+++ +  HP A
Sbjct: 249 SPHSLRHSYATHLLDGGADIRVVQELLGHSSVTTTQIYTLVTADHLREVYRSSHPRA 305


>gi|225174860|ref|ZP_03728857.1| tyrosine recombinase XerD [Dethiobacter alkaliphilus AHT 1]
 gi|225169500|gb|EEG78297.1| tyrosine recombinase XerD [Dethiobacter alkaliphilus AHT 1]
          Length = 295

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 110/292 (37%), Positives = 159/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +S E+  + NTL +Y RDL+    +L    I SL   S ++++ YL  L      TS+  
Sbjct: 12  LSVEKGLAKNTLESYNRDLRTYYTYLKQNGITSLEETSRSNIVGYLLSLQNMGKATSTLS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ IR FYN+L  E    +NP+  LE PK    LP+ L    +  LLEQ         
Sbjct: 72  RNMASIRSFYNYLFQERHLVENPAAELESPKLEKKLPRVLTPQEMDLLLEQP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             Q   +R   ++E++YATG+RVSEL++L    +NL    +   GKG+KER++ L   A+
Sbjct: 125 QTQVTGIRDKAMLEVIYATGIRVSELMSLDIGDVNLDAGFIRCLGKGSKERIIPLGSVAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +  Y        +          +     L+RQ F + LK  A RAGI K+ I+PH +
Sbjct: 185 RNVGRYLNEGRPKLVRQAGEASLFVNQHGNRLTRQGFWKILKKYATRAGITKE-ITPHTM 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++Q +LGH DISTTQIYT +   KL+ + +  HP A
Sbjct: 244 RHSFATHLLENGADLRSVQEMLGHADISTTQIYTQVTKHKLRDVYEKSHPRA 295


>gi|306812204|ref|ZP_07446402.1| site-specific tyrosine recombinase XerD [Escherichia coli NC101]
 gi|305854242|gb|EFM54680.1| site-specific tyrosine recombinase XerD [Escherichia coli NC101]
          Length = 298

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLPQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|75763959|ref|ZP_00743586.1| Integrase/recombinase (XerD/RipX family) [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|74488552|gb|EAO52141.1| Integrase/recombinase (XerD/RipX family) [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
          Length = 302

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 17  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 77  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 130 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 189

Query: 181 HALQMYKKTCSSMK--MTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            +L  Y +         T  D  +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 190 DSLITYIENGRKQLVNKTDEDSRMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 248

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 249 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 302


>gi|228998607|ref|ZP_04158194.1| Tyrosine recombinase xerC [Bacillus mycoides Rock3-17]
 gi|229006107|ref|ZP_04163795.1| Tyrosine recombinase xerC [Bacillus mycoides Rock1-4]
 gi|228755183|gb|EEM04540.1| Tyrosine recombinase xerC [Bacillus mycoides Rock1-4]
 gi|228761075|gb|EEM10034.1| Tyrosine recombinase xerC [Bacillus mycoides Rock3-17]
          Length = 302

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 150/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 17  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYVDVRLYLTTLHDEKLARKSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG R+DNP     LPKK+  +PK L+ + +  L E          
Sbjct: 77  RKVSSLRSLYRFLMREGYREDNPFALASLPKKDLSIPKFLYVEELEKLFEV-------SD 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V+L    ++ +  T+++ GKG K+R V     A 
Sbjct: 130 VKTPLGQRDQALLELMYATGIRVSECVSLQLTDIDFSVGTILVTGKGKKQRYVPFGSYAQ 189

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          +              L+ +     L  L  +A +  + ISPH
Sbjct: 190 DALITYIENGRKQLAKKTEEHSQMVFLNAKGKPLTDRGVRYILNELIKKASLTMR-ISPH 248

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 249 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 302


>gi|42782923|ref|NP_980170.1| site-specific tyrosine recombinase XerC [Bacillus cereus ATCC
           10987]
 gi|42738850|gb|AAS42778.1| site-specific recombinase, phage integrase family [Bacillus cereus
           ATCC 10987]
          Length = 299

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 148/294 (50%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDITYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L +          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFKV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            G     R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TGTPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          +              L+ +     L  L  +A +  + ISPH
Sbjct: 187 DALITYIENGRKQLAKKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|310766537|gb|ADP11487.1| Tyrosine recombinase xerD [Erwinia sp. Ejp617]
          Length = 297

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 172/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NT+ +Y+ DL+ + ++L ++++SL      +L  +L    +     +S  R
Sbjct: 14  LWIERNLAQNTVDSYRLDLRSLGDWLAHQQLSLLNVEVFNLQEFLAQRLEGGYKATSSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+PS  L  PK    LPK L +  +  LL+   +E      
Sbjct: 74  LLSAMRRLFQYLYREKLREDDPSALLSSPKLPQRLPKDLSEAQVERLLQAPCLE------ 127

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++ELLYATG+RV+ELV L+   ++L +  + + GKGNKERLV +   A+H
Sbjct: 128 -QPIELRDKAMLELLYATGLRVTELVGLTLSDISLRQGVVRVIGKGNKERLVPMGEEAVH 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  + +   S +   ++RQ F   +K  A  AGI    +SPH++R
Sbjct: 187 WIEQYIEYGRPWLLNGQTIDVLFPSNRAKQMTRQTFWHRIKHYATLAGIDSDKLSPHVLR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 247 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 297


>gi|319892482|ref|YP_004149357.1| Tyrosine recombinase XerD [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162178|gb|ADV05721.1| Tyrosine recombinase XerD [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464415|gb|ADX76568.1| tyrosine recombinase XerD [Staphylococcus pseudintermedius ED99]
          Length = 295

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 98/293 (33%), Positives = 153/293 (52%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT++AY+RDL    N+L   ++ +L+      +  +   L        + 
Sbjct: 11  FIQIEKGLSNNTIAAYRRDLNHYLNYLAEHKVANLNFVDRQMIQEWFGFLHDEGRSAKTI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R  S IR F+ F   E     +P+  +E PK +  LP  L    +  LL          
Sbjct: 71  ARFTSTIRSFHQFALRENYTSHDPTVLIETPKYDRKLPDVLSIAEVEQLLMAP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATG+RVSEL+ +    +NL    + + GKG+KER+V L  + 
Sbjct: 124 DESKVNGYRDKTMLELLYATGIRVSELINIEVEDINLMMGFVKVFGKGSKERIVPLGETV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +      +      +   +     LSRQ   + +K    +AGI K+ ++PH 
Sbjct: 184 IDCLTHYIQNIRPQLLKHTVTHVLFLNLHGKPLSRQGVWKMIKQTGVKAGIMKR-LTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+  ++++K+ QDYHP A
Sbjct: 243 LRHSFATHLLENGADLRAVQDMLGHSDISTTQLYTHITKNQIRKIYQDYHPRA 295


>gi|329730857|gb|EGG67235.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           21193]
          Length = 295

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 105/293 (35%), Positives = 157/293 (53%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ Q+++    IS +       ++  L HL  +     S 
Sbjct: 11  FIQIEKGLSSNTIGAYRRDLKKYQDYMTEHHISHIDFIDRQLILECLGHLIDQGQSAKSI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  L+ PK +  LP  L+ D +  LLE         
Sbjct: 71  ARFISTIRSFHQFAIREKYAAKDPTVLLDSPKYDKKLPDVLNVDEVLALLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSEL+ L    +NL    + + GKG+KER+V L  + 
Sbjct: 124 DLNKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIVPLGDAV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +      +   +     LSRQ   + +K    +A I KK ++PH 
Sbjct: 184 IEYLTTYIETIRPQLLKKTVTEVLFLNMHGKPLSRQAIWKMIKQNGVKANI-KKTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQFHPRA 295


>gi|228992559|ref|ZP_04152486.1| Tyrosine recombinase xerC [Bacillus pseudomycoides DSM 12442]
 gi|228767193|gb|EEM15829.1| Tyrosine recombinase xerC [Bacillus pseudomycoides DSM 12442]
          Length = 302

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 149/294 (50%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 17  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYVDVRLYLTTLHDEKLARKSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG R+DNP     LPKK   +PK L+ + +  L E          
Sbjct: 77  RKVSSLRSLYRFLMREGYREDNPFALASLPKKELSIPKFLYVEELEKLFEV-------SD 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V+L    ++ +  T+++ GKG K+R V     A 
Sbjct: 130 VKTPLGQRDQALLELMYATGIRVSECVSLQLTDIDFSVGTILVTGKGKKQRYVPFGSYAQ 189

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          +              L+ +     L  L  +A +  + ISPH
Sbjct: 190 DALITYIENGRKQLAKKTEEHSQMVFLNAKGKPLTDRGVRYILNELIKKASLTMR-ISPH 248

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 249 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 302


>gi|330685662|gb|EGG97303.1| tyrosine recombinase XerC [Staphylococcus epidermidis VCU121]
          Length = 297

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 97/297 (32%), Positives = 157/297 (52%), Gaps = 10/297 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S +TL +Y+ D+ +  +FL  + + L+        +YL+ L  + L  ++  
Sbjct: 11  MLKVERNFSDHTLKSYRDDIVQFNDFLYQESLDLNDFEYKDARNYLSFLYSKNLKRTTVS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY +   +     NP   L  PKK   LP+  +++ +  L +  + +++   
Sbjct: 71  RKISTLRTFYEYWMTQDESVVNPFVQLVHPKKEQYLPQFFYEEEMEALFKTVETDSK--- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  +++ELLYATG+RVSELV +    L++    + + GKGNKER +       
Sbjct: 128 ----KGMRDKVILELLYATGIRVSELVHIKTQDLDMKLPGVKVLGKGNKERFIPFGEFCK 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y K    +K   +D +L  +        R V       +   +G+    I PH +
Sbjct: 184 QSIERYLKEFKPLKHVDHD-YLIVNMQGQPITERGVRYVLNDVVKRTSGVTN--IHPHKL 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+  + HP AKKE +
Sbjct: 241 RHTFATHLLNQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLRKVYLNAHPRAKKENE 297


>gi|206978533|ref|ZP_03239383.1| tyrosine recombinase XerC [Bacillus cereus H3081.97]
 gi|217961251|ref|YP_002339819.1| site-specific tyrosine recombinase XerC [Bacillus cereus AH187]
 gi|229140473|ref|ZP_04269028.1| Tyrosine recombinase xerC [Bacillus cereus BDRD-ST26]
 gi|206743256|gb|EDZ54713.1| tyrosine recombinase XerC [Bacillus cereus H3081.97]
 gi|217067516|gb|ACJ81766.1| tyrosine recombinase XerC [Bacillus cereus AH187]
 gi|228643034|gb|EEK99310.1| Tyrosine recombinase xerC [Bacillus cereus BDRD-ST26]
          Length = 299

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 147/294 (50%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDITYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TKTPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          +              L+ +     L  L  +A +  + ISPH
Sbjct: 187 DALITYIENGRKQLAKKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|300718203|ref|YP_003743006.1| Tyrosine recombinase [Erwinia billingiae Eb661]
 gi|299064039|emb|CAX61159.1| Tyrosine recombinase [Erwinia billingiae Eb661]
          Length = 297

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 171/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NT+++Y+ DL  +  +L + E +L       L  +L    +     +S  R
Sbjct: 14  LWIERNLAENTVASYRLDLLSLAGWLQHNESNLLRVDAVDLQGFLAERVEGGYKATSSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+PS  L  PK    LPK L +  I  LL+   +E      
Sbjct: 74  LLSAMRRLFQYLYREKLREDDPSALLASPKLPQRLPKDLSEAQIDRLLQAPSVE------ 127

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++ELLYATG+RV+ELV+L+ + ++L +  + + GKG+KERLV L   A+H
Sbjct: 128 -QPIELRDKAMLELLYATGLRVTELVSLTLNNVSLRQGVVRVIGKGDKERLVPLGEEAVH 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S++   ++RQ F   +K  A  AGI    +SPH++R
Sbjct: 187 WIEQYLEYGRPWLLNGQTLDVLFPSSRAQQMTRQTFWHRIKHYATLAGIDSAKLSPHVLR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 247 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 297


>gi|229134899|ref|ZP_04263706.1| Tyrosine recombinase xerD [Bacillus cereus BDRD-ST196]
 gi|228648574|gb|EEL04602.1| Tyrosine recombinase xerD [Bacillus cereus BDRD-ST196]
          Length = 296

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 107/293 (36%), Positives = 160/293 (54%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M  E+  + NT+ +Y+RDLK    +L    +  +    +  H++++L HL +    + + 
Sbjct: 12  MIVEKGLAKNTVVSYERDLKSYVKYLQNVEQTKTFHEVTRLHIVNFLQHLKENGKSSKTL 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E   + +PS  +E P+    LPK L  D +  LL+         
Sbjct: 72  ARHIASIRSFHQFLLRERAVEHDPSVHIETPQGERKLPKVLSIDEVEALLQT-------T 124

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKGNKER++ L   A
Sbjct: 125 KTASAFGIRDKAMLELLYATGLRVSELIALNLEDVHLTMGFVRCIGKGNKERIIPLGSLA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+Q Y +      M    +     +     LSRQ F + LK LA  A I  K ++PH 
Sbjct: 185 TEAIQKYIEKGRRELMGKKAVDALFLNHHGNRLSRQGFWKILKRLAKEANI-AKELTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVSKTRLKDVYKQFHPRA 296


>gi|304396715|ref|ZP_07378595.1| tyrosine recombinase XerD [Pantoea sp. aB]
 gi|304355511|gb|EFM19878.1| tyrosine recombinase XerD [Pantoea sp. aB]
          Length = 297

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 108/291 (37%), Positives = 172/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLS+Y++DL+ +  +L + +++L + +   L  +L    +     +S  R
Sbjct: 14  LWIERNLAQNTLSSYRQDLQTLTGWLAHHQLTLLSVTPLDLQQFLAERLEGGYKATSSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 74  LLSAMRRLFQYLYREKLRPDDPSALLSAPKLPQRLPKDLSEAQVERLLQAPNIDI----- 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RVSEL+ L+   ++L +  + + GKG+KERLV L   A++
Sbjct: 129 --PLELRDKAMLELLYATGLRVSELIGLTLSDISLRQGVVRVIGKGDKERLVPLGEEAVY 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  L +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 187 WLEQYMEHGRPWLLNGQTLDVMFPSNRAQQMTRQTFWHRIKHYATLAGIDSEKLSPHVMR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 247 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 297


>gi|255325630|ref|ZP_05366727.1| tyrosine recombinase XerD [Corynebacterium tuberculostearicum
           SK141]
 gi|255297240|gb|EET76560.1| tyrosine recombinase XerD [Corynebacterium tuberculostearicum
           SK141]
          Length = 296

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 98/292 (33%), Positives = 153/292 (52%), Gaps = 11/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NTLS Y+RD++    +L +  +  L + +   + +YL  L    +  SS  
Sbjct: 15  LAVERGVSANTLSNYRRDVRRYLAWLGDNGVEDLRSVTRPMVEAYLKDLRS-HMAVSSAN 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R + V R  + F   EG+   + +  +  P     LP+TL  D +  L+E    E     
Sbjct: 74  RALIVARGLHKFAVSEGVVDVDVAVEVTPPSTGQHLPETLSVDEVTALIEATPTE----- 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 VR   L+E+LY TG R+SE+V+L+   ++  +  + ++GKG+KER+V +   A 
Sbjct: 129 --TPVDVRDRALLEMLYGTGARISEIVSLNVDDVSSAQEVIRLRGKGDKERIVPVGSHAR 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            AL  Y          G    LF ++           A  +   AA+     K+ISPH +
Sbjct: 187 QALDAYLVRARPALSKGKTPALFLNTRGGALSR--QSAWTVLKTAAQRAQLGKSISPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLEGGAD+RT+Q LLGH+ ++TTQIYTH+  D L+++ +  HP A
Sbjct: 245 RHSFATHLLEGGADVRTVQELLGHSSVTTTQIYTHVTADSLREVWRTAHPRA 296


>gi|323141913|ref|ZP_08076774.1| tyrosine recombinase XerD [Phascolarctobacterium sp. YIT 12067]
 gi|322413660|gb|EFY04518.1| tyrosine recombinase XerD [Phascolarctobacterium sp. YIT 12067]
          Length = 297

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 107/294 (36%), Positives = 159/294 (54%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN-NKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ E   + NT  AY RDL+ +   L    +  L   S   LI+YL  L Q     S+  
Sbjct: 12  LTVELGLAKNTQLAYMRDLRLLMKSLQLKADEELLQVSRQQLIAYLVRLKQEGRAASTVA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK++ I+ FY FL  E   + NP++ LE   +   LPK L    +  LL++  +      
Sbjct: 72  RKLASIKAFYRFLTAERYIRRNPAEVLEAASRGLHLPKVLSVQEVERLLDEPNL------ 125

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            G     R   ++ELLYATGMRVSELV +    +++  + +I+ GKG+KER++ L  +AL
Sbjct: 126 -GTLDGYRDKTMLELLYATGMRVSELVNVPVKNVDMKMQYVIVMGKGSKERMLPLGRTAL 184

Query: 181 HALQMYKKTCSSMKMTGNDL--WLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           H L+ Y        + G          +   G ++R+ F   + A    AGI K+ ++PH
Sbjct: 185 HYLEHYLSVVRPQLLHGKPDTAAELFVTGWGGPMTRERFYEIIVAYGKSAGISKR-VTPH 243

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH+FA+HLL  G DLR +Q LLGH DISTTQIYTHL  ++L+++    HP A
Sbjct: 244 MLRHSFATHLLNNGTDLRIVQELLGHADISTTQIYTHLDVERLREVYDKTHPRA 297


>gi|228902334|ref|ZP_04066491.1| Tyrosine recombinase xerC [Bacillus thuringiensis IBL 4222]
 gi|228966776|ref|ZP_04127820.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228792875|gb|EEM40433.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228857303|gb|EEN01806.1| Tyrosine recombinase xerC [Bacillus thuringiensis IBL 4222]
          Length = 299

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMK--MTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            +L  Y +         T  D  +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DSLITYIENGRKQLVNKTDEDSRMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|251790996|ref|YP_003005717.1| tyrosine recombinase XerD [Dickeya zeae Ech1591]
 gi|247539617|gb|ACT08238.1| tyrosine recombinase XerD [Dickeya zeae Ech1591]
          Length = 299

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 162/291 (55%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLS+Y+ DL  +  +L +    L  A    L  +L    +     +S  R
Sbjct: 16  LWLERNLAENTLSSYRNDLCSLAEWLAHHNSDLLQAQPLDLQGFLAERLEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R D+PS  L  PK    LPK L +  +  LL     +      
Sbjct: 76  LLSAMRRLFQYLYREKRRADDPSAPLSSPKLPQRLPKDLTEAQVEALLAAPVTD------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++ELLYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPIELRDKAMLELLYATGLRVSELVGLTISDVSLRQGVVRVVGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  L +   S +   ++RQ F   +K  A  A I    +SPH++R
Sbjct: 189 WLEQYLEFSRPWLLNGQTLDVLFPSNRAQQMTRQTFWHRIKHYATLASIDSNKLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|158522508|ref|YP_001530378.1| integrase family protein [Desulfococcus oleovorans Hxd3]
 gi|158511334|gb|ABW68301.1| integrase family protein [Desulfococcus oleovorans Hxd3]
          Length = 308

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 100/295 (33%), Positives = 150/295 (50%), Gaps = 13/295 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN-----NKEISLSAASTNHLISYLNHLSQRKLVT 56
           ++SE+  S NT  AY  DLKE   FL+        + L   S   +  YL  L ++K+  
Sbjct: 21  LASEKGYSPNTCRAYSADLKEFLAFLSPPDDTEHPVCLDDISVIAIRGYLAFLHKKKMDK 80

Query: 57  SSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEA 116
           S+  RK+SV+R F+ +L   G+   NP+  +  PK    +P  L  D +  LL+      
Sbjct: 81  STVSRKLSVLRSFFRYLEKRGIMTGNPARAVLSPKIGRKIPAFLSVDDMFRLLDA----- 135

Query: 117 ENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILS 176
                     +R   + E +Y+TG+RVSE   L A  +   ER   + GKG KER+V + 
Sbjct: 136 --STGDTLLDLRNRAIFETIYSTGIRVSEAAGLDAAHVETDERVFRVYGKGAKERVVPVG 193

Query: 177 PSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
             AL ++  Y+         G +      +   G L+ +   R LK  A R G+   ++S
Sbjct: 194 KKALASIAAYRTRLFEETGIGVEEGPLFLNKNRGRLTTRSMDRILKQTALRCGLTV-SLS 252

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           PH +RH+FA+H+L+ GADLRT+Q +LGH  +STTQ YTH+  DKL ++    HP 
Sbjct: 253 PHALRHSFATHMLDAGADLRTVQEILGHKSLSTTQKYTHVSMDKLMEVYDHAHPR 307


>gi|158426110|ref|YP_001527402.1| tyrosine recombinase [Azorhizobium caulinodans ORS 571]
 gi|158332999|dbj|BAF90484.1| tyrosine recombinase [Azorhizobium caulinodans ORS 571]
          Length = 306

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 118/297 (39%), Positives = 182/297 (61%), Gaps = 7/297 (2%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +   + ER +S +TL AY RDL + ++FL+ ++  + AA+T+ + +YL  L+ R L  +
Sbjct: 10  FLDMQAVERGASRHTLDAYGRDLADFEDFLSVRDHGIDAATTDDIRAYLAELTDRGLKAT 69

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEA- 116
           +  R++S IRQ Y FL  EG R D+P+  LE PK+   LPK L+ D +  L++ A   A 
Sbjct: 70  TVARRLSAIRQLYRFLYAEGRRGDDPAAVLEGPKRGRPLPKVLNVDQVTRLIDTAHDRAG 129

Query: 117 -ENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
            +  +P + +R+R+  L+ELLYATG+R+SELV+L A      +  M+      +  + + 
Sbjct: 130 EDVSSPERLRRLRVVCLVELLYATGLRISELVSLPAAAARARDVIMVTGKGSKERMVPLS 189

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
            P+             S       L+   ++ ++GHL+RQ  AR+LK LA  AG+  + +
Sbjct: 190 GPAKAAMTAYLAARAESGLAVSKWLFP--TAAESGHLTRQHAARELKDLAVAAGVPPQAL 247

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH++RHAFASHLL  GADLR +Q LLGH D+STTQIYTH+L ++L+ +V+D HPL+
Sbjct: 248 SPHVLRHAFASHLLAHGADLRIVQTLLGHADVSTTQIYTHILDERLKSMVRDLHPLS 304


>gi|70726663|ref|YP_253577.1| hypothetical protein SH1662 [Staphylococcus haemolyticus JCSC1435]
 gi|82582336|sp|Q4L5V4|XERC_STAHJ RecName: Full=Tyrosine recombinase xerC
 gi|68447387|dbj|BAE04971.1| xerC [Staphylococcus haemolyticus JCSC1435]
          Length = 297

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 102/297 (34%), Positives = 157/297 (52%), Gaps = 10/297 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S +TL +Y  DL +  +FL  + I+L         +YL++L  + L  ++  
Sbjct: 11  MLKVERNFSAHTLKSYHDDLVQFNHFLEQELINLRTFEYKDARNYLSYLYSQNLKRTTVS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY F   +     NP   L  PKK + LP+  +++ +  L E         A
Sbjct: 71  RKISTLRTFYEFWMTQDETIINPFVQLVHPKKENYLPQFFYEEEMEALFETV-------A 123

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  +++ELLYATG+RVSELV +    ++++   + + GKGNKER V       
Sbjct: 124 KDTKKGLRDRVILELLYATGIRVSELVNIQLKDIDMSLPGVKVLGKGNKERFVPFGEFCR 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y +    ++ T +  +L  +        R V       +   AG+ +  I PH +
Sbjct: 184 QSIEQYLREFKPIQHTKHS-FLLVNMNGAPITERGVRYVLNDVVKRTAGVTE--IHPHKL 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+  + HP AKKE K
Sbjct: 241 RHTFATHLLNQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLRKVYLNAHPRAKKESK 297


>gi|77918237|ref|YP_356052.1| site-specific recombinase [Pelobacter carbinolicus DSM 2380]
 gi|77544320|gb|ABA87882.1| site-specific recombinase [Pelobacter carbinolicus DSM 2380]
          Length = 332

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 102/304 (33%), Positives = 155/304 (50%), Gaps = 22/304 (7%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS---------LSAASTNHLISYLNHLSQR 52
           +  ER  S +TL AY++DL E   FL  +            +       L  YL  L +R
Sbjct: 42  LEVERNLSPHTLRAYRQDLTEFSRFLKQEAGEEGSSNTASAIEQVDALVLRRYLARLHKR 101

Query: 53  KLVTSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQA 112
               ++  RK+S +R F+ +L  +G    +P++T+  PK+   LPK L  D +  L++ A
Sbjct: 102 NRK-TTIGRKLSAVRSFFRYLVRQGELAVSPAETVATPKREQYLPKVLTVDEVFALIKAA 160

Query: 113 KIEAENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERL 172
                     +   VR   ++EL Y++G+RV EL  L    ++L +  + ++GKG+KER+
Sbjct: 161 -------DGDEPLTVRDRAILELFYSSGLRVGELEGLDVGHVDLRDGLVRVRGKGDKERI 213

Query: 173 VILSPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQK 232
           V +   A  AL  Y           +       + + G LS +   R+LK     AGI  
Sbjct: 214 VPMGRPARQALGRYLAER----GVPDREQPLFLNYRGGRLSSRSIERNLKKWLLCAGI-L 268

Query: 233 KNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           K+ SPH +RH FA+HLL+GGADLR IQ LLGH  +STTQ YT +  D+L ++    HP  
Sbjct: 269 KDASPHALRHTFATHLLDGGADLRAIQELLGHASLSTTQKYTQVSLDRLMEVYDRTHPRG 328

Query: 293 KKEK 296
           +K+K
Sbjct: 329 RKKK 332


>gi|293391879|ref|ZP_06636213.1| tyrosine recombinase XerD [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952413|gb|EFE02532.1| tyrosine recombinase XerD [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 297

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 101/287 (35%), Positives = 167/287 (58%), Gaps = 7/287 (2%)

Query: 6   RASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKISV 65
           +  S NT+++Y+ DL  + ++L  + +SL +     L ++L    ++    +S  R +S 
Sbjct: 18  KGLSPNTVASYRLDLTALCDWLEARHLSLLSLDAVDLQTFLGERVEQDYKATSTARLLSA 77

Query: 66  IRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQWK 125
           IR+ + +L  E  R D+PS  L  PK  + LPK L +  + +LL          +  Q  
Sbjct: 78  IRKLFQYLYQEKYRTDDPSAVLSSPKLPNRLPKYLTEQQVTDLLNV-------QSLEQPI 130

Query: 126 RVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQM 185
            +R   ++ELLYATG+RV+ELV+L+ +++NL +  + + GKG KER+V +   A H ++ 
Sbjct: 131 ELRDKAMLELLYATGLRVTELVSLNTNSINLNQGVVRVIGKGKKERIVPMGEEATHWVKQ 190

Query: 186 YKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAFA 245
           +      M + G    +   S +   ++RQ F   +K  A  A I  + +SPH++RHAFA
Sbjct: 191 FMLFARPMLLGGQSSDVLFPSRRGTQMTRQTFWHRIKHYAVLAEIDSEMLSPHVLRHAFA 250

Query: 246 SHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +HL+  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L + YHP  
Sbjct: 251 THLVNHGADLRVVQMLLGHSDLSTTQIYTHVAKERLKRLHERYHPRG 297


>gi|228475035|ref|ZP_04059763.1| tyrosine recombinase XerC [Staphylococcus hominis SK119]
 gi|228271020|gb|EEK12408.1| tyrosine recombinase XerC [Staphylococcus hominis SK119]
          Length = 297

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 103/297 (34%), Positives = 153/297 (51%), Gaps = 10/297 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S +TL AY  DL +   FL  + ++L         +YL++L    L  ++  
Sbjct: 11  MLKVERNFSDHTLKAYHDDLAQFNQFLEQELLNLRTFEYKDARNYLSYLYSNNLKRTTVS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY F   +    +NP   L  PKK   LP+  +++ +  L      +A+   
Sbjct: 71  RKISTLRTFYEFWMTQDTSVNNPFIQLVHPKKEQYLPQFFYEEEMEALFNTVSNDAK--- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  ++IELLYATG+RVSELV +    L++    + + GKGNKER V       
Sbjct: 128 ----KGLRDRVVIELLYATGIRVSELVNIKVMDLDMNLPGVKVLGKGNKERFVPFGEFCR 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y +    +K   +  +L  +        R V       +   AG+ +  I PH +
Sbjct: 184 QSIEQYLEKFKPLKSKSH-PYLIVNMKGDPITERGVRYLLNDVVERTAGVTE--IHPHKL 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+    HP AKKE K
Sbjct: 241 RHTFATHLLNQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLRKVYLSAHPRAKKESK 297


>gi|282916763|ref|ZP_06324521.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           D139]
 gi|283770568|ref|ZP_06343460.1| tyrosine recombinase xerD [Staphylococcus aureus subsp. aureus H19]
 gi|282319250|gb|EFB49602.1| tyrosine recombinase XerD [Staphylococcus aureus subsp. aureus
           D139]
 gi|283460715|gb|EFC07805.1| tyrosine recombinase xerD [Staphylococcus aureus subsp. aureus H19]
 gi|302333169|gb|ADL23362.1| site-specific recombinase XerD [Staphylococcus aureus subsp. aureus
           JKD6159]
          Length = 295

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 105/293 (35%), Positives = 156/293 (53%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ Q+++    IS +       +   L HL  +     S 
Sbjct: 11  FIQIEKGLSSNTIGAYRRDLKKYQDYMTEHHISHIDFIDRQLIQECLGHLIDQGQSAKSI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  L+ PK +  LP  L+ D +  LLE         
Sbjct: 71  ARFISTIRSFHQFAIREKYAAKDPTVLLDSPKYDKKLPDVLNVDEVLALLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSEL+ L    +NL    + + GKG+KER+V L  + 
Sbjct: 124 DLNKINGYRDRTMLELLYATGMRVSELIHLELEHVNLIMGFVRVFGKGDKERIVPLGDAV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +      +   +     LSRQ   + +K    +A I KK ++PH 
Sbjct: 184 IEYLTTYIETIRPQLLKKTVTEVLFLNMHGKPLSRQAIWKMIKQNGVKANI-KKTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQFHPRA 295


>gi|118479053|ref|YP_896204.1| site-specific tyrosine recombinase XerC [Bacillus thuringiensis
           str. Al Hakam]
 gi|228986974|ref|ZP_04147100.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|118418278|gb|ABK86697.1| tyrosine recombinase XerC subunit [Bacillus thuringiensis str. Al
           Hakam]
 gi|228772752|gb|EEM21192.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 302

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 17  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDITYADVRLYLTTLHDEKLARKSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 77  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 130 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 189

Query: 181 HALQMYKKTCSSM--KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +       + T     +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 190 DALITYIENGRKQLAEKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 248

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 249 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 302


>gi|49478402|ref|YP_037892.1| site-specific tyrosine recombinase XerC [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|196042353|ref|ZP_03109624.1| tyrosine recombinase XerC [Bacillus cereus NVH0597-99]
 gi|218904959|ref|YP_002452793.1| tyrosine recombinase XerC [Bacillus cereus AH820]
 gi|225865812|ref|YP_002751190.1| tyrosine recombinase XerC [Bacillus cereus 03BB102]
 gi|228916468|ref|ZP_04080034.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228928879|ref|ZP_04091911.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935145|ref|ZP_04097972.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228947550|ref|ZP_04109840.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|229123345|ref|ZP_04252549.1| Tyrosine recombinase xerC [Bacillus cereus 95/8201]
 gi|229157407|ref|ZP_04285485.1| Tyrosine recombinase xerC [Bacillus cereus ATCC 4342]
 gi|254721983|ref|ZP_05183772.1| site-specific tyrosine recombinase XerC [Bacillus anthracis str.
           A1055]
 gi|301055321|ref|YP_003793532.1| tyrosine recombinase [Bacillus anthracis CI]
 gi|49329958|gb|AAT60604.1| site-specific integrase/recombinase [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|196026809|gb|EDX65445.1| tyrosine recombinase XerC [Bacillus cereus NVH0597-99]
 gi|218540108|gb|ACK92506.1| tyrosine recombinase XerC [Bacillus cereus AH820]
 gi|225791021|gb|ACO31238.1| tyrosine recombinase XerC [Bacillus cereus 03BB102]
 gi|228626134|gb|EEK82883.1| Tyrosine recombinase xerC [Bacillus cereus ATCC 4342]
 gi|228660121|gb|EEL15757.1| Tyrosine recombinase xerC [Bacillus cereus 95/8201]
 gi|228812070|gb|EEM58401.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228824510|gb|EEM70315.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830686|gb|EEM76291.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228843047|gb|EEM88129.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|300377490|gb|ADK06394.1| tyrosine recombinase [Bacillus cereus biovar anthracis str. CI]
          Length = 299

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDITYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSM--KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +       + T     +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DALITYIENGRKQLAEKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|314936587|ref|ZP_07843934.1| tyrosine recombinase XerC [Staphylococcus hominis subsp. hominis
           C80]
 gi|313655206|gb|EFS18951.1| tyrosine recombinase XerC [Staphylococcus hominis subsp. hominis
           C80]
          Length = 297

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 102/297 (34%), Positives = 153/297 (51%), Gaps = 10/297 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S +TL AY  DL +   FL  + ++L         +YL++L    L  ++  
Sbjct: 11  MLKVERNFSDHTLKAYHDDLAQFNQFLEQELLNLRTFEYKDARNYLSYLYSNNLKRTTVS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY F   +    +NP   L  PKK   LP+  +++ +  L      +A+   
Sbjct: 71  RKISTLRTFYEFWMTQDTSVNNPFIQLVHPKKEQYLPQFFYEEEMEALFNTVSNDAK--- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  ++IELLYATG+RVSELV +    L++    + + GKGNKER V       
Sbjct: 128 ----KGLRDRVVIELLYATGIRVSELVNIKVMDLDMNLPGVKVLGKGNKERFVPFGEFCR 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y +    +K   +  +L  +        R +       +   AG+ +  I PH +
Sbjct: 184 QSIEQYLEKFKPLKSKSH-PYLIVNMKGDPITERGIRYLLNDVVKRTAGVTE--IHPHKL 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+    HP AKKE K
Sbjct: 241 RHTFATHLLNQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLRKVYLSAHPRAKKESK 297


>gi|253687046|ref|YP_003016236.1| tyrosine recombinase XerD [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753624|gb|ACT11700.1| tyrosine recombinase XerD [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 299

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 168/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL+ +  +L + +  L  A    L ++L          +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLRTLAEWLAHHDNDLLQAQALDLQAFLADRVDGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+ +L  E LR D+PS  L  PK    LPK L +  +  LL    IE      
Sbjct: 76  LLSAMRRFFQYLYREKLRSDDPSAVLSSPKLPQRLPKDLSEAQVDALLNAPSIE------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDVSLRQGVVRVLGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S +   ++RQ F   +K  A  A I  + +SPH++R
Sbjct: 189 WIEYYLEHGRPWLLNGQTLDVLFPSNRARQMTRQTFWHRIKYYAVLASIDSEKLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|188026224|ref|ZP_02961334.2| hypothetical protein PROSTU_03358 [Providencia stuartii ATCC 25827]
 gi|188022113|gb|EDU60153.1| hypothetical protein PROSTU_03358 [Providencia stuartii ATCC 25827]
          Length = 307

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 98/288 (34%), Positives = 162/288 (56%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           E+  + NTL++Y+ DL+ +  +L   ++ L +  +  L S+L    +     +S  R +S
Sbjct: 27  EQDLAENTLASYRLDLQLLDKWLEANQLDLESVQSIDLQSFLAERIEGGYKAASSARLLS 86

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            +R+ + +   E +R D+PS  +  PK    LPK L +  + +LL          A    
Sbjct: 87  AMRRLFQYFYREKIRLDDPSAVIAAPKIPQRLPKDLSEQQVEDLLNAP-------ATEDP 139

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++E+LYA G+RVSELV L+   ++L +  + + GKGNKERL+ L   A++ ++
Sbjct: 140 LELRDKAMLEVLYACGLRVSELVGLTFSDISLRQGVIRVVGKGNKERLIPLGEEAIYWVE 199

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            Y +      + G    +   S +   ++RQ F   +K  A  A I  + +SPH++RHAF
Sbjct: 200 KYLEEGRPDLLNGKASDVLFPSKRGTKMTRQTFWHRIKHYAVIANIDSEALSPHVLRHAF 259

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L + +HP  
Sbjct: 260 ATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRMLHEQHHPRG 307


>gi|296332285|ref|ZP_06874747.1| site-specific tyrosine recombinase XerD [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674986|ref|YP_003866658.1| site-specific tyrosine recombinase for chromosome partitioning
           [Bacillus subtilis subsp. spizizenii str. W23]
 gi|296150599|gb|EFG91486.1| site-specific tyrosine recombinase XerD [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413230|gb|ADM38349.1| site-specific tyrosine recombinase for chromosome partitioning
           [Bacillus subtilis subsp. spizizenii str. W23]
          Length = 296

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 106/291 (36%), Positives = 157/291 (53%), Gaps = 10/291 (3%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNN--KEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
            ER  S NT+ +Y+RDLK    +L         +  +  H+I YL HL        +  R
Sbjct: 14  VERGLSQNTVVSYERDLKSYSLYLTETLHVTDWNHVTRIHIIQYLKHLKDSGKSGKTSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ IR F+ FL  E +   +PS  +E  K    LPK L  + +  LL+  K+ +     
Sbjct: 74  HLASIRSFHQFLLREKVTDKDPSVHIETQKTERALPKVLALNEVERLLDTPKLTSPF--- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                 R   ++ELLYATG+RVSE++ L    ++L+   +   GKG KER+V +  +A  
Sbjct: 131 ----GYRDKAMLELLYATGIRVSEMIELKTADVHLSMGFVRCFGKGRKERIVPIGEAAAS 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           A++ Y        +  N       +     +SRQ F ++LK +A  AGI KK ++PH +R
Sbjct: 187 AIEEYITKARGKLLKNNVSDALFLNHHGKQISRQGFWKNLKKIALEAGI-KKELTPHTLR 245

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FASHLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 246 HSFASHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYKQFHPRA 296


>gi|170765975|ref|ZP_02900786.1| tyrosine recombinase XerD [Escherichia albertii TW07627]
 gi|170125121|gb|EDS94052.1| tyrosine recombinase XerD [Escherichia albertii TW07627]
          Length = 298

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  P+    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAYLASPRLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|188581692|ref|YP_001925137.1| tyrosine recombinase XerD [Methylobacterium populi BJ001]
 gi|179345190|gb|ACB80602.1| tyrosine recombinase XerD [Methylobacterium populi BJ001]
          Length = 332

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 125/295 (42%), Positives = 184/295 (62%), Gaps = 8/295 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER ++ NTL+AY+RDL +   +L  + I    A  + + +Y+  L  R L  SS  
Sbjct: 22  MLAAERGAAANTLAAYRRDLDDYLGYLAQQGIDPEEAQADQVRAYIASLEPRGLKASSAA 81

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE---AE 117
           R++S IR F+ FL  EG  + +P+  +  P++   LPK L    +  LL  A+     A 
Sbjct: 82  RRLSCIRGFHRFLYAEGYCETDPTAPVAAPRRAKGLPKILSVAEVDRLLATARDRVEAAG 141

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
           +         R+  L+ELLYATG+RVSELV L     +  ER ++++GKG +ERLV L+ 
Sbjct: 142 DDRTEARSAARMLCLLELLYATGLRVSELVALPRSAASARERYLVVKGKGGRERLVPLTE 201

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
            A  A++          +T +  WLFP+ +++GHL+RQ FARDLK  AA AG++   +SP
Sbjct: 202 LAREAMR-----AHVAHLTADGAWLFPADSESGHLTRQAFARDLKVAAAAAGLRTDRVSP 256

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H++RHAFASHLL+ GADLR +Q LLGH D+STTQIYTH+L ++L+ +V+D HPL 
Sbjct: 257 HVLRHAFASHLLQNGADLRIVQELLGHADVSTTQIYTHVLDERLKGMVRDLHPLN 311


>gi|23099003|ref|NP_692469.1| site-specific tyrosine recombinase XerC [Oceanobacillus iheyensis
           HTE831]
 gi|34222801|sp|Q7ZAM5|XERC_OCEIH RecName: Full=Tyrosine recombinase xerC
 gi|22777231|dbj|BAC13504.1| integrase:recombinase [Oceanobacillus iheyensis HTE831]
          Length = 305

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 94/297 (31%), Positives = 144/297 (48%), Gaps = 9/297 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+ +S  T+  Y+ DL+   +FL ++ +S ++  +   +  +L  L +++L   S  
Sbjct: 15  LQIEKNASPYTVKYYRNDLEIFADFLRSEGLSHIANVTYKDVRIFLTSLYEQELSRRSVS 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY FL  EG  + NP   L LPK +  +P  L+++ +  L E          
Sbjct: 75  RKISTLRSFYRFLEREGYVEGNPFVQLHLPKTSKPVPGFLYQEELDKLFEV-------ND 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+E+LY TG+RVSE   L    ++    T+ ++GKG KER V     A 
Sbjct: 128 ITTPLGQRDQALLEMLYGTGIRVSECQNLRLQDIDFAIGTIFVRGKGRKERYVPFGSFAE 187

Query: 181 HALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
            AL+ Y +   + +    N    F      G        R +            ++ PH 
Sbjct: 188 IALETYLQEGRTKLLEKSNSDTEFIFLNSRGGHLTNRGIRTILNKIVERASLTVHVHPHK 247

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           +RH FA+HLL  GADLR++Q LLGH  +S+TQIYTH+  D L++     HP A   K
Sbjct: 248 LRHTFATHLLNEGADLRSVQELLGHESLSSTQIYTHVTKDHLREAYMKSHPRANGNK 304


>gi|183221728|ref|YP_001839724.1| tyrosine recombinase xerD [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189911803|ref|YP_001963358.1| site-specific recombinase XerD [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167776479|gb|ABZ94780.1| Site-specific recombinase XerD [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167780150|gb|ABZ98448.1| Tyrosine recombinase xerD [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 302

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 91/291 (31%), Positives = 152/291 (52%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +S E+  S N++ +Y  DL +   FL  + I+      N ++ +L    +RK+   +  R
Sbjct: 20  LSVEKGLSDNSIYSYGYDLNKFAIFLEKEHINFLEVKANDIMRFLEEERERKISAKTLAR 79

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           ++  IRQFY +L  E     NP++ +E P+    +P  L +  I  L    K +      
Sbjct: 80  EVVAIRQFYKYLRDEKRLDSNPTEKIETPEVARTIPDYLTQAEIEELFRNIKED------ 133

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   + ELLY++G+R+SE   L    +++   T+ ++GKG ++RLV     +L 
Sbjct: 134 -NLYELRDKCIFELLYSSGLRISEACNLKMTDIDMENMTITVEGKGGRQRLVPFGEKSLE 192

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y     +  +          S K  +++R+   R L     R  I+KK ++PH +R
Sbjct: 193 ILKRYLVESRTEILKKRTCDFVFVSKKGSYINRKSVWRLLNHYIKRTKIKKK-VTPHTLR 251

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE  ADL+++Q LLGH DISTTQIYTH+    L+++ + +HP  
Sbjct: 252 HSFATHLLENHADLKSVQELLGHIDISTTQIYTHMANKTLKEVHKKFHPRG 302


>gi|24215183|ref|NP_712664.1| integrase/recombinase XerD [Leptospira interrogans serovar Lai str.
           56601]
 gi|45657354|ref|YP_001440.1| putative integrase/recombinase protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|34222802|sp|Q7ZAM7|XERD_LEPIN RecName: Full=Tyrosine recombinase xerD
 gi|73920480|sp|Q72SA5|XERD_LEPIC RecName: Full=Tyrosine recombinase xerD
 gi|24196257|gb|AAN49682.1| integrase/recombinase XerD [Leptospira interrogans serovar Lai str.
           56601]
 gi|45600593|gb|AAS70077.1| putative integrase/recombinase protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 298

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 95/291 (32%), Positives = 155/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +S E+  S N++ +Y  DL + +NFL  + I       + ++ +LN    RK+ + +  R
Sbjct: 16  LSVEKGLSDNSIYSYGYDLNKFKNFLEKEHIDFLKVQADDIMRFLNEEKDRKISSKTIAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           ++  IRQFY FL  E     NP++ +E P+    +P  L +D I  L    K +      
Sbjct: 76  EVVAIRQFYKFLKDEKKLDTNPTEKIETPEVMRSIPDYLTQDEIEELFASIKED------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   + ELLY++G+R+SE   L  + ++L   T+ ++GKG ++RLV     +L 
Sbjct: 130 -NLYELRDKCIFELLYSSGLRISEACNLRLNDMDLEGMTLTVEGKGGRQRLVPFGEKSLD 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L  Y K      +   +      S K  +++R+   R L     R  I KK ++PH +R
Sbjct: 189 ILNRYLKQSRPFILKSRNCEYLFVSKKGSYINRKSVWRLLNHYIKRTSILKK-VTPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE  ADL+++Q LLGH DI+TTQIYTH+    L+++ + +HP  
Sbjct: 248 HSFATHLLENHADLKSVQELLGHIDIATTQIYTHMANKTLREVHKKFHPRG 298


>gi|324115089|gb|EGC09054.1| tyrosine recombinase XerD [Escherichia fergusonii B253]
          Length = 298

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYRENFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|52141657|ref|YP_085172.1| site-specific tyrosine recombinase XerC [Bacillus cereus E33L]
 gi|51975126|gb|AAU16676.1| site-specific integrase/recombinase XerD protein [Bacillus cereus
           E33L]
          Length = 299

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDITYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TATPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSM--KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +       + T     +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DALITYIENGRKQLAEKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|257887731|ref|ZP_05667384.1| phage integrase [Enterococcus faecium 1,141,733]
 gi|257896226|ref|ZP_05675879.1| phage integrase [Enterococcus faecium Com12]
 gi|293379533|ref|ZP_06625675.1| tyrosine recombinase XerD [Enterococcus faecium PC4.1]
 gi|257823785|gb|EEV50717.1| phage integrase [Enterococcus faecium 1,141,733]
 gi|257832791|gb|EEV59212.1| phage integrase [Enterococcus faecium Com12]
 gi|292641842|gb|EFF60010.1| tyrosine recombinase XerD [Enterococcus faecium PC4.1]
          Length = 295

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 104/292 (35%), Positives = 160/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NT  +Y+RDL++  +FL  +++ S        +I +L  L + K  T++  
Sbjct: 12  LNIERGLSANTRQSYERDLEQYLHFLEEQKVASWQDVDRFLVIRFLEKLHEEKKATATVT 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R+F+ FL  E +   +P   ++ PKK   LP TL    +  L+E          
Sbjct: 72  RMISSLRRFHQFLRQERVTDHDPMQHIDTPKKAQKLPSTLTLAEVEKLIEAP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATGMRVSEL+ L    L+L+   +   GKG+KER++ L   A+
Sbjct: 125 TTKTLGIRDRAILEVMYATGMRVSELIGLKLGDLHLSLGLVQTVGKGDKERIIPLGDYAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y      + +          +     LSRQ   ++LK L   AGI  K ++PH +
Sbjct: 185 QWLERYLDEARPLLVKDASEMHVFVNNHGKGLSRQGIWKNLKQLVREAGI-YKEVTPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLRT+Q LLGH DISTTQIYTH+   ++  + + + P A
Sbjct: 244 RHSFATHLLENGADLRTVQELLGHADISTTQIYTHITKKRMTDVYKQHFPRA 295


>gi|27375301|ref|NP_766830.1| site-specific integrase/recombinase [Bradyrhizobium japonicum USDA
           110]
 gi|34222843|sp|Q89XW5|XERD_BRAJA RecName: Full=Tyrosine recombinase xerD
 gi|27348437|dbj|BAC45455.1| xerD [Bradyrhizobium japonicum USDA 110]
          Length = 318

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 132/302 (43%), Positives = 188/302 (62%), Gaps = 8/302 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++E+ +  NTL AY+RDL +   FL     S + A T  L  YL  L  R   ++S  
Sbjct: 17  MLAAEQGAGPNTLDAYRRDLTDFSEFLGRVGHSFADAETQTLRDYLADLDTRGFKSTSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +R  Y FL  E +R D+P+  L  PK+   LPK L    +  +L +A+  +E   
Sbjct: 77  RRLSAMRHLYRFLLNERIRGDDPAAILSGPKRGRGLPKVLSIADVDRMLRRARELSEAED 136

Query: 121 PG---QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                + + +R++ L+E+LYATG+RVSELV L         R ++++GKGNKERLV L+ 
Sbjct: 137 ASPSKRLRALRLYCLLEVLYATGLRVSELVALPRTAAKRDARMIVVRGKGNKERLVPLNE 196

Query: 178 SALHALQMYKKTCSSMKMTGN-----DLWLFPSSTKTGHLSRQVFARDLKALAARAGIQK 232
           ++  A+  Y     + K           WLFPS  ++GHL+RQ FARDLK LA  +G+Q 
Sbjct: 197 ASRQAMADYLAATEAAKSDKKTGVAASKWLFPSFGESGHLTRQHFARDLKELAVASGLQA 256

Query: 233 KNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           + +SPH++RHAFASHLL  GADLR +Q LLGHTDISTTQIYTH++ ++L+ LV+D HPLA
Sbjct: 257 RLVSPHVLRHAFASHLLHNGADLRIVQTLLGHTDISTTQIYTHVVEERLKSLVRDLHPLA 316

Query: 293 KK 294
           +K
Sbjct: 317 EK 318


>gi|332086819|gb|EGI91955.1| tyrosine recombinase XerD [Shigella boydii 5216-82]
          Length = 298

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGVTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|329962342|ref|ZP_08300347.1| tyrosine recombinase XerD [Bacteroides fluxus YIT 12057]
 gi|328530203|gb|EGF57084.1| tyrosine recombinase XerD [Bacteroides fluxus YIT 12057]
          Length = 317

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 101/297 (34%), Positives = 162/297 (54%), Gaps = 9/297 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E++ S NTL AY+ DL+++  FL  ++I + A + + L  +   L    +   SQ R
Sbjct: 24  LKLEKSLSPNTLDAYRTDLEKLLRFLEAEKIDILAVTLDDLQRFTAGLHDIGIHPRSQAR 83

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S I+ F++FL      + +PS+ LE PK    LP+ L  + I  ++            
Sbjct: 84  ILSGIKSFFHFLVLADYLEGDPSELLEGPKIGFKLPEVLTVEEIDKIISTV-------DL 136

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
              +  R   ++E LY+ G+RVSEL  L    L   E  + ++GKG+K+RLV +SP A+ 
Sbjct: 137 STNEGQRNRAILETLYSCGLRVSELCNLKISDLYFDEGFIKVEGKGSKQRLVPISPRAIK 196

Query: 182 ALQMYKKTCSS-MKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            ++ +    +   K+  +       +     +SR +    +K LA +AGI  KNISPH  
Sbjct: 197 EIKNWFADRNEKWKIKKDFEDYVFLARWGNGISRIMIFHLIKELAEKAGIT-KNISPHTF 255

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           RH+FA+HLLEGGA+LR IQ +LGH  I+TT+IYTH+  + L+  + ++HP   K +K
Sbjct: 256 RHSFATHLLEGGANLRAIQCMLGHESIATTEIYTHIDRNMLRSEIIEHHPRNIKYRK 312


>gi|315092744|gb|EFT64720.1| tyrosine recombinase XerD [Propionibacterium acnes HL060PA1]
          Length = 306

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 85/297 (28%), Positives = 142/297 (47%), Gaps = 13/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+ AY+RDL   Q +L ++ I SL+  +   +  +  HL    L  +S  
Sbjct: 16  LVVERGLSDNTVQAYRRDLLRYQEYLGSRGIGSLAEVTRVDVEEFRRHLDHIGLAPASVT 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +  +R  + F    G  + + +  +    ++  LPK L  D + +LL           
Sbjct: 76  RCVVAVRNLHRFAVGSGQVQADVTAGMSPGTRSRRLPKALTMDQVESLLAAP-------D 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTM-----IIQGKGNKERLVIL 175
               + +R   L+ELLY TG RVSE+  L    +            +I     +  + + 
Sbjct: 129 TSTVEGLRDVALLELLYGTGARVSEVCALDVDDIRRVLDDPDLGLRLIGKGDKERIVPLG 188

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
           S +A        +   +    GN       +T+   LSRQ     ++     AG+  +++
Sbjct: 189 SYAAKAVDAWLIRGRPAWAEIGNGEHALLLNTRGRRLSRQSAWAVIRRAGEAAGLDVEHL 248

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH +RH++A+HLL+GGAD+R +Q LLGH+ ++TTQIYT +  D L+++ +  HP A
Sbjct: 249 SPHSLRHSYATHLLDGGADVRVVQELLGHSSVTTTQIYTLVTADHLREVYRSSHPRA 305


>gi|226328247|ref|ZP_03803765.1| hypothetical protein PROPEN_02140 [Proteus penneri ATCC 35198]
 gi|225202980|gb|EEG85334.1| hypothetical protein PROPEN_02140 [Proteus penneri ATCC 35198]
          Length = 312

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 110/288 (38%), Positives = 166/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           E+  S NTLS+Y+ DL+ +  +L + ++   + ST  L S+L          SS  R +S
Sbjct: 32  EQGLSANTLSSYRLDLQALGQWLAHHQLDWLSVSTLDLQSFLATRLDEGYKASSAARLLS 91

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            +R+ + +L  E LR D+PS  L  PK    LPK L +  + +LL    I+       + 
Sbjct: 92  TMRRLFQYLYREKLRLDDPSALLSTPKLPKRLPKDLSEQQVDDLLNAPCID-------EP 144

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++E+LYA G+RVSELV LS   ++L +  + + GKG+KERLV L   A++ L+
Sbjct: 145 LELRDKAMLEVLYACGLRVSELVGLSLSDISLRQGVLRVIGKGDKERLVPLGEEAIYWLE 204

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            Y +      M G    +   S +   ++RQ F   +K  A  AGI  + +SPH++RHAF
Sbjct: 205 QYLQYGRPTLMQGKTDDIVFPSLRGQKMTRQTFWHRIKHYAVIAGIDTEKLSPHVLRHAF 264

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L Q +HP  
Sbjct: 265 ATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKVLHQQHHPRG 312


>gi|261211515|ref|ZP_05925803.1| site-specific recombinase XerD [Vibrio sp. RC341]
 gi|260839470|gb|EEX66096.1| site-specific recombinase XerD [Vibrio sp. RC341]
          Length = 302

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           M  ER  + NT+++Y+ DL ++  ++      L   S + L  Y + LS++    SS+ R
Sbjct: 19  MWLERGLAENTVASYRNDLSKLLEWMEQHHYRLDFISFSGLQEYQSWLSEQNYKPSSKAR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LL           P
Sbjct: 79  MLSAIRRLFQYLHREKVRADDPSALLISPKLPIRLPKDLSEAQVDALLNAP-------DP 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+ 
Sbjct: 132 QTPIELRDKAMLELLYATGLRVTELVSLTMENMSLRQGVVRVIGKGGKERLVPMGENAIE 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ + +   S+ +      +   S++   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 192 WIETFLQQGRSLLLGEQTSDIVFPSSRGQQMTRQTFWHRIKHYAVIAGIDVEKLSPHVLR 251

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 252 HAFATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHNEHHPRA 302


>gi|227551150|ref|ZP_03981199.1| site-specific DNA tyrosine recombinase [Enterococcus faecium
           TX1330]
 gi|227179712|gb|EEI60684.1| site-specific DNA tyrosine recombinase [Enterococcus faecium
           TX1330]
          Length = 300

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 104/292 (35%), Positives = 160/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NT  +Y+RDL++  +FL  +++ S        +I +L  L + K  T++  
Sbjct: 17  LNIERGLSANTRQSYERDLEQYLHFLEEQKVASWQDVDRFLVIRFLEKLHEEKKATATVT 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R+F+ FL  E +   +P   ++ PKK   LP TL    +  L+E          
Sbjct: 77  RMISSLRRFHQFLRQERVTDHDPMQHIDTPKKAQKLPSTLTLAEVEKLIEAP-------D 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATGMRVSEL+ L    L+L+   +   GKG+KER++ L   A+
Sbjct: 130 TTKTLGIRDRAILEVMYATGMRVSELIGLKLGDLHLSLGLVQTVGKGDKERIIPLGDYAI 189

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y      + +          +     LSRQ   ++LK L   AGI  K ++PH +
Sbjct: 190 QWLERYLDEARPLLVKDASEMHVFVNNHGKGLSRQGIWKNLKQLVREAGI-YKEVTPHTL 248

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLRT+Q LLGH DISTTQIYTH+   ++  + + + P A
Sbjct: 249 RHSFATHLLENGADLRTVQELLGHADISTTQIYTHITKKRMTDVYKQHFPRA 300


>gi|322381748|ref|ZP_08055702.1| site-specific tyrosine recombinase XerD-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154136|gb|EFX46458.1| site-specific tyrosine recombinase XerD-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 298

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 95/293 (32%), Positives = 147/293 (50%), Gaps = 8/293 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  + NT+ +YK+DL +  +FL+++ I +       H+I+Y+N+L Q     ++  
Sbjct: 12  LQDERRLAPNTVESYKKDLAQYADFLSSEGILAWEETQRVHVITYMNNLKQLGRAPATIS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +  IR  Y++L  E +   +PS  +E PK    +P  L  + + NLL         P 
Sbjct: 72  RTLVSIRALYHYLIREQVMTLDPSGQVESPKAETKIPVILTVEEMDNLL-------GVPN 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            G    +R   ++ELLYATG+RVSEL+TL+   +      +   G G KER+V +   A 
Sbjct: 125 TGTSSGLRDKAMLELLYATGIRVSELITLNKGDIYADLGYVRCTGTGGKERIVPMGKVAT 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +Q Y        +              G    +     +    A      K I+PH +
Sbjct: 185 LWIQRYLNEAREALLKEGKPDKALFLNHIGTRMTRQGFWKMMKKYATEAGIHKEITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           RH+FA+HLLE GADLR +Q LLGH+D+STTQ YT +   K++++    HP AK
Sbjct: 245 RHSFATHLLENGADLRAVQELLGHSDLSTTQRYTFVTKTKMKEVYDLTHPRAK 297


>gi|291618684|ref|YP_003521426.1| XerD [Pantoea ananatis LMG 20103]
 gi|291153714|gb|ADD78298.1| XerD [Pantoea ananatis LMG 20103]
          Length = 297

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 112/291 (38%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLS+Y++DL+ +  +L +  ++L+  S   L  +L    +     SS  R
Sbjct: 14  LWIERNLAQNTLSSYRQDLQTLTGWLAHHGLTLTTLSAPDLQQFLAERLEGGYKASSSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E +R D+PS  L  PK    LPK L +  +  LL+           
Sbjct: 74  LLSAMRRLFQYLYREKMRTDDPSAMLAAPKLPQRLPKDLSEAQVDRLLQAP-------DV 126

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RVSELV L+ + ++L +  + + GKGNKERLV L   A+H
Sbjct: 127 NVPLELRDKAMLELLYATGLRVSELVGLTLNDVSLRQGVVRVIGKGNKERLVPLGEEAVH 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  L +F  S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 187 WLEYYMEHGRPWLLNGQTLDVFFPSNRAQQMTRQTFWHRIKHYAMLAGIDSEKLSPHVLR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L Q +HP A
Sbjct: 247 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRLLHQQHHPRA 297


>gi|323439501|gb|EGA97222.1| site-specific recombinase [Staphylococcus aureus O11]
 gi|323441531|gb|EGA99182.1| site-specific recombinase [Staphylococcus aureus O46]
          Length = 295

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 105/293 (35%), Positives = 156/293 (53%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT+ AY+RDLK+ Q+++    IS +       +   L HL  +     S 
Sbjct: 11  FIQIEKGLSSNTIGAYRRDLKKYQDYMTEHHISHIDFIDRQLIQECLGHLIDQGQSAKSI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ F   E     +P+  L+ PK +  LP  L+ D +  LLE         
Sbjct: 71  ARFISTIRSFHQFAIREKYAAKDPTVLLDSPKYDKKLPDVLNVDEVLALLETP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSEL+ L    +NL    + + GKG+KER+V L  + 
Sbjct: 124 DLNKINGYRDRTMLELLYATGMRVSELIHLELEHVNLIMGFVRVFGKGDKERIVPLGDTV 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y +T     +      +   +     LSRQ   + +K    +A I KK ++PH 
Sbjct: 184 IEYLTTYIETIRPQLLKKTVTEVLFLNMHGKPLSRQAIWKMIKQNGVKANI-KKTLTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH+DISTTQ+YTH+   +++K+   +HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQFHPRA 295


>gi|227503694|ref|ZP_03933743.1| site-specific tyrosine recombinase XerD [Corynebacterium accolens
           ATCC 49725]
 gi|227075730|gb|EEI13693.1| site-specific tyrosine recombinase XerD [Corynebacterium accolens
           ATCC 49725]
          Length = 296

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 97/292 (33%), Positives = 154/292 (52%), Gaps = 11/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NTLS Y+RD++   ++L   E+  L   +   + +YL  L +  +  SS  
Sbjct: 15  LAVERGVSANTLSNYRRDIRRYVDWLAVNEVQDLRQVTRPMVEAYLKDLRET-MAVSSAN 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R + V R  + F   EG    + +  +  P     LP+TL  D +  L+E    E     
Sbjct: 74  RALIVARGLHKFAVAEGEIDSDVAAEVSPPSTGQHLPETLSVDEVTQLIEATPTE----- 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   L+E+LY TG R+SE+++L+   +   +  +++ GKG+KERLV L   A 
Sbjct: 129 --TPVDLRDRALLEVLYGTGARISEVISLNVDDVATGDDVLVLHGKGDKERLVPLGSHAR 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  Y      +   G    LF ++       +  ++      AA+     K+ISPH +
Sbjct: 187 QAIDAYLVRARPVLGKGKTAALFLNTRGGALSRQSAWSIIKT--AAQRSQLDKSISPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLEGGAD+RT+Q LLGH+ ++TTQIYTH+  D L+++ +  HP A
Sbjct: 245 RHSFATHLLEGGADVRTVQELLGHSSVTTTQIYTHVTADSLREVWRTAHPRA 296


>gi|229162767|ref|ZP_04290724.1| Tyrosine recombinase xerC [Bacillus cereus R309803]
 gi|228620649|gb|EEK77518.1| Tyrosine recombinase xerC [Bacillus cereus R309803]
          Length = 302

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 98/294 (33%), Positives = 145/294 (49%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 17  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG R DNP     LPKK   +PK L+ + +  L E          
Sbjct: 77  RKVSSLRSLYRFLMREGYRTDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+Y TG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 130 TETPLGQRNQALLELMYGTGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 189

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          +              L+ +     L  L  +A +  + ISPH
Sbjct: 190 DALITYIENGRKQLANKTEEHSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 248

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 249 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 302


>gi|229104393|ref|ZP_04235062.1| Tyrosine recombinase xerC [Bacillus cereus Rock3-28]
 gi|228679091|gb|EEL33299.1| Tyrosine recombinase xerC [Bacillus cereus Rock3-28]
          Length = 299

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 147/294 (50%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVRFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          +              L+ +     L  L  +A +  + ISPH
Sbjct: 187 DALITYMENGRKQLANKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|228960047|ref|ZP_04121711.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228799563|gb|EEM46516.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar pakistani
           str. T13001]
          Length = 299

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLYDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMK--MTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            +L  Y +         T  D  +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DSLITYIENGRKQLVNKTDEDSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|218235700|ref|YP_002368632.1| site-specific tyrosine recombinase XerC [Bacillus cereus B4264]
 gi|229111302|ref|ZP_04240855.1| Tyrosine recombinase xerC [Bacillus cereus Rock1-15]
 gi|229129107|ref|ZP_04258080.1| Tyrosine recombinase xerC [Bacillus cereus BDRD-Cer4]
 gi|229146402|ref|ZP_04274773.1| Tyrosine recombinase xerC [Bacillus cereus BDRD-ST24]
 gi|229152030|ref|ZP_04280225.1| Tyrosine recombinase xerC [Bacillus cereus m1550]
 gi|296504326|ref|YP_003666026.1| site-specific tyrosine recombinase [Bacillus thuringiensis BMB171]
 gi|218163657|gb|ACK63649.1| tyrosine recombinase XerC [Bacillus cereus B4264]
 gi|228631379|gb|EEK88013.1| Tyrosine recombinase xerC [Bacillus cereus m1550]
 gi|228637035|gb|EEK93494.1| Tyrosine recombinase xerC [Bacillus cereus BDRD-ST24]
 gi|228654344|gb|EEL10209.1| Tyrosine recombinase xerC [Bacillus cereus BDRD-Cer4]
 gi|228672078|gb|EEL27369.1| Tyrosine recombinase xerC [Bacillus cereus Rock1-15]
 gi|296325378|gb|ADH08306.1| site-specific tyrosine recombinase [Bacillus thuringiensis BMB171]
          Length = 299

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMK--MTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            +L  Y +         T  D  +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DSLITYIENGRKQLVNKTDEDSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|314923700|gb|EFS87531.1| tyrosine recombinase XerD [Propionibacterium acnes HL001PA1]
          Length = 306

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 85/297 (28%), Positives = 142/297 (47%), Gaps = 13/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+ AY+RDL   Q +L ++ I SL+  +   +  +  HL    L  +S  
Sbjct: 16  LVVERGLSDNTVQAYRRDLLRYQEYLGSRGIGSLAEVTRVDVEEFRRHLDHIGLAPASVT 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +  +R  + F    G  + + +  +    ++  LPK L  D + +LL           
Sbjct: 76  RCVVAVRNLHRFAVGSGQVQADVTAGMSPGTRSRRLPKALTMDQVESLLAAP-------D 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTM-----IIQGKGNKERLVIL 175
               + +R   L+ELLY TG RVSE+  L    +            +I     +  + + 
Sbjct: 129 TSTVEGLRDAALLELLYGTGARVSEVCALDVDDIRRVLDDPDLGLRLIGKGDKERIVPLG 188

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
           S +A        +   +    GN       +T+   LSRQ     ++     AG+  +++
Sbjct: 189 SYAAKAVDAWLIRGRPAWAEIGNGEHALLLNTRGRRLSRQSAWAVIRRAGEAAGLDVEHL 248

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH +RH++A+HLL+GGAD+R +Q LLGH+ ++TTQIYT +  D L+++ +  HP A
Sbjct: 249 SPHSLRHSYATHLLDGGADVRVVQELLGHSSVTTTQIYTLVTADHLREVYRSSHPRA 305


>gi|282853638|ref|ZP_06262975.1| tyrosine recombinase XerD [Propionibacterium acnes J139]
 gi|282583091|gb|EFB88471.1| tyrosine recombinase XerD [Propionibacterium acnes J139]
 gi|314967052|gb|EFT11151.1| tyrosine recombinase XerD [Propionibacterium acnes HL082PA2]
 gi|314983153|gb|EFT27245.1| tyrosine recombinase XerD [Propionibacterium acnes HL110PA3]
 gi|315092375|gb|EFT64351.1| tyrosine recombinase XerD [Propionibacterium acnes HL110PA4]
 gi|315103783|gb|EFT75759.1| tyrosine recombinase XerD [Propionibacterium acnes HL050PA2]
 gi|327327186|gb|EGE68962.1| tyrosine recombinase XerD [Propionibacterium acnes HL103PA1]
          Length = 306

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 85/297 (28%), Positives = 142/297 (47%), Gaps = 13/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+ AY+RDL   Q +L ++ I SL+  +   +  +  HL    L  +S  
Sbjct: 16  LVVERGLSDNTVQAYRRDLLRYQEYLGSRGIGSLAEVTRVDVEEFRRHLDHIGLAPASVT 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +  +R  + F    G  + + +  +    ++  LPK L  D + +LL           
Sbjct: 76  RCVVAVRNLHRFAVGSGQVQADVTAGMSPGTRSRRLPKALTMDQVESLLAAP-------D 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTM-----IIQGKGNKERLVIL 175
               + +R   L+ELLY TG RVSE+  L    +            +I     +  + + 
Sbjct: 129 TSTVEGLRDAALLELLYGTGARVSEVCALDVDDIRRVLDDPDLGLRLIGKGDKERIVPLG 188

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
           S +A        +   +    GN       +T+   LSRQ     ++     AG+  +++
Sbjct: 189 SYAAKAVDAWLIRGRPAWAEIGNGEHALLLNTRGRRLSRQSAWAVIRRAGEAAGLDVEHL 248

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH +RH++A+HLL+GGAD+R +Q LLGH+ ++TTQIYT +  D L+++ +  HP A
Sbjct: 249 SPHSLRHSYATHLLDGGADVRVVQELLGHSSVTTTQIYTLVTADHLREVYRSSHPRA 305


>gi|24114148|ref|NP_708658.1| site-specific tyrosine recombinase XerD [Shigella flexneri 2a str.
           301]
 gi|30064206|ref|NP_838377.1| site-specific tyrosine recombinase XerD [Shigella flexneri 2a str.
           2457T]
 gi|91212272|ref|YP_542258.1| site-specific tyrosine recombinase XerD [Escherichia coli UTI89]
 gi|218559887|ref|YP_002392800.1| site-specific tyrosine recombinase XerD [Escherichia coli S88]
 gi|237706462|ref|ZP_04536943.1| tyrosine recombinase xerD [Escherichia sp. 3_2_53FAA]
 gi|34222799|sp|Q7ZAM0|XERD_SHIFL RecName: Full=Tyrosine recombinase xerD
 gi|24053288|gb|AAN44365.1| site-specific recombinase [Shigella flexneri 2a str. 301]
 gi|30042463|gb|AAP18187.1| site-specific recombinase [Shigella flexneri 2a str. 2457T]
 gi|91073846|gb|ABE08727.1| site-specific recombinase [Escherichia coli UTI89]
 gi|218366656|emb|CAR04410.1| site-specific tyrosine recombinase [Escherichia coli S88]
 gi|226899502|gb|EEH85761.1| tyrosine recombinase xerD [Escherichia sp. 3_2_53FAA]
 gi|294492679|gb|ADE91435.1| tyrosine recombinase XerD [Escherichia coli IHE3034]
 gi|307625533|gb|ADN69837.1| site-specific tyrosine recombinase XerD [Escherichia coli UM146]
 gi|313647934|gb|EFS12380.1| tyrosine recombinase XerD [Shigella flexneri 2a str. 2457T]
 gi|315289443|gb|EFU48838.1| tyrosine recombinase XerD [Escherichia coli MS 110-3]
 gi|323951667|gb|EGB47542.1| tyrosine recombinase XerD [Escherichia coli H252]
 gi|323957385|gb|EGB53107.1| tyrosine recombinase XerD [Escherichia coli H263]
 gi|332752931|gb|EGJ83315.1| tyrosine recombinase XerD [Shigella flexneri 4343-70]
 gi|332753730|gb|EGJ84109.1| tyrosine recombinase XerD [Shigella flexneri K-671]
 gi|332754528|gb|EGJ84894.1| tyrosine recombinase XerD [Shigella flexneri 2747-71]
 gi|332765825|gb|EGJ96038.1| tyrosine recombinase XerD [Shigella flexneri 2930-71]
 gi|333000098|gb|EGK19681.1| tyrosine recombinase XerD [Shigella flexneri K-218]
 gi|333015114|gb|EGK34457.1| tyrosine recombinase XerD [Shigella flexneri K-304]
          Length = 298

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|156932654|ref|YP_001436570.1| site-specific tyrosine recombinase XerD [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156530908|gb|ABU75734.1| hypothetical protein ESA_00437 [Cronobacter sakazakii ATCC BAA-894]
          Length = 319

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 171/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + N+LSAY+RDL  +  +L+++ +SL+   +  L + L    +     +S  R
Sbjct: 36  LWLERNLAENSLSAYRRDLSMVVEWLHHRGLSLATVQSGDLQTLLAERVEGGYKATSTAR 95

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ +  L  E +R D+PS  L  PK    LPK L +  +  LL+   +E      
Sbjct: 96  MLSAVRRLFQHLYREKIRDDDPSALLASPKLPQRLPKDLSEAQVERLLQAPTVE------ 149

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 150 -EPIELRDKAMLEVLYATGLRVSELVGLTMSDVSLRQGVVRVIGKGNKERLVPLGEEAVY 208

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y        + G  L +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 209 WLEQYLTHGRPWLLNGQSLDILFPSNRARQMTRQTFWHRIKHYAQLAGIDSEKLSPHVLR 268

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 269 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 319


>gi|228954107|ref|ZP_04116136.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|229071329|ref|ZP_04204552.1| Tyrosine recombinase xerC [Bacillus cereus F65185]
 gi|229081086|ref|ZP_04213596.1| Tyrosine recombinase xerC [Bacillus cereus Rock4-2]
 gi|229192000|ref|ZP_04318970.1| Tyrosine recombinase xerC [Bacillus cereus ATCC 10876]
 gi|228591551|gb|EEK49400.1| Tyrosine recombinase xerC [Bacillus cereus ATCC 10876]
 gi|228702130|gb|EEL54606.1| Tyrosine recombinase xerC [Bacillus cereus Rock4-2]
 gi|228711783|gb|EEL63735.1| Tyrosine recombinase xerC [Bacillus cereus F65185]
 gi|228805673|gb|EEM52263.1| Tyrosine recombinase xerC [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
          Length = 299

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMK--MTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            +L  Y +         T  D  +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DSLITYIENGRKQLVNKTDEDSHMVFLNAKGKPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|227112633|ref|ZP_03826289.1| site-specific tyrosine recombinase XerD [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 299

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL+ +  +L + +  L  A +  L ++L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLRTLAEWLAHHDNDLLQAQSLDLQAFLADRVEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+ +L  E  R D+PS  L  PK    LPK L +  +  LL    IE      
Sbjct: 76  LLSAMRRFFQYLYREKCRSDDPSAVLSSPKLPQRLPKDLSEAQVDTLLNAPSIE------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV+L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPLELRDKAMLEVLYATGLRVSELVSLTMSDVSLRQGVVRVLGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S +   ++RQ F   +K  A  A I  + +SPH++R
Sbjct: 189 WIEYYLEHGRPWLLNGQTLDVLFPSNRARQMTRQTFWHRIKHYAVLASIDSEKLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|314939481|ref|ZP_07846715.1| tyrosine recombinase XerD [Enterococcus faecium TX0133a04]
 gi|314941112|ref|ZP_07848010.1| tyrosine recombinase XerD [Enterococcus faecium TX0133C]
 gi|314948724|ref|ZP_07852096.1| tyrosine recombinase XerD [Enterococcus faecium TX0082]
 gi|314951697|ref|ZP_07854740.1| tyrosine recombinase XerD [Enterococcus faecium TX0133A]
 gi|314993956|ref|ZP_07859283.1| tyrosine recombinase XerD [Enterococcus faecium TX0133B]
 gi|314997520|ref|ZP_07862465.1| tyrosine recombinase XerD [Enterococcus faecium TX0133a01]
 gi|313588431|gb|EFR67276.1| tyrosine recombinase XerD [Enterococcus faecium TX0133a01]
 gi|313591558|gb|EFR70403.1| tyrosine recombinase XerD [Enterococcus faecium TX0133B]
 gi|313596161|gb|EFR75006.1| tyrosine recombinase XerD [Enterococcus faecium TX0133A]
 gi|313600113|gb|EFR78956.1| tyrosine recombinase XerD [Enterococcus faecium TX0133C]
 gi|313641283|gb|EFS05863.1| tyrosine recombinase XerD [Enterococcus faecium TX0133a04]
 gi|313644790|gb|EFS09370.1| tyrosine recombinase XerD [Enterococcus faecium TX0082]
          Length = 300

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 105/292 (35%), Positives = 160/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NT  +Y+RDL++  +FL  ++I S        +I +L  L + K  T++  
Sbjct: 17  LNIERGLSANTRQSYERDLEQYLHFLQEQKIASWQDVDRFLVIRFLEKLHEEKKATATVT 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R+F+ FL  E +   +P   ++ PKK   LP TL    +  L+E          
Sbjct: 77  RMISSLRRFHQFLRQERITDHDPMQHIDTPKKAQKLPSTLTLTEVEKLIEAP-------D 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATGMRVSEL+ L    L+L+   +   GKG+KER++ L   A+
Sbjct: 130 TTKTLGIRDRAILEVMYATGMRVSELIGLKLGDLHLSLGLVQTVGKGDKERIIPLGDYAI 189

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y      + +          +     LSRQ   ++LK L   AGI  K ++PH +
Sbjct: 190 QWLERYLDEARPLLVKDASEMHVFVNNHGKGLSRQGIWKNLKQLVREAGI-YKEVTPHTL 248

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLRT+Q LLGH DISTTQIYTH+   ++  + + + P A
Sbjct: 249 RHSFATHLLENGADLRTVQELLGHADISTTQIYTHITKKRMTDVYKQHFPRA 300


>gi|257877980|ref|ZP_05657633.1| phage integrase [Enterococcus faecium 1,230,933]
 gi|257881234|ref|ZP_05660887.1| phage integrase [Enterococcus faecium 1,231,502]
 gi|257884899|ref|ZP_05664552.1| phage integrase [Enterococcus faecium 1,231,501]
 gi|257889821|ref|ZP_05669474.1| phage integrase [Enterococcus faecium 1,231,410]
 gi|258616535|ref|ZP_05714305.1| integrase/recombinase XerD, putative [Enterococcus faecium DO]
 gi|260559031|ref|ZP_05831217.1| phage integrase [Enterococcus faecium C68]
 gi|261207565|ref|ZP_05922250.1| phage integrase [Enterococcus faecium TC 6]
 gi|289565077|ref|ZP_06445530.1| tyrosine recombinase XerD [Enterococcus faecium D344SRF]
 gi|293556722|ref|ZP_06675285.1| tyrosine recombinase XerD [Enterococcus faecium E1039]
 gi|293563380|ref|ZP_06677829.1| tyrosine recombinase XerD [Enterococcus faecium E1162]
 gi|293568038|ref|ZP_06679376.1| tyrosine recombinase XerD [Enterococcus faecium E1071]
 gi|294614864|ref|ZP_06694759.1| tyrosine recombinase XerD [Enterococcus faecium E1636]
 gi|294618694|ref|ZP_06698228.1| tyrosine recombinase XerD [Enterococcus faecium E1679]
 gi|294622985|ref|ZP_06701875.1| tyrosine recombinase XerD [Enterococcus faecium U0317]
 gi|257812208|gb|EEV40966.1| phage integrase [Enterococcus faecium 1,230,933]
 gi|257816892|gb|EEV44220.1| phage integrase [Enterococcus faecium 1,231,502]
 gi|257820737|gb|EEV47885.1| phage integrase [Enterococcus faecium 1,231,501]
 gi|257826181|gb|EEV52807.1| phage integrase [Enterococcus faecium 1,231,410]
 gi|260074788|gb|EEW63104.1| phage integrase [Enterococcus faecium C68]
 gi|260077948|gb|EEW65654.1| phage integrase [Enterococcus faecium TC 6]
 gi|289163084|gb|EFD10931.1| tyrosine recombinase XerD [Enterococcus faecium D344SRF]
 gi|291589259|gb|EFF21069.1| tyrosine recombinase XerD [Enterococcus faecium E1071]
 gi|291592326|gb|EFF23940.1| tyrosine recombinase XerD [Enterococcus faecium E1636]
 gi|291595077|gb|EFF26420.1| tyrosine recombinase XerD [Enterococcus faecium E1679]
 gi|291597613|gb|EFF28774.1| tyrosine recombinase XerD [Enterococcus faecium U0317]
 gi|291601054|gb|EFF31343.1| tyrosine recombinase XerD [Enterococcus faecium E1039]
 gi|291604641|gb|EFF34126.1| tyrosine recombinase XerD [Enterococcus faecium E1162]
          Length = 295

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 105/292 (35%), Positives = 160/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NT  +Y+RDL++  +FL  ++I S        +I +L  L + K  T++  
Sbjct: 12  LNIERGLSANTRQSYERDLEQYLHFLQEQKIASWQDVDRFLVIRFLEKLHEEKKATATVT 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R+F+ FL  E +   +P   ++ PKK   LP TL    +  L+E          
Sbjct: 72  RMISSLRRFHQFLRQERITDHDPMQHIDTPKKAQKLPSTLTLTEVEKLIEAP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATGMRVSEL+ L    L+L+   +   GKG+KER++ L   A+
Sbjct: 125 TTKTLGIRDRAILEVMYATGMRVSELIGLKLGDLHLSLGLVQTVGKGDKERIIPLGDYAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y      + +          +     LSRQ   ++LK L   AGI  K ++PH +
Sbjct: 185 QWLERYLDEARPLLVKDASEMHVFVNNHGKGLSRQGIWKNLKQLVREAGI-YKEVTPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLRT+Q LLGH DISTTQIYTH+   ++  + + + P A
Sbjct: 244 RHSFATHLLENGADLRTVQELLGHADISTTQIYTHITKKRMTDVYKQHFPRA 295


>gi|324017291|gb|EGB86510.1| tyrosine recombinase XerD [Escherichia coli MS 117-3]
          Length = 298

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 111/291 (38%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +QILLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQILLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|212710035|ref|ZP_03318163.1| hypothetical protein PROVALCAL_01088 [Providencia alcalifaciens DSM
           30120]
 gi|212687242|gb|EEB46770.1| hypothetical protein PROVALCAL_01088 [Providencia alcalifaciens DSM
           30120]
          Length = 300

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 98/288 (34%), Positives = 160/288 (55%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           E+  + NTL++Y+ DL+ +  +L+ +++ L    +  L S+L          +S  R +S
Sbjct: 20  EQDLAENTLASYRNDLQSLDRWLDKQQLHLETVQSIDLQSFLAERIDGGYKAASSARLLS 79

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +   E +R D+PS  +  PK    LPK L +  + +LL          A    
Sbjct: 80  SIRRLFQYFYREKIRSDDPSAVIAAPKIPQRLPKDLSEKQVEDLLNAP-------ATEDS 132

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++E+LYA G+RVSEL  L+   ++L +  + + GKG+KERL+ L   A++ L+
Sbjct: 133 LELRDKAMLEVLYACGLRVSELTGLTFSDISLRQGVVRVVGKGDKERLIPLGEEAIYWLE 192

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            Y        + G    +   S +   ++RQ F   +K  A  A I  + +SPH++RHAF
Sbjct: 193 KYIAEGRPDLLNGKTSDVLFPSKRGTKMTRQTFWHRIKYYAVLANIDGEALSPHVLRHAF 252

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L + +HP  
Sbjct: 253 ATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRALHEQHHPRG 300


>gi|16130796|ref|NP_417370.1| site-specific tyrosine recombinase [Escherichia coli str. K-12
           substr. MG1655]
 gi|26249309|ref|NP_755349.1| site-specific tyrosine recombinase XerD [Escherichia coli CFT073]
 gi|74313452|ref|YP_311871.1| site-specific tyrosine recombinase XerD [Shigella sonnei Ss046]
 gi|82545483|ref|YP_409430.1| site-specific tyrosine recombinase XerD [Shigella boydii Sb227]
 gi|82778340|ref|YP_404689.1| site-specific tyrosine recombinase XerD [Shigella dysenteriae
           Sd197]
 gi|89109673|ref|AP_003453.1| site-specific tyrosine recombinase [Escherichia coli str. K-12
           substr. W3110]
 gi|110643042|ref|YP_670772.1| site-specific tyrosine recombinase XerD [Escherichia coli 536]
 gi|110806797|ref|YP_690317.1| site-specific tyrosine recombinase XerD [Shigella flexneri 5 str.
           8401]
 gi|157158312|ref|YP_001464231.1| site-specific tyrosine recombinase XerD [Escherichia coli E24377A]
 gi|168747627|ref|ZP_02772649.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4113]
 gi|168753832|ref|ZP_02778839.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4401]
 gi|168766887|ref|ZP_02791894.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4486]
 gi|168775771|ref|ZP_02800778.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4196]
 gi|168778907|ref|ZP_02803914.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4076]
 gi|168785740|ref|ZP_02810747.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC869]
 gi|168800027|ref|ZP_02825034.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC508]
 gi|170082455|ref|YP_001731775.1| site-specific tyrosine recombinase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170681991|ref|YP_001745047.1| site-specific tyrosine recombinase XerD [Escherichia coli SMS-3-5]
 gi|187732006|ref|YP_001881663.1| site-specific tyrosine recombinase XerD [Shigella boydii CDC
           3083-94]
 gi|188496120|ref|ZP_03003390.1| tyrosine recombinase XerD [Escherichia coli 53638]
 gi|191166010|ref|ZP_03027846.1| tyrosine recombinase XerD [Escherichia coli B7A]
 gi|191173237|ref|ZP_03034768.1| tyrosine recombinase XerD [Escherichia coli F11]
 gi|193063471|ref|ZP_03044560.1| tyrosine recombinase XerD [Escherichia coli E22]
 gi|193070556|ref|ZP_03051495.1| tyrosine recombinase XerD [Escherichia coli E110019]
 gi|194426297|ref|ZP_03058852.1| tyrosine recombinase XerD [Escherichia coli B171]
 gi|194431675|ref|ZP_03063966.1| tyrosine recombinase XerD [Shigella dysenteriae 1012]
 gi|194436800|ref|ZP_03068900.1| tyrosine recombinase XerD [Escherichia coli 101-1]
 gi|195936512|ref|ZP_03081894.1| site-specific tyrosine recombinase XerD [Escherichia coli O157:H7
           str. EC4024]
 gi|208806438|ref|ZP_03248775.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4206]
 gi|208814608|ref|ZP_03255937.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4045]
 gi|208820065|ref|ZP_03260385.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4042]
 gi|209398903|ref|YP_002272368.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4115]
 gi|209920348|ref|YP_002294432.1| site-specific tyrosine recombinase XerD [Escherichia coli SE11]
 gi|215488194|ref|YP_002330625.1| site-specific tyrosine recombinase XerD [Escherichia coli O127:H6
           str. E2348/69]
 gi|218555442|ref|YP_002388355.1| site-specific tyrosine recombinase XerD [Escherichia coli IAI1]
 gi|218691019|ref|YP_002399231.1| site-specific tyrosine recombinase XerD [Escherichia coli ED1a]
 gi|218696489|ref|YP_002404156.1| site-specific tyrosine recombinase XerD [Escherichia coli 55989]
 gi|227888443|ref|ZP_04006248.1| site-specific tyrosine recombinase [Escherichia coli 83972]
 gi|238902019|ref|YP_002927815.1| site-specific tyrosine recombinase [Escherichia coli BW2952]
 gi|253772265|ref|YP_003035096.1| site-specific tyrosine recombinase XerD [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162806|ref|YP_003045914.1| site-specific tyrosine recombinase XerD [Escherichia coli B str.
           REL606]
 gi|254794844|ref|YP_003079681.1| site-specific tyrosine recombinase XerD [Escherichia coli O157:H7
           str. TW14359]
 gi|256019308|ref|ZP_05433173.1| site-specific tyrosine recombinase XerD [Shigella sp. D9]
 gi|256024596|ref|ZP_05438461.1| site-specific tyrosine recombinase XerD [Escherichia sp. 4_1_40B]
 gi|260845562|ref|YP_003223340.1| site-specific tyrosine recombinase XerD [Escherichia coli O103:H2
           str. 12009]
 gi|260857017|ref|YP_003230908.1| site-specific tyrosine recombinase XerD [Escherichia coli O26:H11
           str. 11368]
 gi|260869571|ref|YP_003235973.1| site-specific tyrosine recombinase XerD [Escherichia coli O111:H-
           str. 11128]
 gi|261226207|ref|ZP_05940488.1| site-specific tyrosine recombinase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261256538|ref|ZP_05949071.1| site-specific tyrosine recombinase XerD [Escherichia coli O157:H7
           str. FRIK966]
 gi|291284213|ref|YP_003501031.1| Tyrosine recombinase xerD [Escherichia coli O55:H7 str. CB9615]
 gi|293412253|ref|ZP_06654976.1| tyrosine recombinase XerD [Escherichia coli B354]
 gi|293416147|ref|ZP_06658787.1| tyrosine recombinase XerD [Escherichia coli B185]
 gi|293449216|ref|ZP_06663637.1| tyrosine recombinase XerD [Escherichia coli B088]
 gi|297521422|ref|ZP_06939808.1| site-specific tyrosine recombinase XerD [Escherichia coli OP50]
 gi|300815654|ref|ZP_07095878.1| tyrosine recombinase XerD [Escherichia coli MS 107-1]
 gi|300820698|ref|ZP_07100849.1| tyrosine recombinase XerD [Escherichia coli MS 119-7]
 gi|300906556|ref|ZP_07124247.1| tyrosine recombinase XerD [Escherichia coli MS 84-1]
 gi|300921226|ref|ZP_07137599.1| tyrosine recombinase XerD [Escherichia coli MS 115-1]
 gi|300925125|ref|ZP_07141039.1| tyrosine recombinase XerD [Escherichia coli MS 182-1]
 gi|300928170|ref|ZP_07143712.1| tyrosine recombinase XerD [Escherichia coli MS 187-1]
 gi|300936040|ref|ZP_07150988.1| tyrosine recombinase XerD [Escherichia coli MS 21-1]
 gi|300947617|ref|ZP_07161788.1| tyrosine recombinase XerD [Escherichia coli MS 116-1]
 gi|300954266|ref|ZP_07166729.1| tyrosine recombinase XerD [Escherichia coli MS 175-1]
 gi|300980312|ref|ZP_07174966.1| tyrosine recombinase XerD [Escherichia coli MS 45-1]
 gi|300995674|ref|ZP_07181202.1| tyrosine recombinase XerD [Escherichia coli MS 200-1]
 gi|301027808|ref|ZP_07191113.1| tyrosine recombinase XerD [Escherichia coli MS 196-1]
 gi|301049322|ref|ZP_07196292.1| tyrosine recombinase XerD [Escherichia coli MS 185-1]
 gi|301303052|ref|ZP_07209179.1| tyrosine recombinase XerD [Escherichia coli MS 124-1]
 gi|301327295|ref|ZP_07220551.1| tyrosine recombinase XerD [Escherichia coli MS 78-1]
 gi|301643756|ref|ZP_07243794.1| tyrosine recombinase XerD [Escherichia coli MS 146-1]
 gi|307139581|ref|ZP_07498937.1| site-specific tyrosine recombinase XerD [Escherichia coli H736]
 gi|307310487|ref|ZP_07590135.1| tyrosine recombinase XerD [Escherichia coli W]
 gi|309785299|ref|ZP_07679930.1| tyrosine recombinase XerD [Shigella dysenteriae 1617]
 gi|312964846|ref|ZP_07779086.1| tyrosine recombinase XerD [Escherichia coli 2362-75]
 gi|331643584|ref|ZP_08344715.1| tyrosine recombinase XerD [Escherichia coli H736]
 gi|331648640|ref|ZP_08349728.1| tyrosine recombinase XerD [Escherichia coli M605]
 gi|331659024|ref|ZP_08359966.1| tyrosine recombinase XerD [Escherichia coli TA206]
 gi|331664467|ref|ZP_08365373.1| tyrosine recombinase XerD [Escherichia coli TA143]
 gi|331669629|ref|ZP_08370475.1| tyrosine recombinase XerD [Escherichia coli TA271]
 gi|331674379|ref|ZP_08375139.1| tyrosine recombinase XerD [Escherichia coli TA280]
 gi|331678881|ref|ZP_08379555.1| tyrosine recombinase XerD [Escherichia coli H591]
 gi|331684520|ref|ZP_08385112.1| tyrosine recombinase XerD [Escherichia coli H299]
 gi|332280422|ref|ZP_08392835.1| tyrosine recombinase xerD [Shigella sp. D9]
 gi|67475548|sp|P0A8P8|XERD_ECOLI RecName: Full=Tyrosine recombinase xerD
 gi|67475549|sp|P0A8P9|XERD_ECOL6 RecName: Full=Tyrosine recombinase xerD
 gi|26109717|gb|AAN81922.1|AE016766_10 Integrase/recombinase xerD [Escherichia coli CFT073]
 gi|147548|gb|AAA62787.1| xprB [Escherichia coli]
 gi|887844|gb|AAA83075.1| site-specific integrase/recombinase, with xerC [Escherichia coli]
 gi|1789261|gb|AAC75932.1| site-specific tyrosine recombinase [Escherichia coli str. K-12
           substr. MG1655]
 gi|73856929|gb|AAZ89636.1| site-specific recombinase [Shigella sonnei Ss046]
 gi|81242488|gb|ABB63198.1| site-specific recombinase [Shigella dysenteriae Sd197]
 gi|81246894|gb|ABB67602.1| site-specific recombinase [Shigella boydii Sb227]
 gi|85675706|dbj|BAE76959.1| site-specific tyrosine recombinase [Escherichia coli str. K12
           substr. W3110]
 gi|110344634|gb|ABG70871.1| integrase/recombinase XerD [Escherichia coli 536]
 gi|110616345|gb|ABF05012.1| site-specific recombinase [Shigella flexneri 5 str. 8401]
 gi|157080342|gb|ABV20050.1| tyrosine recombinase XerD [Escherichia coli E24377A]
 gi|169890290|gb|ACB03997.1| site-specific tyrosine recombinase [Escherichia coli str. K-12
           substr. DH10B]
 gi|170519709|gb|ACB17887.1| tyrosine recombinase XerD [Escherichia coli SMS-3-5]
 gi|187428998|gb|ACD08272.1| tyrosine recombinase XerD [Shigella boydii CDC 3083-94]
 gi|187768812|gb|EDU32656.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4196]
 gi|188017752|gb|EDU55874.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4113]
 gi|188491319|gb|EDU66422.1| tyrosine recombinase XerD [Escherichia coli 53638]
 gi|189003626|gb|EDU72612.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4076]
 gi|189358670|gb|EDU77089.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4401]
 gi|189363773|gb|EDU82192.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4486]
 gi|189373936|gb|EDU92352.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC869]
 gi|189377626|gb|EDU96042.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC508]
 gi|190903958|gb|EDV63671.1| tyrosine recombinase XerD [Escherichia coli B7A]
 gi|190906488|gb|EDV66096.1| tyrosine recombinase XerD [Escherichia coli F11]
 gi|192930748|gb|EDV83353.1| tyrosine recombinase XerD [Escherichia coli E22]
 gi|192956139|gb|EDV86603.1| tyrosine recombinase XerD [Escherichia coli E110019]
 gi|194415605|gb|EDX31872.1| tyrosine recombinase XerD [Escherichia coli B171]
 gi|194420031|gb|EDX36109.1| tyrosine recombinase XerD [Shigella dysenteriae 1012]
 gi|194424282|gb|EDX40269.1| tyrosine recombinase XerD [Escherichia coli 101-1]
 gi|208726239|gb|EDZ75840.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4206]
 gi|208735885|gb|EDZ84572.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4045]
 gi|208740188|gb|EDZ87870.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4042]
 gi|209160303|gb|ACI37736.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4115]
 gi|209760578|gb|ACI78601.1| site-specific recombinase [Escherichia coli]
 gi|209760582|gb|ACI78603.1| site-specific recombinase [Escherichia coli]
 gi|209760584|gb|ACI78604.1| site-specific recombinase [Escherichia coli]
 gi|209760586|gb|ACI78605.1| site-specific recombinase [Escherichia coli]
 gi|209913607|dbj|BAG78681.1| site-specific recombinase [Escherichia coli SE11]
 gi|215266266|emb|CAS10695.1| site-specific tyrosine recombinase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218353221|emb|CAU99139.1| site-specific tyrosine recombinase [Escherichia coli 55989]
 gi|218362210|emb|CAQ99828.1| site-specific tyrosine recombinase [Escherichia coli IAI1]
 gi|218428583|emb|CAR09510.2| site-specific tyrosine recombinase [Escherichia coli ED1a]
 gi|222034589|emb|CAP77331.1| Tyrosine recombinase xerD [Escherichia coli LF82]
 gi|227834712|gb|EEJ45178.1| site-specific tyrosine recombinase [Escherichia coli 83972]
 gi|238863557|gb|ACR65555.1| site-specific tyrosine recombinase [Escherichia coli BW2952]
 gi|242378425|emb|CAQ33206.1| site-specific recombinase, subunit of Xer site-specific
           recombination system [Escherichia coli BL21(DE3)]
 gi|253323309|gb|ACT27911.1| tyrosine recombinase XerD [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253974707|gb|ACT40378.1| site-specific tyrosine recombinase XerD [Escherichia coli B str.
           REL606]
 gi|253978873|gb|ACT44543.1| site-specific tyrosine recombinase XerD [Escherichia coli
           BL21(DE3)]
 gi|254594244|gb|ACT73605.1| site-specific tyrosine recombinase [Escherichia coli O157:H7 str.
           TW14359]
 gi|257755666|dbj|BAI27168.1| site-specific tyrosine recombinase XerD [Escherichia coli O26:H11
           str. 11368]
 gi|257760709|dbj|BAI32206.1| site-specific tyrosine recombinase XerD [Escherichia coli O103:H2
           str. 12009]
 gi|257765927|dbj|BAI37422.1| site-specific tyrosine recombinase XerD [Escherichia coli O111:H-
           str. 11128]
 gi|260448060|gb|ACX38482.1| tyrosine recombinase XerD [Escherichia coli DH1]
 gi|281179899|dbj|BAI56229.1| site-specific recombinase [Escherichia coli SE15]
 gi|284922842|emb|CBG35931.1| tyrosine recombinase [Escherichia coli 042]
 gi|290764086|gb|ADD58047.1| Tyrosine recombinase xerD [Escherichia coli O55:H7 str. CB9615]
 gi|291322306|gb|EFE61735.1| tyrosine recombinase XerD [Escherichia coli B088]
 gi|291432336|gb|EFF05318.1| tyrosine recombinase XerD [Escherichia coli B185]
 gi|291469024|gb|EFF11515.1| tyrosine recombinase XerD [Escherichia coli B354]
 gi|299879070|gb|EFI87281.1| tyrosine recombinase XerD [Escherichia coli MS 196-1]
 gi|300298921|gb|EFJ55306.1| tyrosine recombinase XerD [Escherichia coli MS 185-1]
 gi|300304782|gb|EFJ59302.1| tyrosine recombinase XerD [Escherichia coli MS 200-1]
 gi|300318727|gb|EFJ68511.1| tyrosine recombinase XerD [Escherichia coli MS 175-1]
 gi|300401595|gb|EFJ85133.1| tyrosine recombinase XerD [Escherichia coli MS 84-1]
 gi|300409320|gb|EFJ92858.1| tyrosine recombinase XerD [Escherichia coli MS 45-1]
 gi|300411832|gb|EFJ95142.1| tyrosine recombinase XerD [Escherichia coli MS 115-1]
 gi|300418727|gb|EFK02038.1| tyrosine recombinase XerD [Escherichia coli MS 182-1]
 gi|300452792|gb|EFK16412.1| tyrosine recombinase XerD [Escherichia coli MS 116-1]
 gi|300458832|gb|EFK22325.1| tyrosine recombinase XerD [Escherichia coli MS 21-1]
 gi|300463810|gb|EFK27303.1| tyrosine recombinase XerD [Escherichia coli MS 187-1]
 gi|300526962|gb|EFK48031.1| tyrosine recombinase XerD [Escherichia coli MS 119-7]
 gi|300531583|gb|EFK52645.1| tyrosine recombinase XerD [Escherichia coli MS 107-1]
 gi|300841716|gb|EFK69476.1| tyrosine recombinase XerD [Escherichia coli MS 124-1]
 gi|300846158|gb|EFK73918.1| tyrosine recombinase XerD [Escherichia coli MS 78-1]
 gi|301077855|gb|EFK92661.1| tyrosine recombinase XerD [Escherichia coli MS 146-1]
 gi|306909382|gb|EFN39877.1| tyrosine recombinase XerD [Escherichia coli W]
 gi|307554870|gb|ADN47645.1| site-specific tyrosine recombinase XerD [Escherichia coli ABU
           83972]
 gi|308926419|gb|EFP71895.1| tyrosine recombinase XerD [Shigella dysenteriae 1617]
 gi|309703254|emb|CBJ02589.1| tyrosine recombinase [Escherichia coli ETEC H10407]
 gi|312290402|gb|EFR18282.1| tyrosine recombinase XerD [Escherichia coli 2362-75]
 gi|312947427|gb|ADR28254.1| site-specific tyrosine recombinase XerD [Escherichia coli O83:H1
           str. NRG 857C]
 gi|315062198|gb|ADT76525.1| site-specific tyrosine recombinase [Escherichia coli W]
 gi|315137493|dbj|BAJ44652.1| tyrosine recombinase xerD [Escherichia coli DH1]
 gi|315256777|gb|EFU36745.1| tyrosine recombinase XerD [Escherichia coli MS 85-1]
 gi|315293873|gb|EFU53225.1| tyrosine recombinase XerD [Escherichia coli MS 153-1]
 gi|315295682|gb|EFU55002.1| tyrosine recombinase XerD [Escherichia coli MS 16-3]
 gi|315614950|gb|EFU95588.1| tyrosine recombinase XerD [Escherichia coli 3431]
 gi|320175918|gb|EFW50996.1| Tyrosine recombinase XerD [Shigella dysenteriae CDC 74-1112]
 gi|320182203|gb|EFW57106.1| Tyrosine recombinase XerD [Shigella boydii ATCC 9905]
 gi|320184562|gb|EFW59363.1| Tyrosine recombinase XerD [Shigella flexneri CDC 796-83]
 gi|320189238|gb|EFW63897.1| Tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC1212]
 gi|320195013|gb|EFW69642.1| Tyrosine recombinase XerD [Escherichia coli WV_060327]
 gi|320202554|gb|EFW77124.1| Tyrosine recombinase XerD [Escherichia coli EC4100B]
 gi|320640537|gb|EFX10076.1| site-specific tyrosine recombinase XerD [Escherichia coli O157:H7
           str. G5101]
 gi|320645784|gb|EFX14769.1| site-specific tyrosine recombinase XerD [Escherichia coli O157:H-
           str. 493-89]
 gi|320651084|gb|EFX19524.1| site-specific tyrosine recombinase XerD [Escherichia coli O157:H-
           str. H 2687]
 gi|320656580|gb|EFX24476.1| site-specific tyrosine recombinase XerD [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320662100|gb|EFX29501.1| site-specific tyrosine recombinase XerD [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320667175|gb|EFX34138.1| site-specific tyrosine recombinase XerD [Escherichia coli O157:H7
           str. LSU-61]
 gi|323162515|gb|EFZ48365.1| tyrosine recombinase XerD [Escherichia coli E128010]
 gi|323167900|gb|EFZ53590.1| tyrosine recombinase XerD [Shigella sonnei 53G]
 gi|323180338|gb|EFZ65890.1| tyrosine recombinase XerD [Escherichia coli 1180]
 gi|323183448|gb|EFZ68845.1| tyrosine recombinase XerD [Escherichia coli 1357]
 gi|323188707|gb|EFZ73992.1| tyrosine recombinase XerD [Escherichia coli RN587/1]
 gi|323377218|gb|ADX49486.1| tyrosine recombinase XerD [Escherichia coli KO11]
 gi|323935874|gb|EGB32173.1| tyrosine recombinase XerD [Escherichia coli E1520]
 gi|323941585|gb|EGB37765.1| tyrosine recombinase XerD [Escherichia coli E482]
 gi|323946620|gb|EGB42643.1| tyrosine recombinase XerD [Escherichia coli H120]
 gi|323960809|gb|EGB56430.1| tyrosine recombinase XerD [Escherichia coli H489]
 gi|323966695|gb|EGB62127.1| tyrosine recombinase XerD [Escherichia coli M863]
 gi|323971668|gb|EGB66897.1| tyrosine recombinase XerD [Escherichia coli TA007]
 gi|323978814|gb|EGB73895.1| tyrosine recombinase XerD [Escherichia coli TW10509]
 gi|324005546|gb|EGB74765.1| tyrosine recombinase XerD [Escherichia coli MS 57-2]
 gi|324011756|gb|EGB80975.1| tyrosine recombinase XerD [Escherichia coli MS 60-1]
 gi|324119935|gb|EGC13814.1| tyrosine recombinase XerD [Escherichia coli E1167]
 gi|325498455|gb|EGC96314.1| site-specific tyrosine recombinase [Escherichia fergusonii ECD227]
 gi|326343096|gb|EGD66864.1| Tyrosine recombinase XerD [Escherichia coli O157:H7 str. 1125]
 gi|327251657|gb|EGE63343.1| tyrosine recombinase XerD [Escherichia coli STEC_7v]
 gi|330908926|gb|EGH37440.1| tyrosine recombinase XerD [Escherichia coli AA86]
 gi|331037055|gb|EGI09279.1| tyrosine recombinase XerD [Escherichia coli H736]
 gi|331042387|gb|EGI14529.1| tyrosine recombinase XerD [Escherichia coli M605]
 gi|331053606|gb|EGI25635.1| tyrosine recombinase XerD [Escherichia coli TA206]
 gi|331058398|gb|EGI30379.1| tyrosine recombinase XerD [Escherichia coli TA143]
 gi|331063297|gb|EGI35210.1| tyrosine recombinase XerD [Escherichia coli TA271]
 gi|331068473|gb|EGI39868.1| tyrosine recombinase XerD [Escherichia coli TA280]
 gi|331073711|gb|EGI45032.1| tyrosine recombinase XerD [Escherichia coli H591]
 gi|331078135|gb|EGI49341.1| tyrosine recombinase XerD [Escherichia coli H299]
 gi|332087665|gb|EGI92792.1| tyrosine recombinase XerD [Shigella dysenteriae 155-74]
 gi|332090893|gb|EGI95984.1| tyrosine recombinase XerD [Shigella boydii 3594-74]
 gi|332102774|gb|EGJ06120.1| tyrosine recombinase xerD [Shigella sp. D9]
 gi|332344790|gb|AEE58124.1| tyrosine recombinase XerD [Escherichia coli UMNK88]
 gi|332999673|gb|EGK19258.1| tyrosine recombinase XerD [Shigella flexneri VA-6]
          Length = 298

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|308187997|ref|YP_003932128.1| Tyrosine recombinase xerD [Pantoea vagans C9-1]
 gi|308058507|gb|ADO10679.1| Tyrosine recombinase xerD [Pantoea vagans C9-1]
          Length = 297

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 106/291 (36%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLS+Y++DL+ +  +L + +++L + +   L  +L    +     +S  R
Sbjct: 14  LWIERNLAQNTLSSYRQDLQTLTGWLTHHQLTLLSVTPLDLQQFLAERLEGGYKATSSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR D+PS  L  PK    LPK L +  +  LL+           
Sbjct: 74  LLSAMRRLFQYLYREKLRPDDPSALLSAPKLPQRLPKDLSEAQVERLLQAP-------DT 126

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSEL  L+   ++L +  + + GKG+KERLV L   A++
Sbjct: 127 NIPLELRDKAMLEVLYATGLRVSELTGLTLSDISLRQGVVRVIGKGDKERLVPLGEEAVY 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  L +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 187 WLEQYMEHGRPWLLNGQTLDVMFPSNRAQQMTRQTFWHRIKHYATLAGIDSEKLSPHVMR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 247 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 297


>gi|239787464|emb|CAX83935.1| Tyrosine recombinase XerC subunit [uncultured bacterium]
          Length = 321

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 97/303 (32%), Positives = 159/303 (52%), Gaps = 10/303 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQN-FLNNKEISLSA-----ASTNHLISYLNHLSQRKLV 55
           ++ ER  S NT+SAY RDL+     +       L+           L +++    +    
Sbjct: 15  LAVERRLSPNTVSAYLRDLELFGRYWCQRHGGGLTEEQLRQMRPEDLRAFMGMGQREGAA 74

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
            S+ +R+++ +R ++ +L  EGL ++NP+  +  PK+   LP+   ++  A L+E     
Sbjct: 75  KSTLQRRMASVRAWFRYLEREGLAENNPAALVASPKQAQRLPRAPTEEDTARLIESLPPP 134

Query: 116 AENPAPGQWKR---VRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERL 172
                   W R   +R   ++ELLY +G+R+ EL  L    LNL +  + + GKG KERL
Sbjct: 135 GPQSPLTGWARVRLLRDGAILELLYGSGLRIGELCGLDRLDLNLRQAEVRVLGKGGKERL 194

Query: 173 VILSPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQK 232
           V L   A+ AL+ Y +   +     + L    +  + G L+ +   R +  L  R G+ +
Sbjct: 195 VPLGSMAIQALERYLEARKAEAPPPDHLGPVFTGRQGGRLNPREVQRLVVKLRRRLGLPE 254

Query: 233 KNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           K ++PH +RHAFA+HLL+ GADLR+IQ +LGH  ++TTQ YTHL    L K+    HP A
Sbjct: 255 K-VTPHALRHAFATHLLQAGADLRSIQEMLGHASLTTTQRYTHLDLANLTKIYDAAHPRA 313

Query: 293 KKE 295
           +++
Sbjct: 314 RRQ 316


>gi|229822894|ref|ZP_04448964.1| hypothetical protein GCWU000282_00184 [Catonella morbi ATCC 51271]
 gi|229787707|gb|EEP23821.1| hypothetical protein GCWU000282_00184 [Catonella morbi ATCC 51271]
          Length = 302

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 107/290 (36%), Positives = 154/290 (53%), Gaps = 12/290 (4%)

Query: 7   ASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQRRKISV 65
             S NT+ +Y RDL + Q +L  + I  + A     + ++L  LSQ     SS  R +S 
Sbjct: 21  NRSANTIQSYGRDLAKFQAYLTEQGIDKVEAIDEVTVRAFLAKLSQDAYAASSTSRMLSS 80

Query: 66  IRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQWK 125
           ++QF+ FL  EG+ + NP   +  PK+   LPK L    I  LL+               
Sbjct: 81  LKQFFLFLRKEGILETNPMSLVHRPKQGRHLPKVLTASEIEALLQAP-------DTSSPH 133

Query: 126 RVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQM 185
            +R   + EL+YATG+RV+ELV L    L+L    +   GKG+KERLV L   A+  L+ 
Sbjct: 134 GLRDRAIFELMYATGLRVTELVQLKLEDLHLELGFIQTLGKGDKERLVPLIDEAIEWLEA 193

Query: 186 YKKTCSSMKMT---GNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRH 242
           Y +      +             + +    +RQ   ++L    A AGI K+ +SPH++RH
Sbjct: 194 YLEQVRPSFLRLAGSASPQEVFLTERGKAFTRQGIWKNLNKYVALAGI-KQTVSPHMLRH 252

Query: 243 AFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +FA+HLLE GADLR +Q LLGH DISTTQIYTH+   +LQ++ + Y P A
Sbjct: 253 SFATHLLENGADLRMVQELLGHADISTTQIYTHISTQRLQEVYRKYFPRA 302


>gi|225181363|ref|ZP_03734807.1| integrase family protein [Dethiobacter alkaliphilus AHT 1]
 gi|225167944|gb|EEG76751.1| integrase family protein [Dethiobacter alkaliphilus AHT 1]
          Length = 299

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 94/296 (31%), Positives = 139/296 (46%), Gaps = 11/296 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISL-SAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+ +S +T+  Y  DL +   FL  +  S         +  +L  +        + 
Sbjct: 11  FLQVEKNASPHTIRNYAEDLGQFFQFLEKEGASFPQDLDYLAIRHFLALMQAHGYERRTI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            RK++ IR F   L  EG   D    T+  P+    LPK L+ D +  LL          
Sbjct: 71  ARKLAAIRSFLRHLNREGYLADTSWTTISTPRIGKKLPKFLYVDEVFRLLAAP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++E LY++G+RVSELV L   +L+L     I+ GKG  ERLV L   A
Sbjct: 124 DSQTPAGLRDVAILEFLYSSGVRVSELVALELQSLDLNRGQAIVMGKGGCERLVHLGRFA 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ---KKNIS 236
             +L  Y +      +  N       +        ++  R ++ +  +   Q    K IS
Sbjct: 184 RRSLLAYLEQGRPEILRKNADGDREGALWLNKYGTRLSDRGVRRIVEKYVRQVSLAKGIS 243

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           PH IRH+FA+HLL  GADLR +Q LLGH +ISTTQIYTH+  D+L+++    HP A
Sbjct: 244 PHSIRHSFATHLLNAGADLRVVQELLGHVNISTTQIYTHITRDQLKEVYNGAHPRA 299


>gi|116328373|ref|YP_798093.1| site-specific recombinase XerD [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116331099|ref|YP_800817.1| site-specific recombinase XerD [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116121117|gb|ABJ79160.1| Site-specific recombinase XerD [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116124788|gb|ABJ76059.1| Site-specific recombinase XerD [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 298

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 94/291 (32%), Positives = 153/291 (52%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +S E+  S N++ +Y  DL + +NFL  + I       N ++ +LN    RK+ + +  R
Sbjct: 16  LSVEKGLSDNSIYSYGYDLNKFKNFLEKEHIDFLKVQANDIMRFLNEERDRKISSKTIAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           ++  IRQFY FL  E     NP++ +E P+    +P  L +D I  L    + +      
Sbjct: 76  EVVAIRQFYKFLKDEKKLDTNPTEKIETPEVMRNIPDYLTQDEIEELFASIRED------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   + ELLY++G+R+SE   L    ++L    + ++GKG ++RLV     +L 
Sbjct: 130 -NLYELRDKCIFELLYSSGLRISEACNLRLSDMDLEGMILTVEGKGGRQRLVPFGEKSLD 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            +  Y K      +   +      S K  +++R+   R L     R  I KK ++PH +R
Sbjct: 189 IMNRYLKQSRPFILKARNCEYLFVSKKGSYINRKSVWRLLNHYIKRTSISKK-VTPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE  ADL+++Q LLGH DISTTQIYTH+    L+++ + +HP  
Sbjct: 248 HSFATHLLENHADLKSVQELLGHIDISTTQIYTHMANKTLKEVHKKFHPRG 298


>gi|323154775|gb|EFZ40973.1| tyrosine recombinase XerD [Escherichia coli EPECa14]
          Length = 298

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 174/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L ++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLYHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|1916335|gb|AAC45774.1| site-specific recombinase [Salmonella enterica subsp. enterica
           serovar Typhimurium]
          Length = 298

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 173/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L+++  +L+ A  + L + L    +     ++  R
Sbjct: 15  LWLERNLAENTLSAYRRDLSMVVAWLHHRGKTLATAQADDLQTLLAERVEGGYKATTSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+  L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAMRRFFQHLYREKYREDDPSAQLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L + +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHEQHHPRA 298


>gi|229098300|ref|ZP_04229247.1| Tyrosine recombinase xerC [Bacillus cereus Rock3-29]
 gi|228685198|gb|EEL39129.1| Tyrosine recombinase xerC [Bacillus cereus Rock3-29]
          Length = 302

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 147/294 (50%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 17  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 77  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 130 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 189

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          +              L+ +     L  L  +A +  + ISPH
Sbjct: 190 DALITYMENGRKQLANKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 248

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 249 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 302


>gi|222151393|ref|YP_002560549.1| site-specific tyrosine recombinase XerD [Macrococcus caseolyticus
           JCSC5402]
 gi|222120518|dbj|BAH17853.1| site-specific tyrosine recombinase XerD [Macrococcus caseolyticus
           JCSC5402]
          Length = 295

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 94/293 (32%), Positives = 148/293 (50%), Gaps = 9/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  E+  S NT++AY+RDL   + FL    I S+       +  +L  L      + + 
Sbjct: 11  FIMIEKGLSENTIAAYRRDLNHYKKFLEESHIGSIDNIDRFTISLFLGKLKDDGKSSKTL 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R  + +R F+ F   E     +P+  LE PK    LP  L  + +   L          
Sbjct: 71  ARVTASVRGFHQFALREKYAVKDPTIILEPPKFERKLPGILTVEEVDIFLSSP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +    R   ++ELLYATGMRVSEL+ L    +N     + + GKGNKER+V +    
Sbjct: 124 DTSKVTGRRDQAMLELLYATGMRVSELINLDVADVNTIMGFVKVTGKGNKERIVPIGTHM 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  +  Y        +          +     ++RQ F + +K + A +GIQKK ++PH 
Sbjct: 184 IKLMDAYIANTRHKMLKKEMTDSLFLNFHGKRMTRQGFWKIMKQVQAESGIQKK-LTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DIS+TQ+YTH+   +++++ ++ HP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHADISSTQLYTHIDTKQIREVYKNTHPRA 295


>gi|22127152|ref|NP_670575.1| site-specific tyrosine recombinase XerD [Yersinia pestis KIM 10]
 gi|45443323|ref|NP_994862.1| site-specific tyrosine recombinase XerD [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51597478|ref|YP_071669.1| site-specific tyrosine recombinase XerD [Yersinia
           pseudotuberculosis IP 32953]
 gi|108806374|ref|YP_650290.1| site-specific tyrosine recombinase XerD [Yersinia pestis Antiqua]
 gi|108813251|ref|YP_649018.1| site-specific tyrosine recombinase XerD [Yersinia pestis Nepal516]
 gi|145597930|ref|YP_001162006.1| site-specific tyrosine recombinase XerD [Yersinia pestis Pestoides
           F]
 gi|150260097|ref|ZP_01916825.1| integrase/recombinase [Yersinia pestis CA88-4125]
 gi|153948372|ref|YP_001399863.1| site-specific tyrosine recombinase XerD [Yersinia
           pseudotuberculosis IP 31758]
 gi|162418404|ref|YP_001608154.1| site-specific tyrosine recombinase XerD [Yersinia pestis Angola]
 gi|165924857|ref|ZP_02220689.1| tyrosine recombinase XerD [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165937373|ref|ZP_02225937.1| tyrosine recombinase XerD [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166010314|ref|ZP_02231212.1| tyrosine recombinase XerD [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212682|ref|ZP_02238717.1| tyrosine recombinase XerD [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399752|ref|ZP_02305270.1| tyrosine recombinase XerD [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167418760|ref|ZP_02310513.1| tyrosine recombinase XerD [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425367|ref|ZP_02317120.1| tyrosine recombinase XerD [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170023169|ref|YP_001719674.1| site-specific tyrosine recombinase XerD [Yersinia
           pseudotuberculosis YPIII]
 gi|186896598|ref|YP_001873710.1| site-specific tyrosine recombinase XerD [Yersinia
           pseudotuberculosis PB1/+]
 gi|218928065|ref|YP_002345940.1| site-specific tyrosine recombinase XerD [Yersinia pestis CO92]
 gi|229837578|ref|ZP_04457740.1| site-specific tyrosine recombinase [Yersinia pestis Pestoides A]
 gi|229840801|ref|ZP_04460960.1| site-specific tyrosine recombinase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842640|ref|ZP_04462795.1| site-specific tyrosine recombinase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229903707|ref|ZP_04518820.1| site-specific tyrosine recombinase [Yersinia pestis Nepal516]
 gi|270487486|ref|ZP_06204560.1| tyrosine recombinase XerD [Yersinia pestis KIM D27]
 gi|294502941|ref|YP_003567003.1| tyrosine recombinase [Yersinia pestis Z176003]
 gi|34222946|sp|Q8ZHK1|XERD_YERPE RecName: Full=Tyrosine recombinase xerD
 gi|21960213|gb|AAM86826.1|AE013928_11 site-specific recombinase [Yersinia pestis KIM 10]
 gi|45438192|gb|AAS63739.1| integrase/recombinase [Yersinia pestis biovar Microtus str. 91001]
 gi|51590760|emb|CAH22405.1| Probable site-specific integrase/recombinase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108776899|gb|ABG19418.1| tyrosine recombinase XerD subunit [Yersinia pestis Nepal516]
 gi|108778287|gb|ABG12345.1| tyrosine recombinase XerD subunit [Yersinia pestis Antiqua]
 gi|115346676|emb|CAL19559.1| integrase/recombinase [Yersinia pestis CO92]
 gi|145209626|gb|ABP39033.1| tyrosine recombinase XerD subunit [Yersinia pestis Pestoides F]
 gi|149289505|gb|EDM39582.1| integrase/recombinase [Yersinia pestis CA88-4125]
 gi|152959867|gb|ABS47328.1| tyrosine recombinase XerD [Yersinia pseudotuberculosis IP 31758]
 gi|162351219|gb|ABX85167.1| tyrosine recombinase XerD [Yersinia pestis Angola]
 gi|165914847|gb|EDR33460.1| tyrosine recombinase XerD [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165923057|gb|EDR40208.1| tyrosine recombinase XerD [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990800|gb|EDR43101.1| tyrosine recombinase XerD [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205974|gb|EDR50454.1| tyrosine recombinase XerD [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962754|gb|EDR58775.1| tyrosine recombinase XerD [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167050460|gb|EDR61868.1| tyrosine recombinase XerD [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055767|gb|EDR65551.1| tyrosine recombinase XerD [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749703|gb|ACA67221.1| tyrosine recombinase XerD [Yersinia pseudotuberculosis YPIII]
 gi|186699624|gb|ACC90253.1| tyrosine recombinase XerD [Yersinia pseudotuberculosis PB1/+]
 gi|229679477|gb|EEO75580.1| site-specific tyrosine recombinase [Yersinia pestis Nepal516]
 gi|229690950|gb|EEO83004.1| site-specific tyrosine recombinase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229697167|gb|EEO87214.1| site-specific tyrosine recombinase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229704266|gb|EEO91277.1| site-specific tyrosine recombinase [Yersinia pestis Pestoides A]
 gi|262360976|gb|ACY57697.1| tyrosine recombinase [Yersinia pestis D106004]
 gi|262364916|gb|ACY61473.1| tyrosine recombinase [Yersinia pestis D182038]
 gi|270335990|gb|EFA46767.1| tyrosine recombinase XerD [Yersinia pestis KIM D27]
 gi|294353400|gb|ADE63741.1| tyrosine recombinase [Yersinia pestis Z176003]
 gi|320014032|gb|ADV97603.1| site-specific tyrosine recombinase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 299

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 108/291 (37%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL  +  +L +    L  AS   L S+L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLHALVGWLTHHNSDLLRASPQDLQSFLAERIEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+P+  L  PK    LPK L +  +  LL    ++      
Sbjct: 76  LLSAMRRLFQYLYREKLREDDPTALLSSPKLPQRLPKDLSEAQVDALLNSPNVDI----- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 131 --PLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYMEHGRPWLVNGASLDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 299


>gi|30263835|ref|NP_846212.1| site-specific tyrosine recombinase XerC [Bacillus anthracis str.
           Ames]
 gi|47529259|ref|YP_020608.1| site-specific tyrosine recombinase XerC [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49186681|ref|YP_029933.1| site-specific tyrosine recombinase XerC [Bacillus anthracis str.
           Sterne]
 gi|165873312|ref|ZP_02217917.1| tyrosine recombinase XerC [Bacillus anthracis str. A0488]
 gi|167642028|ref|ZP_02400258.1| tyrosine recombinase XerC [Bacillus anthracis str. A0193]
 gi|170689658|ref|ZP_02880838.1| tyrosine recombinase XerC [Bacillus anthracis str. A0465]
 gi|170709363|ref|ZP_02899777.1| tyrosine recombinase XerC [Bacillus anthracis str. A0389]
 gi|177655993|ref|ZP_02937120.1| tyrosine recombinase XerC [Bacillus anthracis str. A0174]
 gi|229603261|ref|YP_002868069.1| tyrosine recombinase XerC [Bacillus anthracis str. A0248]
 gi|254683462|ref|ZP_05147322.1| site-specific tyrosine recombinase XerC [Bacillus anthracis str.
           CNEVA-9066]
 gi|254735869|ref|ZP_05193575.1| site-specific tyrosine recombinase XerC [Bacillus anthracis str.
           Western North America USA6153]
 gi|254739605|ref|ZP_05197299.1| site-specific tyrosine recombinase XerC [Bacillus anthracis str.
           Kruger B]
 gi|254751200|ref|ZP_05203239.1| site-specific tyrosine recombinase XerC [Bacillus anthracis str.
           Vollum]
 gi|254759317|ref|ZP_05211342.1| site-specific tyrosine recombinase XerC [Bacillus anthracis str.
           Australia 94]
 gi|30258479|gb|AAP27698.1| tyrosine recombinase XerC [Bacillus anthracis str. Ames]
 gi|47504407|gb|AAT33083.1| tyrosine recombinase XerC [Bacillus anthracis str. 'Ames Ancestor']
 gi|49180608|gb|AAT55984.1| site-specific recombinase, phage integrase family [Bacillus
           anthracis str. Sterne]
 gi|164710950|gb|EDR16522.1| tyrosine recombinase XerC [Bacillus anthracis str. A0488]
 gi|167510008|gb|EDR85424.1| tyrosine recombinase XerC [Bacillus anthracis str. A0193]
 gi|170125737|gb|EDS94650.1| tyrosine recombinase XerC [Bacillus anthracis str. A0389]
 gi|170666382|gb|EDT17165.1| tyrosine recombinase XerC [Bacillus anthracis str. A0465]
 gi|172079892|gb|EDT65000.1| tyrosine recombinase XerC [Bacillus anthracis str. A0174]
 gi|229267669|gb|ACQ49306.1| tyrosine recombinase XerC [Bacillus anthracis str. A0248]
          Length = 299

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDITYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSM--KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +       + T     +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DALITYIENGRKQLAEKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           I+RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 ILRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|65321158|ref|ZP_00394117.1| COG4974: Site-specific recombinase XerD [Bacillus anthracis str.
           A2012]
          Length = 302

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 17  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDITYADVRLYLTTLHDEKLARKSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 77  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 130 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 189

Query: 181 HALQMYKKTCSSM--KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +       + T     +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 190 DALITYIENGRKQLAEKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 248

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           I+RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 249 ILRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 302


>gi|229019026|ref|ZP_04175867.1| Tyrosine recombinase xerC [Bacillus cereus AH1273]
 gi|229025272|ref|ZP_04181692.1| Tyrosine recombinase xerC [Bacillus cereus AH1272]
 gi|228736025|gb|EEL86600.1| Tyrosine recombinase xerC [Bacillus cereus AH1272]
 gi|228742266|gb|EEL92425.1| Tyrosine recombinase xerC [Bacillus cereus AH1273]
          Length = 302

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 99/294 (33%), Positives = 148/294 (50%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 17  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG +KDNP     LPKK   +PK L+ + +  L E          
Sbjct: 77  RKVSSLRSLYRFLMREGYQKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 130 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 189

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +      +   +              L+ +     L  L  +A +  + ISPH
Sbjct: 190 DALITYIENGRKQLIQKTEEHSHMVFLNAKGTPLTDRGVRYVLNELIKKASLTMR-ISPH 248

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 249 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 302


>gi|333000719|gb|EGK20294.1| tyrosine recombinase XerD [Shigella flexneri K-272]
 gi|333015225|gb|EGK34567.1| tyrosine recombinase XerD [Shigella flexneri K-227]
          Length = 298

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTISDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|218550141|ref|YP_002383932.1| site-specific tyrosine recombinase XerD [Escherichia fergusonii
           ATCC 35469]
 gi|218357682|emb|CAQ90323.1| site-specific tyrosine recombinase [Escherichia fergusonii ATCC
           35469]
          Length = 298

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  +  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYRKKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|239833075|ref|ZP_04681404.1| tyrosine recombinase XerD [Ochrobactrum intermedium LMG 3301]
 gi|239825342|gb|EEQ96910.1| tyrosine recombinase XerD [Ochrobactrum intermedium LMG 3301]
          Length = 313

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 137/298 (45%), Positives = 206/298 (69%), Gaps = 6/298 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTL +Y+RDL+ +   +  + ++L+ A  +H+ S ++ ++      +SQ 
Sbjct: 15  MMSAERGAARNTLESYRRDLEAVAEAMAARGVNLAEAGADHVRSAIDAMAAEGFAATSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP- 119
           R++S +RQF+ FL  EG R+D+P+ T++ PKK   LPK +  + +  LL++A +EA+ P 
Sbjct: 75  RRLSALRQFFRFLYSEGYRQDDPTGTVDAPKKQKPLPKIMSVENVTRLLDRAVLEADEPG 134

Query: 120 -----APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVI 174
                   + + +R+  L+E LYATG+RVSELV L         R ++++GKG+KER+V 
Sbjct: 135 GPADLTSDRLRALRLHALLETLYATGLRVSELVGLPVTVARTDHRFLLVRGKGSKERMVP 194

Query: 175 LSPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKN 234
           LSP A  ALQ +     S+  + ++ WLFP+ +++GHL+RQVFAR+LK LAARAG+    
Sbjct: 195 LSPKAREALQRFLALRDSLPGSDDNPWLFPAFSESGHLARQVFARELKGLAARAGLSASA 254

Query: 235 ISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +SPH++RHAFASHLL+ GADLRT+Q LLGH DISTTQIYTH+L ++L KLV ++HPLA
Sbjct: 255 VSPHVLRHAFASHLLQNGADLRTVQQLLGHADISTTQIYTHVLEERLHKLVSEHHPLA 312


>gi|30021919|ref|NP_833550.1| site-specific tyrosine recombinase XerC [Bacillus cereus ATCC
           14579]
 gi|29897475|gb|AAP10751.1| Integrase/recombinase (XerC/CodV family) [Bacillus cereus ATCC
           14579]
          Length = 294

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 9   LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 68

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 69  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 121

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 122 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 181

Query: 181 HALQMYKKTCSSMK--MTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            +L  Y +         T  D  +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 182 DSLITYIENGRKQLVNKTDEDSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 240

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 241 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 294


>gi|257869544|ref|ZP_05649197.1| phage integrase [Enterococcus gallinarum EG2]
 gi|257803708|gb|EEV32530.1| phage integrase [Enterococcus gallinarum EG2]
          Length = 296

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 95/292 (32%), Positives = 149/292 (51%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NT  +Y+RDL++   FL  + I    A     ++S+L  L Q    +++  
Sbjct: 12  LTIERGLSQNTRKSYERDLEQYLTFLTEQHIKDWQAVDRVLILSFLQQLQQSGKSSATII 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R+F+ FL  E     +P   ++ PKK   LP TL    +  L+E          
Sbjct: 72  RMVSSLRRFHQFLRQERFTDHDPMQHIDSPKKQQKLPDTLSLSEVERLIETP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATG+RVSEL+ L    L+L+   +   GKG+KER+V L   A+
Sbjct: 125 TKEVLGIRDRAILEVMYATGLRVSELIGLQLKDLHLSMGLLQTTGKGDKERIVPLGDLAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             ++ Y +         +           G    +           R     KN++PH +
Sbjct: 185 QWIETYLEEARPFLTRKHPEESHLFVNNHGKQLSRQGIWKNLKALVRKAGITKNVTPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLRT+Q LLGH DISTTQIYTH+   ++ ++ + + P A
Sbjct: 245 RHSFATHLLENGADLRTVQELLGHADISTTQIYTHITKKRMTEVYKQHFPRA 296


>gi|270308385|ref|YP_003330443.1| integrase/recombinase [Dehalococcoides sp. VS]
 gi|270154277|gb|ACZ62115.1| integrase/recombinase [Dehalococcoides sp. VS]
          Length = 302

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 98/298 (32%), Positives = 158/298 (53%), Gaps = 13/298 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAA------STNHLISYLNHLSQRKLV 55
           +  E+  S NT  AY+ DL++M  F + +             +   +++Y+  L +R   
Sbjct: 12  LMVEKGFSENTTEAYENDLRQMMTFADKEAAKFGKIPGWENFTRQTMLAYMLDLKERNYA 71

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
            ++  RK++  + F+NF+  EG  K+NP++ +  PK    LP  +    +  LL Q    
Sbjct: 72  ITTVVRKMAAAKSFFNFMVAEGKLKENPTENISTPKVGKPLPDAISISQVRALLNQPVKS 131

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
             + A       R   ++ELLYA+GMRV+ELV L+   ++L E  +   GKG KER++ +
Sbjct: 132 GSSEAK------RDKAMLELLYASGMRVTELVNLNVLDIDLKEGFVRCFGKGRKERMIPI 185

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
            P A  ++Q Y        +          + +   L+RQ   + LK  A  AG+    +
Sbjct: 186 YPQAAQSIQEYLTEIRPNLVRAETEKALFLNRRGDRLTRQGLWQILKGYAREAGLDD-VV 244

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           +PH +RH+FA+H+L GGADLR++Q LLGH +ISTTQIYTHL  + +++  +  HP AK
Sbjct: 245 TPHTLRHSFATHMLSGGADLRSVQELLGHANISTTQIYTHLTSEHIRRSYEKAHPRAK 302


>gi|311739368|ref|ZP_07713203.1| tyrosine recombinase XerD [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|311305184|gb|EFQ81252.1| tyrosine recombinase XerD [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 296

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 98/292 (33%), Positives = 154/292 (52%), Gaps = 11/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NTLS Y+RD++   ++L +  +  L + +   + +YL  L    +  SS  
Sbjct: 15  LAVERGVSANTLSNYRRDVRRYLSWLGDNGVEDLRSVTRPMVEAYLKDLRS-HMAVSSAN 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R + V R  + F   EG+   + +  +  P     LP+TL  D +  L+E    E     
Sbjct: 74  RALIVARGLHKFAVSEGVVDVDVAVEVTPPSTGQQLPETLSVDEVTALIEATPTE----- 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 VR   L+E+LY TG R+SE+V+L+   ++  +  + ++GKG+KER+V +   A 
Sbjct: 129 --TPVDVRDRALLEMLYGTGARISEIVSLNVDDVSSAQEVIRLRGKGDKERIVPVGSHAR 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            AL  Y          G    LF ++           A  +   AA+     K+ISPH +
Sbjct: 187 QALDAYLVRARPALSKGKTPALFLNTRGGALSR--QSAWTVLKTAAQRAQLGKSISPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLEGGAD+RT+Q LLGH+ ++TTQIYTH+  D L+++ +  HP A
Sbjct: 245 RHSFATHLLEGGADVRTVQELLGHSSVTTTQIYTHVTADSLREVWRTAHPRA 296


>gi|325571148|ref|ZP_08146720.1| integrase/recombinase XerD [Enterococcus casseliflavus ATCC 12755]
 gi|325156233|gb|EGC68419.1| integrase/recombinase XerD [Enterococcus casseliflavus ATCC 12755]
          Length = 296

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 103/293 (35%), Positives = 163/293 (55%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NT ++Y+RDL++   FL  K+++         ++S+L  L +    +++  
Sbjct: 12  LTIERGLSQNTRASYQRDLQQYLAFLQKKQVTQWQQIDRVIVLSFLQSLQEAGKSSATVI 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R+F+ FL  E     +P   ++ PKK   LP TL    +  L+E          
Sbjct: 72  RMVSSLRRFHQFLRQERFTDHDPMQHIDSPKKQQKLPDTLSLQEVERLIETP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++E++YATG+RVSEL+ L  + L+L+   +   GKG+KER+V L   A+
Sbjct: 125 TRAVLGIRDRAILEVMYATGLRVSELIGLKLNDLHLSMGLLQTTGKGDKERIVPLGDLAI 184

Query: 181 HALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             ++ Y       +     D      +     LSRQ   ++LKAL  +AGI  KN++PH 
Sbjct: 185 QWIETYLSDARPYLTRKTPDESHLFVNNHGTQLSRQGIWKNLKALVRQAGIT-KNVTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLRT+Q LLGH DISTTQIYTH+   ++ ++ + + P A
Sbjct: 244 LRHSFATHLLENGADLRTVQELLGHADISTTQIYTHITKKRMTEVYKQHFPRA 296


>gi|222055852|ref|YP_002538214.1| tyrosine recombinase XerD [Geobacter sp. FRC-32]
 gi|221565141|gb|ACM21113.1| tyrosine recombinase XerD [Geobacter sp. FRC-32]
          Length = 295

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 111/292 (38%), Positives = 163/292 (55%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKE-ISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+  + NTL AY RDL    +FL  +  + L   +   +I +L  L +R L   S+ 
Sbjct: 12  LQVEKGLTKNTLEAYSRDLSVYLDFLAGQGRLDLDHITAMDVIEHLAGLKERGLSPRSRA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S ++ F+ FL  E    +NP+  +E P+  + LP  L    +  LL+ A+       
Sbjct: 72  RALSAVKMFHRFLMVENHCPNNPAVIIEAPRSLNRLPDVLSGREVELLLDSARS------ 125

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 VR   ++E+LYATG+RVSELV L    +NL    ++  GKG KERLV L  +A 
Sbjct: 126 -ADLNDVRDLAMLEVLYATGLRVSELVALKLRDVNLDAGYLLTMGKGEKERLVPLGETAR 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A   Y ++         D  +   S     ++RQ F   +K  AA AGI +K+ISPH +
Sbjct: 185 LATAEYLRSARVKADRKGDCEILFISRLGDGMTRQAFWNIIKKRAAAAGI-RKSISPHSL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++QI+LGH D+S+TQIYTH+  ++L++L QD HP  
Sbjct: 244 RHSFATHLLENGADLRSVQIMLGHADLSSTQIYTHVTRERLKQLHQDIHPRG 295


>gi|50842870|ref|YP_056097.1| site-specific tyrosine recombinase XerD [Propionibacterium acnes
           KPA171202]
 gi|289425573|ref|ZP_06427350.1| tyrosine recombinase XerD [Propionibacterium acnes SK187]
 gi|289428211|ref|ZP_06429907.1| tyrosine recombinase XerD [Propionibacterium acnes J165]
 gi|295130925|ref|YP_003581588.1| tyrosine recombinase XerD [Propionibacterium acnes SK137]
 gi|50840472|gb|AAT83139.1| site-specific recombinase [Propionibacterium acnes KPA171202]
 gi|289154551|gb|EFD03239.1| tyrosine recombinase XerD [Propionibacterium acnes SK187]
 gi|289158592|gb|EFD06799.1| tyrosine recombinase XerD [Propionibacterium acnes J165]
 gi|291376433|gb|ADE00288.1| tyrosine recombinase XerD [Propionibacterium acnes SK137]
 gi|313764051|gb|EFS35415.1| tyrosine recombinase XerD [Propionibacterium acnes HL013PA1]
 gi|313792446|gb|EFS40539.1| tyrosine recombinase XerD [Propionibacterium acnes HL110PA1]
 gi|313801509|gb|EFS42758.1| tyrosine recombinase XerD [Propionibacterium acnes HL110PA2]
 gi|313807151|gb|EFS45646.1| tyrosine recombinase XerD [Propionibacterium acnes HL087PA2]
 gi|313809643|gb|EFS47379.1| tyrosine recombinase XerD [Propionibacterium acnes HL083PA1]
 gi|313813282|gb|EFS50996.1| tyrosine recombinase XerD [Propionibacterium acnes HL025PA1]
 gi|313816401|gb|EFS54115.1| tyrosine recombinase XerD [Propionibacterium acnes HL059PA1]
 gi|313819347|gb|EFS57061.1| tyrosine recombinase XerD [Propionibacterium acnes HL046PA2]
 gi|313819996|gb|EFS57710.1| tyrosine recombinase XerD [Propionibacterium acnes HL036PA1]
 gi|313823212|gb|EFS60926.1| tyrosine recombinase XerD [Propionibacterium acnes HL036PA2]
 gi|313825000|gb|EFS62714.1| tyrosine recombinase XerD [Propionibacterium acnes HL063PA1]
 gi|313827302|gb|EFS65016.1| tyrosine recombinase XerD [Propionibacterium acnes HL063PA2]
 gi|313829963|gb|EFS67677.1| tyrosine recombinase XerD [Propionibacterium acnes HL007PA1]
 gi|313833033|gb|EFS70747.1| tyrosine recombinase XerD [Propionibacterium acnes HL056PA1]
 gi|313838270|gb|EFS75984.1| tyrosine recombinase XerD [Propionibacterium acnes HL086PA1]
 gi|314914912|gb|EFS78743.1| tyrosine recombinase XerD [Propionibacterium acnes HL005PA4]
 gi|314917863|gb|EFS81694.1| tyrosine recombinase XerD [Propionibacterium acnes HL050PA1]
 gi|314919752|gb|EFS83583.1| tyrosine recombinase XerD [Propionibacterium acnes HL050PA3]
 gi|314924835|gb|EFS88666.1| tyrosine recombinase XerD [Propionibacterium acnes HL036PA3]
 gi|314930006|gb|EFS93837.1| tyrosine recombinase XerD [Propionibacterium acnes HL067PA1]
 gi|314956418|gb|EFT00730.1| tyrosine recombinase XerD [Propionibacterium acnes HL027PA1]
 gi|314957287|gb|EFT01390.1| tyrosine recombinase XerD [Propionibacterium acnes HL002PA1]
 gi|314960608|gb|EFT04710.1| tyrosine recombinase XerD [Propionibacterium acnes HL002PA2]
 gi|314963140|gb|EFT07240.1| tyrosine recombinase XerD [Propionibacterium acnes HL082PA1]
 gi|314967736|gb|EFT11835.1| tyrosine recombinase XerD [Propionibacterium acnes HL037PA1]
 gi|314972871|gb|EFT16968.1| tyrosine recombinase XerD [Propionibacterium acnes HL053PA1]
 gi|314975706|gb|EFT19801.1| tyrosine recombinase XerD [Propionibacterium acnes HL045PA1]
 gi|314978092|gb|EFT22186.1| tyrosine recombinase XerD [Propionibacterium acnes HL072PA2]
 gi|314984110|gb|EFT28202.1| tyrosine recombinase XerD [Propionibacterium acnes HL005PA1]
 gi|314986253|gb|EFT30345.1| tyrosine recombinase XerD [Propionibacterium acnes HL005PA2]
 gi|314989533|gb|EFT33624.1| tyrosine recombinase XerD [Propionibacterium acnes HL005PA3]
 gi|315078203|gb|EFT50246.1| tyrosine recombinase XerD [Propionibacterium acnes HL053PA2]
 gi|315080906|gb|EFT52882.1| tyrosine recombinase XerD [Propionibacterium acnes HL078PA1]
 gi|315086002|gb|EFT57978.1| tyrosine recombinase XerD [Propionibacterium acnes HL002PA3]
 gi|315088279|gb|EFT60255.1| tyrosine recombinase XerD [Propionibacterium acnes HL072PA1]
 gi|315095700|gb|EFT67676.1| tyrosine recombinase XerD [Propionibacterium acnes HL038PA1]
 gi|315098208|gb|EFT70184.1| tyrosine recombinase XerD [Propionibacterium acnes HL059PA2]
 gi|315101638|gb|EFT73614.1| tyrosine recombinase XerD [Propionibacterium acnes HL046PA1]
 gi|315105953|gb|EFT77929.1| tyrosine recombinase XerD [Propionibacterium acnes HL030PA1]
 gi|315109457|gb|EFT81433.1| tyrosine recombinase XerD [Propionibacterium acnes HL030PA2]
 gi|327327897|gb|EGE69671.1| tyrosine recombinase XerD [Propionibacterium acnes HL096PA3]
 gi|327330004|gb|EGE71758.1| tyrosine recombinase XerD [Propionibacterium acnes HL097PA1]
 gi|327330036|gb|EGE71789.1| tyrosine recombinase XerD [Propionibacterium acnes HL096PA2]
 gi|327442733|gb|EGE89387.1| tyrosine recombinase XerD [Propionibacterium acnes HL043PA1]
 gi|327443869|gb|EGE90523.1| tyrosine recombinase XerD [Propionibacterium acnes HL043PA2]
 gi|327443937|gb|EGE90591.1| tyrosine recombinase XerD [Propionibacterium acnes HL013PA2]
 gi|327452342|gb|EGE98996.1| tyrosine recombinase XerD [Propionibacterium acnes HL087PA3]
 gi|327452783|gb|EGE99437.1| tyrosine recombinase XerD [Propionibacterium acnes HL083PA2]
 gi|327453535|gb|EGF00190.1| tyrosine recombinase XerD [Propionibacterium acnes HL092PA1]
 gi|328752650|gb|EGF66266.1| tyrosine recombinase XerD [Propionibacterium acnes HL025PA2]
 gi|328753798|gb|EGF67414.1| tyrosine recombinase XerD [Propionibacterium acnes HL087PA1]
 gi|328755026|gb|EGF68642.1| tyrosine recombinase XerD [Propionibacterium acnes HL020PA1]
 gi|328761444|gb|EGF74970.1| tyrosine recombinase XerD [Propionibacterium acnes HL099PA1]
          Length = 306

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 85/297 (28%), Positives = 142/297 (47%), Gaps = 13/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+ AY+RDL   Q +L ++ I SL+  +   +  +  HL    L  +S  
Sbjct: 16  LVVERGLSDNTVQAYRRDLLRYQEYLGSRGIGSLAEVTRVDVEEFRRHLDHIGLAPASVT 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +  +R  + F    G  + + +  +    ++  LPK L  D + +LL           
Sbjct: 76  RCVVAVRNLHRFAVGSGQLQADVTAGMSPGTRSRRLPKALSMDQVESLLAAP-------D 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTM-----IIQGKGNKERLVIL 175
               + +R   L+ELLY TG RVSE+  L    +            +I     +  + + 
Sbjct: 129 TSTVEGLRDAALLELLYGTGARVSEVCALDVDDIRPVLDDPDLGLRLIGKGDKERIVPLG 188

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
           S +A        +   +    GN       +T+   LSRQ     ++     AG+  +++
Sbjct: 189 SYAAKAVDAWLIRGRPAWAEIGNGEHALLLNTRGRRLSRQSAWAVIRRAGEAAGLDVEHL 248

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH +RH++A+HLL+GGAD+R +Q LLGH+ ++TTQIYT +  D L+++ +  HP A
Sbjct: 249 SPHSLRHSYATHLLDGGADVRVVQELLGHSSVTTTQIYTLVTADHLREVYRSSHPRA 305


>gi|309793966|ref|ZP_07688391.1| tyrosine recombinase XerD [Escherichia coli MS 145-7]
 gi|308122373|gb|EFO59635.1| tyrosine recombinase XerD [Escherichia coli MS 145-7]
          Length = 298

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVSLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|15803430|ref|NP_289463.1| site-specific tyrosine recombinase XerD [Escherichia coli O157:H7
           EDL933]
 gi|15833020|ref|NP_311793.1| site-specific tyrosine recombinase XerD [Escherichia coli O157:H7
           str. Sakai]
 gi|168760022|ref|ZP_02785029.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4501]
 gi|217327493|ref|ZP_03443576.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. TW14588]
 gi|34222933|sp|Q8X574|XERD_ECO57 RecName: Full=Tyrosine recombinase xerD
 gi|12517420|gb|AAG58022.1|AE005519_8 site-specific recombinase [Escherichia coli O157:H7 str. EDL933]
 gi|13363238|dbj|BAB37189.1| site-specific recombinase [Escherichia coli O157:H7 str. Sakai]
 gi|189369440|gb|EDU87856.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. EC4501]
 gi|209760580|gb|ACI78602.1| site-specific recombinase [Escherichia coli]
 gi|217319860|gb|EEC28285.1| tyrosine recombinase XerD [Escherichia coli O157:H7 str. TW14588]
 gi|326339022|gb|EGD62837.1| Tyrosine recombinase XerD [Escherichia coli O157:H7 str. 1044]
          Length = 298

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 174/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ     +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTLWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|212715582|ref|ZP_03323710.1| hypothetical protein BIFCAT_00481 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660949|gb|EEB21524.1| hypothetical protein BIFCAT_00481 [Bifidobacterium catenulatum DSM
           16992]
          Length = 317

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 93/307 (30%), Positives = 155/307 (50%), Gaps = 14/307 (4%)

Query: 1   MMS---SERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVT 56
            ++    ER  S  T+SAY  DLK+ + +L N+ I  +++ +T  + +Y+  L +     
Sbjct: 11  FLAHIDVERGLSKATVSAYGADLKKYRQWLANRGINDITSVTTQDVENYVAFLDESGESA 70

Query: 57  SSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQ----- 111
            S+ R+++ I  F+ F   E    D+ S  ++ PK    LP  L  D +A LLE      
Sbjct: 71  RSKARRLASIHAFHRFAVDEHSVADDVSAQVKAPKGASTLPDVLAIDEVARLLEAIPVSQ 130

Query: 112 --AKIEAENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNK 169
             A  +A          +R   L+E +YATG RVSE    +   ++   R   + GKG+K
Sbjct: 131 NRACDDASLEVSDDPVMLRDKALLEFMYATGARVSEACGANLDDVDTESRIARLMGKGSK 190

Query: 170 ERLVILSPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAG 229
           +RLV +   A  A+  Y ++   +  + +       +       R++  + +  +   AG
Sbjct: 191 QRLVPVGSYACEAISRYVRSGRPILESKSKGPQERRALFLNKRGRRLSRQSVWEIIRVAG 250

Query: 230 IQ---KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQ 286
            +    K + PH +RH+FA+HL++GGAD+RT+Q LLGH  ++TTQIYTH+ P+ L +   
Sbjct: 251 ERAHIDKPLHPHTLRHSFATHLIQGGADVRTVQELLGHASVTTTQIYTHVSPENLIETYL 310

Query: 287 DYHPLAK 293
             HP A+
Sbjct: 311 TSHPRAR 317


>gi|332675806|gb|AEE72622.1| tyrosine recombinase XerD [Propionibacterium acnes 266]
          Length = 306

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 85/297 (28%), Positives = 141/297 (47%), Gaps = 13/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+ AY+RDL   Q +L ++ I SL+  +   +  +  HL    L  +S  
Sbjct: 16  LVVERGLSDNTVQAYRRDLLRYQEYLGSRGIGSLAEVTRVDVEEFRRHLDHIGLAPASVT 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +  +R  + F    G  + + +  +    ++  LPK L  D + +LL           
Sbjct: 76  RCVVAVRNLHRFAVGSGQLQADVTAGMSPGTRSRRLPKALSMDQVESLLAAP-------D 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTM-----IIQGKGNKERLVIL 175
               + +R   L+ELLY TG RVSE   L    +            +I     +  + + 
Sbjct: 129 TSTVEGLRDAALLELLYGTGARVSEACALDVDDIRPVLDDPDLGLRLIGKGDKERIVPLG 188

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
           S +A        +   +    GN       +T+   LSRQ     ++     AG+  +++
Sbjct: 189 SYAAKAVDAWLIRGRPAWAEIGNGEHALLLNTRGRRLSRQSAWAVIRRAGEAAGLDVEHL 248

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH +RH++A+HLL+GGAD+R +Q LLGH+ ++TTQIYT +  D L+++ +  HP A
Sbjct: 249 SPHSLRHSYATHLLDGGADVRVVQELLGHSSVTTTQIYTLVTADHLREVYRSSHPRA 305


>gi|322419214|ref|YP_004198437.1| tyrosine recombinase XerD [Geobacter sp. M18]
 gi|320125601|gb|ADW13161.1| tyrosine recombinase XerD [Geobacter sp. M18]
          Length = 292

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 103/291 (35%), Positives = 155/291 (53%), Gaps = 10/291 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER ++ NT++AY RDL     +L  +E        + +  YL  L    +   S+ R
Sbjct: 12  LLVERGAAANTVAAYSRDLTRYLAYLGERE--PDQIRPSDVTGYLGKLKGEGIAPRSRAR 69

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R  + FL  EG  + NP+  +E PK    LP  L    +  LL            
Sbjct: 70  ALSALRMLHRFLVREGHCEVNPTAIVEAPKGLLKLPTVLSSREVEALLASPLDTG----- 124

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RVSELV L    +N+    ++  GKG+KERL+ +  SA  
Sbjct: 125 --AIELRDKAMLELLYATGLRVSELVGLKTGDVNIAAGYLMTIGKGDKERLIPMGESACR 182

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           A+  Y +      +      L   S     ++RQ F   +K  A +AG+ +  ISPH +R
Sbjct: 183 AVGEYLEKARQELLKQKSSPLLFISRLGEGMTRQAFWNIIKKRALQAGV-RSGISPHTLR 241

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE GADLR++QI+LGH D+STTQIYTH+  ++L++L  ++HP  
Sbjct: 242 HSFATHLLENGADLRSVQIMLGHADLSTTQIYTHVTRERLKRLHAEFHPRG 292


>gi|229047517|ref|ZP_04193107.1| Tyrosine recombinase xerC [Bacillus cereus AH676]
 gi|228723764|gb|EEL75119.1| Tyrosine recombinase xerC [Bacillus cereus AH676]
          Length = 299

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 154/294 (52%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E + +E     
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEVSDME----- 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 129 --TPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMK--MTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            +L  Y +         T  D  +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DSLITYIENGRKQLVNKTDEDSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|161506408|ref|YP_001573520.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867755|gb|ABX24378.1| hypothetical protein SARI_04606 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 298

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 113/291 (38%), Positives = 172/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L ++  +L+ A  + L + L    +     +S  R
Sbjct: 15  LWLERNLAENTLSAYRRDLSMVVAWLRHRGKTLATAQADDLQTLLAERVEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+  L  E  R+D+PS  L  PK    LPK L +  +  LL+   IE      
Sbjct: 75  LLSAMRRFFQHLYREKYREDDPSAQLASPKLPQRLPKDLSEAQVERLLQAPLIE------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|116328183|ref|YP_797903.1| tyrosine site-specific recombinase XerC [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116330907|ref|YP_800625.1| tyrosine site-specific recombinase XerC [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|116120927|gb|ABJ78970.1| Tyrosine site-specific recombinase XerC [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116124596|gb|ABJ75867.1| Tyrosine site-specific recombinase XerC [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 311

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 89/294 (30%), Positives = 149/294 (50%), Gaps = 10/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHL-SQRKLVTSSQR 60
           +  E+  S NT++AY  DLK    F   +++ +       + SY ++L  ++ L   SQ 
Sbjct: 27  LKIEKNYSQNTINAYSIDLKFFFEFCEKEQLDILQVEPVDIRSYFSYLAKEQDLDRRSQS 86

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R FY  L  +   + NP+  +  PK    +PK    +    +LE          
Sbjct: 87  RKLSSLRTFYKVLLRDDQIESNPATRISFPKVRKEVPKNFRINETEEILEFEAER----- 141

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   +IE+LY++G+RV ELV     +L+     + + GKG KER V     A+
Sbjct: 142 TSEILEIRDKAMIEVLYSSGLRVFELVNAKLGSLSKDLTVLKVLGKGQKERFVYFGKEAV 201

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +L+ Y +  +       +++L     K   L+ +     L     + G +KK I+PH  
Sbjct: 202 DSLRRYLEYRNVSFPDVKEIFLNQ---KGKKLTTRGVRYILNERRKKMGWEKK-ITPHKF 257

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH FA+ LL+ GAD+R +Q LLGH+ +STTQIY  +  +K++++ +  HP A+K
Sbjct: 258 RHTFATDLLDAGADIRAVQELLGHSSLSTTQIYLSVSKEKIKEVYRKAHPHARK 311


>gi|254561653|ref|YP_003068748.1| tyrosine recombinase xerD [Methylobacterium extorquens DM4]
 gi|254268931|emb|CAX24892.1| Tyrosine recombinase xerD [Methylobacterium extorquens DM4]
          Length = 328

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 126/297 (42%), Positives = 183/297 (61%), Gaps = 8/297 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER ++ NTL+AY+RDL +   +L    I    A  + + +Y+  L  R L  SS  
Sbjct: 22  MLAAERGAAANTLAAYRRDLDDYLGYLAQGGIDPEEAQADQVRAYIASLEPRGLKASSAA 81

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE---AE 117
           R++S IR F+ FL  EG  + +P+  +  P++   LPK L    +  LL  A+     A 
Sbjct: 82  RRLSCIRGFHRFLYAEGYSETDPTAPVAAPRRAKGLPKVLSVAEVDRLLATARERVEAAG 141

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
           +         R+  L+ELLYATG+RVSELV L        ER ++++GKG +ERLV L+ 
Sbjct: 142 DDRAEARSAARMLCLLELLYATGLRVSELVALPRSAAATRERYLVVKGKGGRERLVPLTD 201

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
            A  A++ +        +T    WLFP+ +++GHL+RQ FARDLK  AA AG++   +SP
Sbjct: 202 LAREAMRTHVAY-----LTAEGAWLFPAESESGHLTRQAFARDLKTAAAAAGLRTDRVSP 256

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           H++RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L+ +V+D HPL  +
Sbjct: 257 HVLRHAFASHLLQNGADLRIVQELLGHADISTTQIYTHVLDERLKGMVRDLHPLNDR 313


>gi|189347316|ref|YP_001943845.1| tyrosine recombinase XerD [Chlorobium limicola DSM 245]
 gi|189341463|gb|ACD90866.1| tyrosine recombinase XerD [Chlorobium limicola DSM 245]
          Length = 306

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 104/291 (35%), Positives = 156/291 (53%), Gaps = 5/291 (1%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +S ER  S+NT  +Y+ DLK    F+ ++  ++ A  T  +  +++ L    L  S+  R
Sbjct: 21  LSVERNFSVNTRESYRNDLKRYLLFMQDENKAIGAVETADIRKFISELHATGLEASTLGR 80

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            IS IR  + FL  E   + NP++T++ PK    LP  L    + +LLE    +     P
Sbjct: 81  NISAIRSLHKFLLIERTLETNPAETIQQPKLAKNLPDVLSLSEVMSLLEAPLQQ----NP 136

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E LYA G+RVSEL  L    L      + I GKG+KERLV +  +A+ 
Sbjct: 137 PGKFLLRDKAILEFLYAAGVRVSELTALQQQHLYFDAGFVRILGKGSKERLVPVGNAAIE 196

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           A+  Y+       +T         + +   LSR      ++  AA AGI +KNISPH +R
Sbjct: 197 AITQYQNQLRIGMVTKESEDCLFLNARGKKLSRMAVYLMVREYAALAGI-RKNISPHTLR 255

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H FA+HLLEGGADLR +Q +LGH+ I  TQIYTH+    ++++ + +HP A
Sbjct: 256 HTFATHLLEGGADLRAVQEMLGHSSILATQIYTHIDRSFIREVHKTFHPRA 306


>gi|47570332|ref|ZP_00240977.1| site-specific recombinase, phage integrase family [Bacillus cereus
           G9241]
 gi|47552997|gb|EAL11403.1| site-specific recombinase, phage integrase family [Bacillus cereus
           G9241]
          Length = 302

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 100/294 (34%), Positives = 147/294 (50%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 17  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDITYADVRLYLTTLHDEKLARKSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 77  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 130 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 189

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          +              L+ +     L  L  +A +  + ISPH
Sbjct: 190 DALITYIENGRKQLAEKTEEHSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 248

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 249 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 302


>gi|1303994|dbj|BAA12649.1| YqkM [Bacillus subtilis]
          Length = 296

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 157/291 (53%), Gaps = 10/291 (3%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNN--KEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
            ER  S NT+ +Y+RDLK    +L         +  +  H+I YL HL        +  R
Sbjct: 14  VERGLSQNTIVSYERDLKSYSLYLTETLHVTDWNHVTRIHIIQYLKHLKDSGKSGKTSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ IR F+ FL  E +   +PS  +E  K    LPK L  + +  LL+  K+ +     
Sbjct: 74  HLASIRSFHQFLLREKVTDKDPSVHIETQKTERALPKVLALNEVERLLDTPKLTSPF--- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                 R   ++ELLYATG+RVSE++ L    ++L+   +   GKG KER+V +  +A  
Sbjct: 131 ----GYRDKAMLELLYATGIRVSEMIELKTADVHLSMGFIRCFGKGRKERIVPIGEAAAS 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           A++ Y        +  N       +     +SRQ F ++LK +A  AGI KK ++PH +R
Sbjct: 187 AIEEYMTKARGKLLKNNVSDALFLNHHGKQISRQGFWKNLKKIALEAGI-KKELTPHTLR 245

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 246 HSFATHLLEDGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYKQFHPRA 296


>gi|255011423|ref|ZP_05283549.1| putative tyrosine recombinase [Bacteroides fragilis 3_1_12]
 gi|313149239|ref|ZP_07811432.1| integrase [Bacteroides fragilis 3_1_12]
 gi|313138006|gb|EFR55366.1| integrase [Bacteroides fragilis 3_1_12]
          Length = 319

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 108/302 (35%), Positives = 168/302 (55%), Gaps = 11/302 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E++ S NTL AY  DL ++ NFL+++ + +   S   L  +   L    +   SQ R
Sbjct: 24  LKLEKSLSKNTLDAYLTDLDKLLNFLSDEGVDILEISLKDLQRFAAGLHDIGIHARSQAR 83

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            IS I+ F++FL      + +PS+ LE PK    LP+ L  + I +++            
Sbjct: 84  IISGIKSFFHFLIMADYIEADPSELLEGPKIGFKLPEVLTVEEIDHIISTV-------DL 136

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            + +  R   ++E LY+ G+RVSEL  L    L   E  + ++GKG+K+RLV +SP A+ 
Sbjct: 137 SKNEGQRNRAILETLYSCGLRVSELTNLKLSDLYFNEGFIKVEGKGSKQRLVPISPRAIQ 196

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y    + + +  +       S +  HLSR +    +K LA  AGI  KNISPH  R
Sbjct: 197 EIKYYFMDRNRINIKKDYEDYLFLSRRGTHLSRIMIFHLIKELADMAGIT-KNISPHTFR 255

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA---KKEKKH 298
           H+FA+HLLEGGA+LR IQ +LGH  ISTT+IYTH+  + L+  + ++HP     ++EK+H
Sbjct: 256 HSFATHLLEGGANLRAIQCMLGHESISTTEIYTHIDRNMLRSEIIEHHPRNIKYRQEKRH 315

Query: 299 YN 300
           +N
Sbjct: 316 FN 317


>gi|258620859|ref|ZP_05715893.1| Tyrosine recombinase xerD [Vibrio mimicus VM573]
 gi|258586247|gb|EEW10962.1| Tyrosine recombinase xerD [Vibrio mimicus VM573]
          Length = 302

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 104/291 (35%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           M  ER  + NT+++Y+ DL ++  ++   +  L   S + L  Y N LS++    +S+ R
Sbjct: 19  MWLERGLAENTVASYRNDLSKLLEWMAQHQYQLDFISFSGLQEYQNWLSEQNYKPTSKAR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LL           P
Sbjct: 79  MLSAIRRLFQYLHREKVRADDPSALLISPKLPTRLPKDLTEAQVEALLSAP-------DP 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+ 
Sbjct: 132 QTPIELRDKAMLELLYATGLRVTELVSLTMENMSLRQGVVRVIGKGGKERLVPMGENAIE 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ + +   S+ +      +   S++   ++RQ F   +K  A  A I  + +SPH++R
Sbjct: 192 WIETFLQQGRSLLLGEQTSDIVFPSSRGQQMTRQTFWHRIKHYAVIAEIDVELLSPHVLR 251

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 252 HAFATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHNEHHPRA 302


>gi|57234018|ref|YP_181928.1| tyrosine recombinase XerD [Dehalococcoides ethenogenes 195]
 gi|57224466|gb|AAW39523.1| tyrosine recombinase XerD [Dehalococcoides ethenogenes 195]
          Length = 302

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 98/298 (32%), Positives = 158/298 (53%), Gaps = 13/298 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS------LSAASTNHLISYLNHLSQRKLV 55
           +  E+  S NT  AY+ DL++M  F + +             +   +++Y+  L +R   
Sbjct: 12  LMVEKGFSENTTEAYENDLRQMMTFADKEAAKSGKIPGWENFTRQTMLAYMLDLKERNYA 71

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
            ++  RK++  + F+NF+  EG  K+NP++ +  PK    LP  +    +  LL Q    
Sbjct: 72  ITTVVRKMAAAKSFFNFMVAEGKLKENPTENISTPKVGKPLPDAISISQVRALLNQPVKS 131

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
             + A       R   ++ELLYA+GMRV+ELV L+   ++L E  +   GKG KER++ +
Sbjct: 132 GSSEAK------RDKAMLELLYASGMRVTELVNLNVLDVDLKEGFVRCFGKGRKERMIPI 185

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
            P A  ++Q Y        +          + +   L+RQ   + LK  A  AG+    +
Sbjct: 186 YPQAAQSIQEYLTEIRPNLVRAETEKALFLNRRGDRLTRQGLWQILKGYAREAGLDD-VV 244

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           +PH +RH+FA+H+L GGADLR++Q LLGH +ISTTQIYTHL  + +++  +  HP AK
Sbjct: 245 TPHTLRHSFATHMLSGGADLRSVQELLGHANISTTQIYTHLTSEHIKRSYEKAHPRAK 302


>gi|313673072|ref|YP_004051183.1| integrase family protein [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939828|gb|ADR19020.1| integrase family protein [Calditerrivibrio nitroreducens DSM 19672]
          Length = 300

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 101/296 (34%), Positives = 155/296 (52%), Gaps = 9/296 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
            +  E+ +S +T+ +Y  DL E+ NF+ ++ I +       L  Y+  L  R L  SS  
Sbjct: 13  FLKIEKNASDHTIRSYMNDLVELINFVKDESIDIKEIDFFALRGYITTLYDRSLSKSSIE 72

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS I+ F+ FL  +G  ++N +  L+ PKK   L K  + D +  LLE        P 
Sbjct: 73  RKISTIKSFFKFLTQKGYLEENHARMLKFPKKEKKLFKVFNIDDLFTLLE-------LPD 125

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               + +R  LL+EL+Y TG+RVSELV +    ++     + ++GKG KER++ L+   +
Sbjct: 126 KNTPQGIRDALLMELMYGTGVRVSELVGIKIDDIDFQGLRVRVRGKGKKERMIPLAEFHI 185

Query: 181 HALQMYKKTCSSMKMTGN-DLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             ++ Y  T   +  +          +     LS +   R ++     AG+     SPH 
Sbjct: 186 DFIKKYLATRDDIPKSRTIKTDKLFINKNGTSLSDRSVRRIVEKYLKMAGLPLD-FSPHS 244

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
            RH+FA+H+LE GADLRTIQ LLGH+ +STTQ YTHL    + K+  + HP A+K 
Sbjct: 245 FRHSFATHMLESGADLRTIQSLLGHSSLSTTQKYTHLNLSDILKIYDEAHPFARKR 300


>gi|284048544|ref|YP_003398883.1| tyrosine recombinase XerD [Acidaminococcus fermentans DSM 20731]
 gi|283952765|gb|ADB47568.1| tyrosine recombinase XerD [Acidaminococcus fermentans DSM 20731]
          Length = 301

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 92/291 (31%), Positives = 151/291 (51%), Gaps = 10/291 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           ++ E   + NT  +Y RDL+    ++      L       +++Y+  L   +   +S  R
Sbjct: 21  LTVELGLAYNTRESYGRDLRLFAGWIKK---PLEDVKREDILAYMRMLKVHQYAPTSASR 77

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           K++ ++ F+ F+  EG  +++PS+ +E   +  +LPK +  + +  L             
Sbjct: 78  KLAALKAFFRFMTAEGFLEEDPSEVVEAGTRGVVLPKVMSLEEVKQLFSAP-------DL 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q +  R   ++E++YATGMRVSEL++L   ++NL  R +I  GKG KERL+ L   A+ 
Sbjct: 131 TQPEGFRDRTMLEVMYATGMRVSELLSLKRASVNLETRYVIAYGKGAKERLIPLGQYAIQ 190

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y      + +           T  G    +     +          +K ++PHI+R
Sbjct: 191 YLKKYLAQVRPLFVKNGKDDDSLFLTIRGTGMTRQRFWQIIRAYGVKAGLQKPLTPHILR 250

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+H+L+ GADLRT+Q LLGH DISTTQIYTHL  ++L+K+    HP A
Sbjct: 251 HSFATHMLDNGADLRTVQELLGHADISTTQIYTHLTNNRLKKVFDKTHPRA 301


>gi|229117317|ref|ZP_04246695.1| Tyrosine recombinase xerC [Bacillus cereus Rock1-3]
 gi|228666217|gb|EEL21681.1| Tyrosine recombinase xerC [Bacillus cereus Rock1-3]
          Length = 302

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 101/294 (34%), Positives = 150/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 17  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E + +E     
Sbjct: 77  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEVSDME----- 131

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 132 --TPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 189

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          +              L+ +     L  L  +A +  + ISPH
Sbjct: 190 DALITYMENGRKQLANKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 248

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 249 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 302


>gi|316931928|ref|YP_004106910.1| tyrosine recombinase XerD [Rhodopseudomonas palustris DX-1]
 gi|315599642|gb|ADU42177.1| tyrosine recombinase XerD [Rhodopseudomonas palustris DX-1]
          Length = 327

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 134/298 (44%), Positives = 194/298 (65%), Gaps = 4/298 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++E+ +S NTL AY+RDL ++ +FL+ + +S+ AA T  L  YL  L +R   TSS  
Sbjct: 29  MIAAEQGASANTLDAYRRDLADLSHFLSRRRLSIGAADTAALRGYLADLDKRGFATSSVA 88

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +R  + FL  E +R D+P+  L  PK+   LPK L    +  LL  A+ EA+   
Sbjct: 89  RRLSALRHLFRFLLSERIRADDPAAILAGPKRGRSLPKVLSIADVDRLLACARQEADAAE 148

Query: 121 -PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              + +  R+  L+E+LYATG+RVSEL+ L         R ++++GKG+KERLV L+  A
Sbjct: 149 GAARLRAARLNCLLEVLYATGLRVSELMALPLSAARRDARIIVVRGKGDKERLVPLNAGA 208

Query: 180 LHALQMYKKTCSSMKMTGN---DLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
             A+  Y +  +++          WLFPS   +GHL+RQ FARDLK LAARAG+  + +S
Sbjct: 209 KQAMARYLEEVAAVAKDPKGASSKWLFPSFGDSGHLTRQHFARDLKDLAARAGLSPRLVS 268

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           PH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH++ ++L+ LV+D HPL+ +
Sbjct: 269 PHVLRHAFASHLLHNGADLRIVQTLLGHSDISTTQIYTHVVEERLKSLVRDLHPLSNR 326


>gi|168823065|ref|ZP_02835065.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|204927994|ref|ZP_03219194.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204322316|gb|EDZ07513.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205340622|gb|EDZ27386.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320087473|emb|CBY97238.1| Tyrosine recombinase xerD [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 298

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 112/291 (38%), Positives = 173/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L+++  +L+ A  + L + L    +     +S  R
Sbjct: 15  LWLERNLAENTLSAYRRDLSMVVAWLHHRGKTLATAQADDLQTLLAERVEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+  L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAMRRFFQHLYREKCREDDPSAQLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|152976197|ref|YP_001375714.1| site-specific tyrosine recombinase XerC [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152024949|gb|ABS22719.1| tyrosine recombinase XerC [Bacillus cytotoxicus NVH 391-98]
          Length = 299

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 148/294 (50%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYVDVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG R+DNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYREDNPFALASLPKKEWSIPKFLYAEELEKLFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE VTL    ++ +  T+++ GKG K+R +     A 
Sbjct: 127 TKTPLGQRNQALLELMYATGIRVSECVTLKLTDIDFSVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTK--TGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +          + +            L+ +     L  L  +  +  + ISPH
Sbjct: 187 DALITYIENGRKQLAKKTEEYSQMVFLNAKGVPLTDRGVRYILNELIKKTSLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ G+DLR +Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGSDLRAVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|226227913|ref|YP_002762019.1| tyrosine recombinase XerC [Gemmatimonas aurantiaca T-27]
 gi|226091104|dbj|BAH39549.1| tyrosine recombinase XerC [Gemmatimonas aurantiaca T-27]
          Length = 324

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 93/302 (30%), Positives = 153/302 (50%), Gaps = 14/302 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNK----EISLSAASTNHLISYLNHLSQRKLVTS 57
           +  ER  S NTL AY+RDL+E  ++L           +  +  ++  Y+ HL++R L   
Sbjct: 26  LEKERDLSPNTLQAYRRDLREFASWLAATHGIAGWEWNELTRTNIRGYMAHLTRRGLAKR 85

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           S  R++S +R FY ++  +     NP+  +  PK    LP  L +     L++ A   A+
Sbjct: 86  SIARQLSAVRSFYRWMHRDERVDVNPARAVGSPKLPRTLPAYLDRTQAETLMQHAATRAQ 145

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                ++  VR   ++EL Y++G+R+SEL  +    L+L  + + ++GKG KER+V L  
Sbjct: 146 ---SLEFTDVRNLAMLELFYSSGLRLSELRGVDLADLDLVSQQVKVRGKGRKERIVPLGD 202

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGI------- 230
            A  AL+ Y     ++    +   +     +      +  AR        A +       
Sbjct: 203 HAQRALRNYLVKRDALIAQASGGAVGRRVARGAVFLSERGARISARAVQHAMVTLMSAVS 262

Query: 231 QKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHP 290
           +  +++ H +RH FA+HL++ GADLR +Q LLGH  ISTTQIYTH   D+L+K+ +  HP
Sbjct: 263 EGADLTTHSLRHTFATHLVDAGADLRAVQELLGHASISTTQIYTHTSVDRLKKVYRQAHP 322

Query: 291 LA 292
            A
Sbjct: 323 RA 324


>gi|238787321|ref|ZP_04631120.1| Tyrosine recombinase xerD [Yersinia frederiksenii ATCC 33641]
 gi|238724583|gb|EEQ16224.1| Tyrosine recombinase xerD [Yersinia frederiksenii ATCC 33641]
          Length = 299

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL  +  +L +    L  A +  L S+L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLHALSGWLEHHGSDLLRAGSQDLQSFLAERIEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+P+  L  PK    LPK L +  +  LL    ++      
Sbjct: 76  LLSAMRRLFQYLYREKLREDDPTALLSSPKLPQRLPKDLSEAQVDALLNSPNVDI----- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 131 --PLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYMEHGRPWLINGQSLDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|85859051|ref|YP_461253.1| integrase/recombinase [Syntrophus aciditrophicus SB]
 gi|85722142|gb|ABC77085.1| integrase/recombinase [Syntrophus aciditrophicus SB]
          Length = 296

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 106/292 (36%), Positives = 167/292 (57%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ E+ +S NTL AY RDL      +  + I  +   S + +I Y+  L ++ L  +S  
Sbjct: 13  LTVEKGASHNTLEAYGRDLSRYSGLIQERGIKEIHEISPDDVIYYMAELKRKGLSANSIN 72

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ +R FY FL  E   + NP   +EL K    LP TL  + +  LL Q  +  ++  
Sbjct: 73  RSLAALRGFYKFLLREKKIEQNPVAEIELAKVWMRLPDTLSHEEMDQLLSQPGVRTDS-- 130

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++EL+YATG+RVSEL++L+  ++N     +++QGKGNKER+V +   A 
Sbjct: 131 -----AIRDTAMLELMYATGLRVSELISLTTGSINWQVGYLVVQGKGNKERIVPIGQVAY 185

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             ++ Y        + G    +   +     ++RQ F + ++  A +AG+QKK + PH  
Sbjct: 186 EHVRRYFDEVRPKCIRGAQTNVLFLNKSGQGMTRQGFWKLVRKYAVKAGLQKK-VHPHTF 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FASHLLEGGADLR++Q++LGH DISTTQIYTH+  + L+ + + YHP  
Sbjct: 245 RHSFASHLLEGGADLRSVQMMLGHADISTTQIYTHVTREHLKDIHKKYHPRG 296


>gi|85059971|ref|YP_455673.1| site-specific tyrosine recombinase XerD [Sodalis glossinidius str.
           'morsitans']
 gi|84780491|dbj|BAE75268.1| phage integrase [Sodalis glossinidius str. 'morsitans']
          Length = 299

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 104/291 (35%), Positives = 167/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL+ +  +L +++     AS+  L ++L          +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLQALSAWLQSQQRDSLNASSADLQAFLADRLDHGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R+F+ +L  E  R ++PS  +  PK    LPK L +  + +LL          A 
Sbjct: 76  LLSATRRFFQYLYREKRRGNDPSAGISAPKLPQRLPKDLSEAQVGDLLAAP-------AI 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKG+KERLV L   A++
Sbjct: 129 ADPVELRDKAMLEVLYATGLRVSELVGLTLSDVSLRQGVVRVIGKGDKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +        G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIEYYLEHGRPALTHGQSLDILFPSNRSRKMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ + Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQLLLGHSDLSTTQIYTHVATERLKLIHQQHHPRA 299


>gi|197104212|ref|YP_002129589.1| probable integrase/recombinase DNA recombination protein
           [Phenylobacterium zucineum HLK1]
 gi|196477632|gb|ACG77160.1| probable integrase/recombinase DNA recombination protein
           [Phenylobacterium zucineum HLK1]
          Length = 305

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 128/296 (43%), Positives = 179/296 (60%), Gaps = 7/296 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MM+ ERA++ NTLSAY RDL +   FL      LS A+   + +Y   L  R L  ++  
Sbjct: 15  MMAVERAAARNTLSAYGRDLADAAGFLAGLGRDLSDATAEDVEAYFADLGARGLSAATAA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R+ + +RQFY F+  EG R D+PS  +E PKK   LPK L ++ +  L+  A        
Sbjct: 75  RRRAAVRQFYRFVLGEGWRGDDPSRRVEAPKKGRSLPKVLSREEMDRLIAAAGARD---- 130

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            G    +R+  ++EL YA+G+R+SEL  L+   L      +I++GKG KERL  L+  A 
Sbjct: 131 -GASHALRLACMVELAYASGLRISELTGLTLAALARDPAYLIVKGKGGKERLAPLNEPAR 189

Query: 181 HALQMYKKTCSSMKMTGN--DLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            A++ Y +   +    G+  + WLFPS  K G L+ + FA+ L   AA AGI    +SPH
Sbjct: 190 AAVKAYLEVRPAFLPKGDTANPWLFPSRGKGGRLTPRRFAQLLDEAAADAGIDPGRVSPH 249

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           ++RHAFA+HLLEGGADLR +Q LLGH DI+TTQIYTH+  D+L ++V+  HPLAKK
Sbjct: 250 VLRHAFATHLLEGGADLRVVQKLLGHADIATTQIYTHVASDRLSEVVRSKHPLAKK 305


>gi|212638838|ref|YP_002315358.1| site-specific tyrosine recombinase XerD [Anoxybacillus flavithermus
           WK1]
 gi|212560318|gb|ACJ33373.1| Site-specific recombinase XerD [Anoxybacillus flavithermus WK1]
          Length = 300

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 101/295 (34%), Positives = 156/295 (52%), Gaps = 12/295 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           +  ER  + NT+ +Y+RDLK+   +L   E     +  +  H++ +L  L ++     + 
Sbjct: 14  LIVERNLAHNTIVSYERDLKKYVQYLQKVEQLCHWNDVTRFHIMQFLKFLKEKGSSPKTI 73

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R ++ +R F+ FL  E     +P+  +E P+    LP  L    +  LLE  K      
Sbjct: 74  ARHLASVRSFHQFLLREKAVDQDPTVHIETPQLPRKLPNVLSMAEVEALLEAPKQ----- 128

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATG+RVSEL+ L+   ++LT   +   GKG KER+V +   A
Sbjct: 129 --NTPFSIRDKAMLELLYATGIRVSELIQLNISDVHLTMGFIRCYGKGRKERIVPIGKMA 186

Query: 180 LHALQMYKKTCSS--MKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
             AL+ Y +      ++           +     L+RQ   + LK LA  A IQ K ++P
Sbjct: 187 TEALKRYIEQGRPELLQRKKGTTDALFLNHHGERLTRQGCWKILKRLAQEANIQ-KQLTP 245

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +L+ + + +HP A
Sbjct: 246 HTLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYKQFHPRA 300


>gi|257876556|ref|ZP_05656209.1| phage integrase [Enterococcus casseliflavus EC20]
 gi|257810722|gb|EEV39542.1| phage integrase [Enterococcus casseliflavus EC20]
          Length = 296

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 103/293 (35%), Positives = 164/293 (55%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NT ++Y+RDL++   FL  K+++         ++S+L  L +    +++  
Sbjct: 12  LTIERGLSQNTRASYQRDLQQYLAFLQKKQVTQWQQIDRVIVLSFLQSLQEAGKSSATVI 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R+F+ +L  E L   +P   ++ PKK   LP TL    +  L+E          
Sbjct: 72  RMVSSLRRFHQYLRQERLTDHDPMQHIDSPKKQQKLPDTLSLQEVERLIETP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++E++YATG+RVSEL+ L  + L+L+   +   GKG+KER+V L   A+
Sbjct: 125 TRAVLGIRDRAILEVMYATGLRVSELIGLKLNDLHLSMGLLQTTGKGDKERIVPLGDLAI 184

Query: 181 HALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             ++ Y       +     D      +     LSRQ   ++LKAL  +AGI  KN++PH 
Sbjct: 185 QWIETYLSDARPYLTRKTPDESHLFVNNHGTQLSRQGIWKNLKALVRQAGIT-KNVTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLRT+Q LLGH DISTTQIYTH+   ++ ++ + + P A
Sbjct: 244 LRHSFATHLLENGADLRTVQELLGHADISTTQIYTHITKKRMTEVYKQHFPRA 296


>gi|317493832|ref|ZP_07952249.1| tyrosine recombinase XerD [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918159|gb|EFV39501.1| tyrosine recombinase XerD [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 299

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 106/291 (36%), Positives = 166/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL+ +  +L +    L  A  + L  +L          +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLRSLAEWLAHHHSDLLLAQVSDLQDFLAERVDGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +   E +R D+P+  L  PK    LPK L +  +  LL+   IE      
Sbjct: 76  LLSAMRRLFQYFYREKMRSDDPTTLLSSPKLPQRLPKDLTEAQVDTLLQTPCIE------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -NPIELRDKAMLEVLYATGLRVSELVGLTLADVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  + +   S +T  ++RQ F   +K  A  AGI    +SPH++R
Sbjct: 189 WIEYYLEYGRPWLLNGQTIDVLFPSNRTQQMTRQTFWHRIKHYAVLAGIDSSRLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|262166461|ref|ZP_06034198.1| tyrosine recombinase XerD [Vibrio mimicus VM223]
 gi|262170635|ref|ZP_06038313.1| tyrosine recombinase XerD [Vibrio mimicus MB-451]
 gi|261891711|gb|EEY37697.1| tyrosine recombinase XerD [Vibrio mimicus MB-451]
 gi|262026177|gb|EEY44845.1| tyrosine recombinase XerD [Vibrio mimicus VM223]
          Length = 302

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 103/291 (35%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           M  ER  + NT+++Y+ DL ++  ++   +  L   S + L  Y + LS++    +S+ R
Sbjct: 19  MWLERGLAENTVASYRNDLSKLLEWMAQHQYRLDFISFSGLQEYQSWLSEQNYKPTSKAR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LL           P
Sbjct: 79  MLSAIRRLFQYLHREKVRADDPSALLISPKLPTRLPKDLTEAQVEALLSAP-------DP 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+ 
Sbjct: 132 QTPIELRDKAMLELLYATGLRVTELVSLTMENMSLRQGVVRVIGKGGKERLVPMGENAIE 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ + +   S+ +      +   S++   ++RQ F   +K  A  A I  + +SPH++R
Sbjct: 192 WIETFLQQGRSLLLGEQTSDIVFPSSRGQQMTRQTFWHRIKHYAVIAEIDVELLSPHVLR 251

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 252 HAFATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHNEHHPRA 302


>gi|157148431|ref|YP_001455750.1| site-specific tyrosine recombinase XerD [Citrobacter koseri ATCC
           BAA-895]
 gi|157085636|gb|ABV15314.1| hypothetical protein CKO_04256 [Citrobacter koseri ATCC BAA-895]
          Length = 298

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 171/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L+++  +L+   ++ L + L          +S  R
Sbjct: 15  LWLERNLAENTLSAYRRDLSMVVEWLHHRGKTLATVQSDDLQTLLAERMDGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R+F+  L  E  R+D+PS  L  PK    LPK L +  +  LL+   ++      
Sbjct: 75  LLSATRRFFQHLYREKFREDDPSAQLASPKLPQRLPKDLSEAQVERLLQSPVVD------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|281357422|ref|ZP_06243910.1| integrase family protein [Victivallis vadensis ATCC BAA-548]
 gi|281316025|gb|EFB00051.1| integrase family protein [Victivallis vadensis ATCC BAA-548]
          Length = 314

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 87/304 (28%), Positives = 154/304 (50%), Gaps = 13/304 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS---LSAASTNHLISYLNHLSQRKLVTSS 58
           +  ER +S +T+ AY+ D+ E    +   + S    S    N    +++ L +      S
Sbjct: 12  LRVERNASSHTVEAYRSDILEFLRRVMEADESFNAWSQVERNQARRFVSSLFEAGDSKRS 71

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
            +RK+S +R F+ ++    L  DNP   L   K +  LP  +  + I  L +      E 
Sbjct: 72  IQRKLSALRSFFRYMMRMELLGDNPFLKLPPIKADQPLPLVMSINQIDLLTKAVGEYWEM 131

Query: 119 PAPG---------QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNK 169
            A           ++   R   ++E++Y+ G+R+SE   L    ++L      ++GKG K
Sbjct: 132 AAANGISKSDEAAEFAAARDLAMVEVIYSGGLRISETTGLDMGDIDLIGGIARVRGKGKK 191

Query: 170 ERLVILSPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAG 229
           ER+ +L   +  AL+ Y K  S++            +     L+ + F R+LK     A 
Sbjct: 192 ERIAVLGRPSQKALRNYFKLRSTVGGGRAPGSPVFLNKFGKRLTPRSFQRNLKNYLIAAN 251

Query: 230 IQKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYH 289
           +   +++PH +RH+FA+HLL+ GADLR++Q +LGH ++STTQIYTH+  ++++++ ++ H
Sbjct: 252 L-PPDLTPHKLRHSFATHLLDAGADLRSVQEMLGHENLSTTQIYTHVSAERMKEVYKEAH 310

Query: 290 PLAK 293
           P AK
Sbjct: 311 PRAK 314


>gi|226313077|ref|YP_002772971.1| tyrosine recombinase [Brevibacillus brevis NBRC 100599]
 gi|226096025|dbj|BAH44467.1| probable tyrosine recombinase [Brevibacillus brevis NBRC 100599]
          Length = 314

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 96/292 (32%), Positives = 142/292 (48%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+ +S +T+  Y  D+ E  +F+   +I+  +A S  H  S+L  L+ R L   S  
Sbjct: 18  LRVEKNASPHTVKQYVADISEFVSFMEQHQITVFAAVSYLHGRSFLAQLAGRGLSRRSIA 77

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG  + NP   +  PK    LP  L+   +    +        P 
Sbjct: 78  RKLSSLRSLYRFLLREGQLEQNPFQLVSTPKMEKKLPSFLYPQEVQAFFD-------LPD 130

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R  L+ ELLYA+GMRV+EL TLS   +N +    ++ GKG KER V +   A 
Sbjct: 131 TTTPLGIRDRLIFELLYASGMRVTELTTLSVSDVNPSMGVALVYGKGAKERYVPVGSYAC 190

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y +      + G            G        R +          +  +SPH  
Sbjct: 191 DVLRQYLEHGREKLLAGKVEHGNLLVNYRGEPLSDRSVRRIVDKYVDTYALQLRVSPHTF 250

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH FA+H+L GGADLRT+Q LLGH ++STTQ+YTH+  ++L+ +    HP A
Sbjct: 251 RHTFATHMLNGGADLRTVQELLGHVNVSTTQVYTHVTKERLRHVYDTAHPRA 302


>gi|258593730|emb|CBE70071.1| Tyrosine recombinase xerD [NC10 bacterium 'Dutch sediment']
          Length = 295

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 99/292 (33%), Positives = 151/292 (51%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ E+  + N+L+AY RDL+ +  +     + S    S   +   L  L +  L   +  
Sbjct: 12  LAVEKGLAENSLAAYGRDLRRIVGYFKQGGVGSFREVSRGQVARLLLTLREAGLAPRTVS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R  S +R  Y +L  +   K++P+  LE       LP  L ++ +  LL           
Sbjct: 72  RHTSSLRGLYRYLLTQDHVKEDPTAHLESSSPWVRLPGVLSQEEVERLLAAP-------L 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++ELLYA G+RVSE+VTL    ++L    +  QGKG K+R+V L   A 
Sbjct: 125 TSNPLGLRDKAMLELLYAAGLRVSEMVTLRLSEVDLEVGYVHCQGKGGKDRVVPLGRDAQ 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A++ Y +T       G        +     L+RQ F + L+A A  AGI ++ ++PH +
Sbjct: 185 TAVRRYLETSRPYLQRGWSSSTLFLNRFGYPLTRQGFWKLLRAYAIAAGIDRR-VTPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q++LGH DISTTQIYTH+    L+ +   YHP A
Sbjct: 244 RHSFATHLLERGADLRAVQMMLGHADISTTQIYTHVSRAHLKTVYNRYHPRA 295


>gi|206901908|ref|YP_002251233.1| recombinase [Dictyoglomus thermophilum H-6-12]
 gi|206741011|gb|ACI20069.1| recombinase [Dictyoglomus thermophilum H-6-12]
          Length = 301

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 99/299 (33%), Positives = 149/299 (49%), Gaps = 14/299 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NTL +Y RDL +   +   K++  +  +  ++ SY+  ++Q+    S+  R
Sbjct: 16  LRFERNYSPNTLRSYSRDLMDFYKYCKEKDLDFT--NKRNVRSYIQFIAQKNYKNSTFVR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           K+  +R F+ +L       ++ +  +  PK    LP+ L  D +  LL          + 
Sbjct: 74  KVISLRSFFEYLLTFEKINEDLTVFIPTPKAEKKLPQFLSVDEVMKLLNSP-------SL 126

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   +IE LYATG+RVSELV ++   +N     + + GK  KER+VI+    L 
Sbjct: 127 DDLIGIRDRAIIETLYATGIRVSELVGMNEEDINWNYGEIRVFGKRAKERIVIVGEETLK 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            LQ+YK       +   +   F ++       R +     K          K +SPH +R
Sbjct: 187 ILQLYKDHVRPKLLKKPEKAFFLNAKGGRISDRAIRMIIKKYTKDF----NKKVSPHTLR 242

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA-KKEKKHY 299
           H FA+HLLEGGADLR +Q LLGH  ISTTQIYTHL  ++++K     HP A KKE K  
Sbjct: 243 HTFATHLLEGGADLRYVQELLGHVRISTTQIYTHLTSEQIRKTYTLSHPRAIKKETKEE 301


>gi|119503715|ref|ZP_01625797.1| site-specific tyrosine recombinase XerC [marine gamma
           proteobacterium HTCC2080]
 gi|119460223|gb|EAW41316.1| site-specific tyrosine recombinase XerC [marine gamma
           proteobacterium HTCC2080]
          Length = 304

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 92/301 (30%), Positives = 156/301 (51%), Gaps = 13/301 (4%)

Query: 1   MMSSER---ASSINTLSAYKRDLKEMQNFLN-NKEISLSAASTNHLISYLNHLSQRKLVT 56
            ++ +R     S +TL  Y RD++   +F   + + S ++   + + ++++ L ++ L  
Sbjct: 12  FLAYQRDIRQVSRHTLEGYGRDIRRFVSFCAVSNKQSATSVRESDVRNWVSQLHRQGLSP 71

Query: 57  SSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEA 116
           +S +R +S +R  Y FL    +   NP+  ++ PK+   LPKTL  D++ +L +      
Sbjct: 72  TSIQRALSSVRSLYRFLSERDVTLGNPALGVQAPKRPRNLPKTLDADSVNHLFQ------ 125

Query: 117 ENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILS 176
               P      R   + ELLY++G+R+SELV+ + + L   ER + + GKG K R + + 
Sbjct: 126 --WQPETTLDFRDMAIAELLYSSGLRLSELVSANINDLEFNERMITVTGKGRKTRTLPVG 183

Query: 177 PSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
             AL A+  +                   S +   +S +     L+ +A  + +  K + 
Sbjct: 184 GPALTAVTKWLSLRPLGNEDVGPASPLFVSARGTRISPRSVQLRLQRMARFSALPGK-LH 242

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH++RH+FASH+LE   DLR +Q LLGH+DISTTQIYTHL    L K+    HP A+++ 
Sbjct: 243 PHMLRHSFASHMLESSGDLRAVQELLGHSDISTTQIYTHLDFQHLSKVYDAAHPRARRKN 302

Query: 297 K 297
           K
Sbjct: 303 K 303


>gi|126650133|ref|ZP_01722366.1| site-specific tyrosine recombinase XerD [Bacillus sp. B14905]
 gi|126593305|gb|EAZ87267.1| site-specific tyrosine recombinase XerD [Bacillus sp. B14905]
          Length = 300

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 104/295 (35%), Positives = 161/295 (54%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S+NTL++Y+RDL+   NFL N E     +      ++ +L  L  +   + +
Sbjct: 14  FIQVERQLSVNTLASYRRDLESYVNFLQNAEGMADFNRVERTTILRHLEQLRAQGKTSRT 73

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R IS IR F+ FL  E   + +P+  LE+P     LP  L  + I  LL         
Sbjct: 74  IARHISSIRSFHQFLLREKRAESDPTVHLEMPTIEQKLPNILSIEEIEALLTAPN----- 128

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
               + + +R   ++ELLY +GMR+SEL+ L    ++LT   + + GKG KER++ L  S
Sbjct: 129 --RSKPQGIRDLAMLELLYGSGMRISELIALDLADIHLTMGFVRVFGKGGKERIIPLGKS 186

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           AL A+  Y       ++        F  + +   L+RQ   + +K  A +AGIQ + ++P
Sbjct: 187 ALSAISTYLNNARGQLQGKYPKTDAFFINQRGKRLTRQGCWKLMKEHALKAGIQHE-LTP 245

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HL+E GADLR +Q +LGH DISTTQIYTH+   +L ++ + +HP A
Sbjct: 246 HTLRHSFATHLVENGADLRAVQEMLGHADISTTQIYTHISKTRLSEVYKQFHPRA 300


>gi|260599234|ref|YP_003211805.1| site-specific tyrosine recombinase XerD [Cronobacter turicensis
           z3032]
 gi|260218411|emb|CBA33498.1| Tyrosine recombinase xerD [Cronobacter turicensis z3032]
          Length = 298

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 171/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + N+LSAY+RDL  +  +L+++ +SL+   +  L + L    +     +S  R
Sbjct: 15  LWLERNLAENSLSAYRRDLSMVVEWLHHRGLSLATVQSGDLQTLLAERVEGGYKATSTAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ +  L  E +R D+PS  L  PK    LPK L +  +  LL+   +E      
Sbjct: 75  MLSAVRRLFQHLYREKIRDDDPSALLASPKLPQRLPKDLSEAQVDRLLQAPTVE------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -EPIELRDKAMLEVLYATGLRVSELVGLTMSDVSLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y        + G  L +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WVEQYLTHGRPWLLNGQSLDILFPSNRARQMTRQTFWHRIKHYAQLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|84393959|ref|ZP_00992699.1| tyrosine recombinase [Vibrio splendidus 12B01]
 gi|84375403|gb|EAP92310.1| tyrosine recombinase [Vibrio splendidus 12B01]
          Length = 304

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 164/288 (56%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL +Y+ DL ++  ++      L   S + L  Y   L+      +S+ R +S
Sbjct: 24  ERGLSENTLVSYRTDLSKLLTWMEKNNYRLDFISLSGLQDYQGWLADADFKQTSRARMLS 83

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK L ++ +  LLE          P   
Sbjct: 84  AIRRLFQYLHREKVRGDDPSALLISPKLPQRLPKDLSEEQVNALLEAP-------DPNDP 136

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 137 IELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVIGKGGKERLVPMGENAVDWIE 196

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +      +  N   +   S +   ++RQ F   +K  +  AGI  + +SPH++RHAF
Sbjct: 197 TFIEQGRPQLLGENSSDVVFPSKRAKQMTRQTFWYRIKHYSVVAGIDTELLSPHVLRHAF 256

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+++   +HP A
Sbjct: 257 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQIHAQHHPRA 304


>gi|23099302|ref|NP_692768.1| integrase:recombinase [Oceanobacillus iheyensis HTE831]
 gi|34222800|sp|Q7ZAM3|XERD_OCEIH RecName: Full=Tyrosine recombinase xerD
 gi|22777531|dbj|BAC13803.1| integrase : recombinase [Oceanobacillus iheyensis HTE831]
          Length = 297

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 105/294 (35%), Positives = 154/294 (52%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS--LSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S NTLS+YKRDL     ++ + + +      S   ++ +L  L  +   T++
Sbjct: 12  FLRIERGLSDNTLSSYKRDLTNYLQYMKDHDKTATWDKISRTDIMGFLYMLKDQGKSTAT 71

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R IS IR F+ FL  E +  ++PS  +E PKK+  LP  L +D +  LLE        
Sbjct: 72  ISRHISSIRSFHQFLIREQITSNDPSLHIETPKKDRKLPDILSQDEVDRLLE-------- 123

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   VR   ++ELLYATG+RVSEL++L+   L+L    +   GKG+KER+V L  +
Sbjct: 124 IKMNTKLSVRNKAMLELLYATGLRVSELISLNVSDLHLMMGFVQCFGKGSKERIVPLGDT 183

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A H L+ Y        +  N+        + G    +     +           K I+PH
Sbjct: 184 AKHYLEKYISEARDSLIKKNNREDALFVNQHGRRLTRQGFWKILKGLTLEAGILKTITPH 243

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLE GADLR +Q +LGH DISTTQ+YTH+   +L+ + Q YHP A
Sbjct: 244 TLRHSFATHLLENGADLRLVQEMLGHADISTTQVYTHVTKARLKDMYQSYHPRA 297


>gi|257867648|ref|ZP_05647301.1| phage integrase [Enterococcus casseliflavus EC30]
 gi|257873977|ref|ZP_05653630.1| phage integrase [Enterococcus casseliflavus EC10]
 gi|257801731|gb|EEV30634.1| phage integrase [Enterococcus casseliflavus EC30]
 gi|257808141|gb|EEV36963.1| phage integrase [Enterococcus casseliflavus EC10]
          Length = 296

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 103/293 (35%), Positives = 163/293 (55%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NT ++Y+RDL++   FL  K+++         ++S+L  L      +++  
Sbjct: 12  LTIERGLSQNTRASYQRDLQQYLAFLQKKQVTQWQQIDRVIVLSFLQSLQDAGKSSATVI 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R+F+ +L  E L   +P   ++ PKK   LP TL    +  L+E          
Sbjct: 72  RMVSSLRRFHQYLRQERLTDHDPMQHIDSPKKQQKLPDTLSLQEVERLIETP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++E++YATG+RVSEL+ L  + L+L+   +   GKG+KER+V L   A+
Sbjct: 125 TRAVLGIRDRAILEVMYATGLRVSELIGLKLNDLHLSMGLLQTTGKGDKERIVPLGDLAI 184

Query: 181 HALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             ++ Y       +     D      +     LSRQ   ++LKAL  +AGI  KN++PH 
Sbjct: 185 QWIETYLSDARPYLTRKTPDESHLFVNNHGTQLSRQGIWKNLKALVRQAGIT-KNVTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLRT+Q LLGH DISTTQIYTH+   ++ ++ + + P A
Sbjct: 244 LRHSFATHLLENGADLRTVQELLGHADISTTQIYTHITKKRMTEVYKQHFPRA 296


>gi|255026410|ref|ZP_05298396.1| hypothetical protein LmonocytFSL_08880 [Listeria monocytogenes FSL
           J2-003]
          Length = 290

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 96/288 (33%), Positives = 155/288 (53%), Gaps = 11/288 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S NT+ AY+RDL    ++++   +    +    + ++ ++    Q      S
Sbjct: 11  FLIVERGLSANTIKAYERDLHYFVSYMDVTKELTDPNTLERSDIVGFMAFARQEGKSPRS 70

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R I+ +R F+++L ++G    +P   +E PK+   LPK L+ D +  LL         
Sbjct: 71  VARYIASLRSFFHYLMHDGKMSHDPMIQIETPKQAKGLPKVLNLDDVEKLLSS------- 123

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E+LYATG+RV+ELV+L    L+L    +   GKG+KER++ L  +
Sbjct: 124 SDTSTPLGLRDQAMMEILYATGLRVTELVSLKMDDLHLHMGFIQTIGKGDKERIIPLGKT 183

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A   L+ Y +     ++           +     L+RQ F + LK +A  +GI+K  I+P
Sbjct: 184 ATTVLEKYLEEARPKLRRPKYRNDFVFLNHHGQGLTRQGFWKILKGIAKESGIEKP-ITP 242

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLV 285
           H +RH+FA+HLLE GADLR++Q LLGH DISTTQIYTH+   +L+ + 
Sbjct: 243 HTLRHSFATHLLENGADLRSVQELLGHADISTTQIYTHVTKLRLKDVY 290


>gi|261345596|ref|ZP_05973240.1| tyrosine recombinase XerD [Providencia rustigianii DSM 4541]
 gi|282566076|gb|EFB71611.1| tyrosine recombinase XerD [Providencia rustigianii DSM 4541]
          Length = 300

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 97/288 (33%), Positives = 164/288 (56%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           E+  + NTL++Y+ DL+ +  +L+ +++ L    +  L S+L          +S  R +S
Sbjct: 20  EQDLAENTLASYRNDLQSLDRWLDAQQLHLENVQSIDLQSFLAERIDSGYKAASSARLLS 79

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            +R+ + +L  E +R D+PS  +  PK    LPK L +  + +LL          A    
Sbjct: 80  AMRRLFQYLYREKIRLDDPSAVIAAPKIPQRLPKDLSEKQVEDLLNAP-------ATEDS 132

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++E+LYA G+RVSEL+ L+   ++L +  + + GKG+KERL+ L   A++ ++
Sbjct: 133 LELRDKAMLEVLYACGLRVSELIGLTFSDISLRQGVIRVVGKGDKERLIPLGEEAIYWVE 192

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            Y +      + G    +   S +   ++RQ F   +K  A  A I  +++SPH++RHAF
Sbjct: 193 KYLEYGRPDLLNGKASDVLFPSKRGTKMTRQTFWHRIKYYAVLANIDGESLSPHVLRHAF 252

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L + +HP  
Sbjct: 253 ATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRTLHEQHHPRG 300


>gi|289432900|ref|YP_003462773.1| tyrosine recombinase XerD [Dehalococcoides sp. GT]
 gi|288946620|gb|ADC74317.1| tyrosine recombinase XerD [Dehalococcoides sp. GT]
          Length = 302

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 99/298 (33%), Positives = 159/298 (53%), Gaps = 13/298 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS------LSAASTNHLISYLNHLSQRKLV 55
           +  E+  S NT  AY+ DL++M  F + +             +   +++Y+  L +R   
Sbjct: 12  LMVEKGFSENTSEAYENDLRQMTTFADKEAAKSGKIPGWDNFTRQTMLAYMLDLKERNYA 71

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
            ++  RK++  + F+NF+  EG  K+NP++ +  PK    LP  +    +  LL Q    
Sbjct: 72  ITTVVRKMAAAKSFFNFMVAEGKLKENPTENISTPKVGKPLPDAISISQVRALLNQPVKS 131

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
             + A       R   ++ELLYA+GMRV+ELV L+   ++L E  +   GKG KER++ +
Sbjct: 132 GSSEAK------RDKAMLELLYASGMRVTELVNLNMLDVDLKEGFVRCFGKGRKERMIPI 185

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
            P A  ++Q Y        +          + +   L+RQ   + LKA A  AG+    +
Sbjct: 186 YPQAAQSVQEYLNEIRPNLVRAEAEKALFLNRRGDRLTRQGLWQILKAYAREAGLDD-VV 244

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           +PH +RH+FA+H+L GGADLR++Q LLGH +ISTTQIYTHL  + +++  +  HP AK
Sbjct: 245 TPHTLRHSFATHMLSGGADLRSVQELLGHANISTTQIYTHLTSEHIRRSYEKAHPRAK 302


>gi|88706916|ref|ZP_01104615.1| Tyrosine recombinase xerD [Congregibacter litoralis KT71]
 gi|88698838|gb|EAQ95958.1| Tyrosine recombinase xerD [Congregibacter litoralis KT71]
          Length = 302

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 107/288 (37%), Positives = 162/288 (56%), Gaps = 8/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           E+  S NTL+AY+RDL+    +  +++ + +    + + +YL  L ++K    S  R +S
Sbjct: 23  EKGLSENTLAAYRRDLQAFARWALSRQRTATQIERSDIEAYLASLLEKKSSPRSAARALS 82

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            +R FY +L   G    +P+  L+ P+    LPKTL +  +  LL+  K++         
Sbjct: 83  CLRGFYRYLLRSGQLDTDPTLGLDSPRLGRPLPKTLSEVDVDALLKAPKLD-------DP 135

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
              R   ++ELLYA G+RVSEL  L+   L+L +  + I GKG KERLV +   ALH LQ
Sbjct: 136 IGFRDRCMLELLYACGLRVSELTGLTLSQLSLNQGVLRIVGKGGKERLVPIGEEALHWLQ 195

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +      +      +   S +   ++RQ F   +K  A  AGI+K  ISPH++RHAF
Sbjct: 196 RFLRDVRPELLGETSSDVLFPSRRAREMTRQTFWHRIKQHAMTAGIRKP-ISPHVLRHAF 254

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HL+  GADLR +Q+LLGH+D+STTQIYTH+   +LQ L   +HP  
Sbjct: 255 ATHLVNHGADLRVVQLLLGHSDLSTTQIYTHVARQRLQSLHAKHHPRG 302


>gi|331654392|ref|ZP_08355392.1| tyrosine recombinase XerD [Escherichia coli M718]
 gi|331047774|gb|EGI19851.1| tyrosine recombinase XerD [Escherichia coli M718]
          Length = 298

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 174/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A  + L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQCDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|238752994|ref|ZP_04614453.1| Tyrosine recombinase xerD [Yersinia rohdei ATCC 43380]
 gi|238708782|gb|EEQ01041.1| Tyrosine recombinase xerD [Yersinia rohdei ATCC 43380]
          Length = 299

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL  +  +L +    L  A +  L S+L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLHALTGWLEHNGSDLLRAGSQDLQSFLAERIEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+P+  L  PK    LPK L +  +  LL    ++      
Sbjct: 76  LLSAMRRLFQYLYREKLREDDPTALLSSPKLPQRLPKDLSEAQVDALLNSPNVDI----- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 131 --PLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G+ L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYMEHGRPWLINGHSLDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|229180107|ref|ZP_04307451.1| Tyrosine recombinase xerC [Bacillus cereus 172560W]
 gi|228603316|gb|EEK60793.1| Tyrosine recombinase xerC [Bacillus cereus 172560W]
          Length = 299

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 151/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMKREGISSFLDVTYADVRLYLTMLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSMK--MTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            +L  Y +         T  D  +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DSLITYIENGRKQLVNKTDEDSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|16761825|ref|NP_457442.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16766345|ref|NP_461960.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29143312|ref|NP_806654.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|62181554|ref|YP_217971.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161615991|ref|YP_001589956.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167550072|ref|ZP_02343829.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167994107|ref|ZP_02575199.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168231149|ref|ZP_02656207.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168236103|ref|ZP_02661161.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168261794|ref|ZP_02683767.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168463788|ref|ZP_02697705.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194446221|ref|YP_002042295.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194470177|ref|ZP_03076161.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194471635|ref|ZP_03077619.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194738371|ref|YP_002115993.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197249597|ref|YP_002147956.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265258|ref|ZP_03165332.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198244272|ref|YP_002217021.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200387943|ref|ZP_03214555.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205353968|ref|YP_002227769.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858307|ref|YP_002244958.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213051988|ref|ZP_03344866.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213425823|ref|ZP_03358573.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213646964|ref|ZP_03377017.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213857737|ref|ZP_03384708.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|224584833|ref|YP_002638631.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238909843|ref|ZP_04653680.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|60416276|sp|P0A2P6|XERD_SALTY RecName: Full=Tyrosine recombinase xerD
 gi|60416277|sp|P0A2P7|XERD_SALTI RecName: Full=Tyrosine recombinase xerD
 gi|25299270|pir||AB0872 site-specific integrase/recombinase [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16421595|gb|AAL21919.1| site-specific recombinase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16504127|emb|CAD02874.1| site-specific integrase/recombinase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29138946|gb|AAO70514.1| site-specific integrase/recombinase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|62129187|gb|AAX66890.1| recombinase, site-specific [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161365355|gb|ABX69123.1| hypothetical protein SPAB_03791 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404884|gb|ACF65106.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194456541|gb|EDX45380.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194457999|gb|EDX46838.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194713873|gb|ACF93094.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195633587|gb|EDX52001.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197213300|gb|ACH50697.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197243513|gb|EDY26133.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197290855|gb|EDY30209.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197938788|gb|ACH76121.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199605041|gb|EDZ03586.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205273749|emb|CAR38744.1| site-specific integrase/recombinase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205324693|gb|EDZ12532.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205327977|gb|EDZ14741.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205334414|gb|EDZ21178.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205349044|gb|EDZ35675.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710110|emb|CAR34465.1| site-specific integrase/recombinase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224469360|gb|ACN47190.1| tyrosine recombinase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|261248176|emb|CBG26012.1| Tyrosine recombinase xerD [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995198|gb|ACY90083.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159600|emb|CBW19119.1| Tyrosine recombinase xerD [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914065|dbj|BAJ38039.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321225719|gb|EFX50773.1| Tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322613442|gb|EFY10383.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322621034|gb|EFY17892.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322624098|gb|EFY20932.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322628163|gb|EFY24952.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322633282|gb|EFY30024.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636140|gb|EFY32848.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322639478|gb|EFY36166.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647589|gb|EFY44078.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648773|gb|EFY45220.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653828|gb|EFY50154.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657934|gb|EFY54202.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322664037|gb|EFY60236.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668952|gb|EFY65103.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673054|gb|EFY69161.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322677955|gb|EFY74018.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322681131|gb|EFY77164.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687939|gb|EFY83906.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322716035|gb|EFZ07606.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323131400|gb|ADX18830.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323194865|gb|EFZ80052.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323196616|gb|EFZ81764.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202684|gb|EFZ87724.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207829|gb|EFZ92775.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323212619|gb|EFZ97436.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323214898|gb|EFZ99646.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222629|gb|EGA06994.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225092|gb|EGA09344.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230614|gb|EGA14732.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235035|gb|EGA19121.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323239074|gb|EGA23124.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244568|gb|EGA28574.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247183|gb|EGA31149.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253334|gb|EGA37163.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323256359|gb|EGA40095.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262465|gb|EGA46021.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323267439|gb|EGA50923.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269157|gb|EGA52612.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326624789|gb|EGE31134.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326629082|gb|EGE35425.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332989911|gb|AEF08894.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 298

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 112/291 (38%), Positives = 173/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L+++  +L+ A  + L + L    +     +S  R
Sbjct: 15  LWLERNLAENTLSAYRRDLSMVVAWLHHRGKTLATAQADDLQTLLAERVEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+  L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAMRRFFQHLYREKYREDDPSAQLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|86139973|ref|ZP_01058538.1| tyrosine recombinase XerD [Roseobacter sp. MED193]
 gi|85823391|gb|EAQ43601.1| tyrosine recombinase XerD [Roseobacter sp. MED193]
          Length = 328

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 123/315 (39%), Positives = 181/315 (57%), Gaps = 19/315 (6%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +   ++E  ++ NTL AY RDLK+  ++L + +   S A+   + +YL   +   L  +
Sbjct: 14  FLDAQAAELGAARNTLLAYGRDLKDAASWLAHHDNRFSEAAREDIEAYLISCNAEGLSRA 73

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           ++ R++S +RQ Y+F   EG R DNP+  ++ P +   LPKTL    +  LL+ A+    
Sbjct: 74  TRARRLSALRQLYHFAFEEGWRSDNPAIQIKGPGRAKTLPKTLEVIEVDRLLDAARQTGR 133

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
            PA     R+R   L+ELLYATGMRVSEL++L           +++QGKG KER+V LSP
Sbjct: 134 KPAD----RLRNTCLMELLYATGMRVSELMSLPVAAARGDPNMLLVQGKGGKERMVPLSP 189

Query: 178 SALHALQMYKKTCSSM------KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ 231
            A  AL+ +             K      +LFPS  K GHL+R  F   +K LA   G+ 
Sbjct: 190 PAREALRAWLMQRDEADEDSQAKGNPGSKFLFPSRGKEGHLTRHWFYLLIKDLAVTGGVD 249

Query: 232 KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
            K ++PH +RHAFA+HLL  GADLR IQ LLGH DI+TT+IYTH+L  +L +LV  +HPL
Sbjct: 250 PKKVTPHTLRHAFATHLLANGADLRAIQALLGHADIATTEIYTHVLDARLSELVLQHHPL 309

Query: 292 AK------KEKKHYN 300
           ++      + K++ +
Sbjct: 310 SREGEARQRLKENDD 324


>gi|238759282|ref|ZP_04620448.1| Tyrosine recombinase xerD [Yersinia aldovae ATCC 35236]
 gi|238702443|gb|EEP94994.1| Tyrosine recombinase xerD [Yersinia aldovae ATCC 35236]
          Length = 299

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 167/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL  +  +L      L  A    L S+L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLHALTGWLECHGSDLLRAVPQDLQSFLAERIEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+P+  L  PK    LPK L +  +  LL    ++      
Sbjct: 76  LLSAMRRLFQYLYREKLREDDPTALLSSPKLPQRLPKDLSEAQVDALLNSPNVDI----- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 131 --PLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYMEHGRPWLINGQSLDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|229174497|ref|ZP_04302029.1| Tyrosine recombinase xerC [Bacillus cereus MM3]
 gi|228609057|gb|EEK66347.1| Tyrosine recombinase xerC [Bacillus cereus MM3]
          Length = 299

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 152/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E A  E     
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEVADTE----- 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 129 --TPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSM--KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +         T     +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DALITYIENGRKQLAHKTEEHSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|327183467|gb|AEA31914.1| tyrosine recombinase xerD [Lactobacillus amylovorus GRL 1118]
          Length = 301

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 167/291 (57%), Gaps = 10/291 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT+SAY++DL+E  +F+  + +S      + + ++L         TSS  R 
Sbjct: 18  QVERGLSTNTISAYRQDLEEYLSFIKKEGVSSWPTEASDVDAFLARQRDLNKATSSISRL 77

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           IS +R+FY +L  + ++K NP   ++LPKK   LP  L ++ +  LLEQ  +E       
Sbjct: 78  ISSMRKFYQWLARQNIQKLNPMLEIDLPKKERRLPTALSREEVNRLLEQPDVE------- 130

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
           Q   +R   ++E LYATGMRVSEL+ L    ++     + + GKG+KERL+ +SP ALH 
Sbjct: 131 QKLGLRDRAILETLYATGMRVSELINLELQDIHEDLGLIRVLGKGSKERLIPISPVALHW 190

Query: 183 LQMYKKTCSS--MKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           +  Y+K      +  +G +      + + G L+RQ   + +K     AGI  K+++PH +
Sbjct: 191 IDKYQKQVRDPLILKSGKNDEHLFLNNRGGKLTRQAIWQMIKKYCQMAGIT-KDVTPHTL 249

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           RH FA+HLLE GADLR +Q +LGH+DISTTQIYT+L    + ++ Q  HP 
Sbjct: 250 RHTFATHLLENGADLRVVQEILGHSDISTTQIYTNLSQKHILQVYQKTHPR 300


>gi|73748904|ref|YP_308143.1| tyrosine recombinase XerD [Dehalococcoides sp. CBDB1]
 gi|147669665|ref|YP_001214483.1| tyrosine recombinase XerD subunit [Dehalococcoides sp. BAV1]
 gi|73660620|emb|CAI83227.1| tyrosine recombinase XerD [Dehalococcoides sp. CBDB1]
 gi|146270613|gb|ABQ17605.1| tyrosine recombinase XerD subunit [Dehalococcoides sp. BAV1]
          Length = 302

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 99/298 (33%), Positives = 159/298 (53%), Gaps = 13/298 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS------LSAASTNHLISYLNHLSQRKLV 55
           +  E+  S NT  AY+ DL++M  F + +             +   +++Y+  L +R   
Sbjct: 12  LMVEKGFSENTSEAYENDLRQMTTFADKEAAKSGKIPGWDNFTRQTMLAYMLDLKERNYA 71

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
            ++  RK++  + F+NF+  EG  K+NP++ +  PK    LP  +    +  LL Q    
Sbjct: 72  ITTVVRKMAAAKSFFNFMVAEGKLKENPTENISTPKVGKPLPDAISISQVRALLNQPIKS 131

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
             + A       R   ++ELLYA+GMRV+ELV L+   ++L E  +   GKG KER++ +
Sbjct: 132 GSSEAK------RDKAMLELLYASGMRVTELVNLNMLDVDLKEGFVRCFGKGRKERMIPI 185

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
            P A  ++Q Y        +          + +   L+RQ   + LKA A  AG+    +
Sbjct: 186 YPQAAQSVQEYLNEIRPNLVRAEAEKALFLNRRGDRLTRQGLWQILKAYAREAGLDD-VV 244

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           +PH +RH+FA+H+L GGADLR++Q LLGH +ISTTQIYTHL  + +++  +  HP AK
Sbjct: 245 TPHTLRHSFATHMLSGGADLRSVQELLGHANISTTQIYTHLTSEHIRRSYEKAHPRAK 302


>gi|291280177|ref|YP_003497012.1| tyrosine recombinase [Deferribacter desulfuricans SSM1]
 gi|290754879|dbj|BAI81256.1| tyrosine recombinase [Deferribacter desulfuricans SSM1]
          Length = 302

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 97/297 (32%), Positives = 149/297 (50%), Gaps = 9/297 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           + SER  S NT+ +Y  DL ++ +F+ +++ SL       L  ++ +L  +    SS  R
Sbjct: 14  LISERQVSSNTVKSYLNDLNDLVSFIKDEDKSLKEIDYFALRMFVAYLYDKGFSKSSIER 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           KI+ +R F+ FL   GL +DNP+  ++        PK   K      ++      E P  
Sbjct: 74  KIATLRSFFKFLIKRGLIEDNPARMIKF-------PKKDKKLFTVFDIDTIFSLLELPDK 126

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R  L++E LY TG+RVSELV +    ++     + I GKG K R++ LS   + 
Sbjct: 127 ETPSGIRDALILEFLYGTGVRVSELVNIKLDDIDFGGMRVRIFGKGKKMRVIPLSDYIMD 186

Query: 182 ALQMYKKTCSSMKMTGN-DLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            ++ Y     ++   G  +      +     L+ +   R +     +AG+   N SPH  
Sbjct: 187 LIKKYLSVRENIVQKGIVNTDHLFINKFGTALTDRSVRRIVDKYLKKAGLPL-NYSPHSF 245

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           RH FA+HLLE GADLRTIQ LLGH+ ++TTQ YTHL   ++ K+    HP  K E K
Sbjct: 246 RHTFATHLLENGADLRTIQKLLGHSSLATTQKYTHLNLSEILKVYDKTHPYGKGELK 302


>gi|315500433|ref|YP_004089236.1| integrase family protein [Asticcacaulis excentricus CB 48]
 gi|315418445|gb|ADU15085.1| integrase family protein [Asticcacaulis excentricus CB 48]
          Length = 304

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 115/297 (38%), Positives = 169/297 (56%), Gaps = 8/297 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+S ER +S  T  AY  DL +++N        L   +   +  +   L  R L +S+ +
Sbjct: 12  MLSVERNASPRTREAYGHDLLDLRNHAGIDADGLLTLNEGDIAGFFAALDARGLASSTLQ 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK + +RQFY F   EGL  ++PS  +   KK   LPK L +  +  L+  A  +  + A
Sbjct: 72  RKRAAVRQFYRFCVREGLSDNDPSRKIAAAKKGRPLPKILSRQEVDALIAAADAKDAHQA 131

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R+  LIE+ YA+GMRVSE+V L    +      +I++GKG  ERLV L+PSA 
Sbjct: 132 T------RLQCLIEIAYASGMRVSEIVALRLDAVQKDPAYLIVKGKGGTERLVPLNPSAR 185

Query: 181 HALQMYKKTCSSMKMTGN--DLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            A++ Y           +  + +LF S    GHL+R+   + L   A  AGI    +SPH
Sbjct: 186 AAIKDYLDIRPLFLNAKDKANPYLFCSRGAEGHLTRRRVGQLLDEAALEAGIDPARVSPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           ++RHAFA+HLLEGGADLR +Q LLGH DISTTQ+YTH+  ++L+++V+ +HPL+K+ 
Sbjct: 246 VLRHAFATHLLEGGADLRVVQTLLGHADISTTQVYTHVATERLKEVVETHHPLSKRR 302


>gi|73662825|ref|YP_301606.1| integrase recombinase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82582337|sp|Q49X37|XERC_STAS1 RecName: Full=Tyrosine recombinase xerC
 gi|72495340|dbj|BAE18661.1| putative integrase recombinase [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 296

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 98/296 (33%), Positives = 158/296 (53%), Gaps = 10/296 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  E+  S +TL +Y  DL++   FL  + + L+A       +YL++L  + L  +S  
Sbjct: 11  MLKVEKQFSEHTLKSYHDDLEQFNVFLAQEHLDLNAFEYKDARNYLSYLYSKNLKRTSVS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY +   +     NP   L  PKK H LP   +++ +  L +  + +A+   
Sbjct: 71  RKISTLRSFYEYWMTQDEAVVNPFIQLVHPKKEHYLPHFFYEEEMEALFDTVENDAK--- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  +++ELLY+TG+RVSELV +    +++T   + + GKG KER +       
Sbjct: 128 ----KGLRDRVILELLYSTGIRVSELVHIKEQDIDMTSPGVKVLGKGGKERFIPFGEFCK 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y  +    K+  N  +L  +        R V       +   AG+ +  I PH +
Sbjct: 184 QSMERYLAS-FKPKLNSNHDYLLVNMKGDPITERGVRYVLNDVVKRTAGVTE--IHPHKL 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           RH FA+H+L  GADLRT+Q LLGH ++STT  YTH+  ++L+K+  + HP AKKE 
Sbjct: 241 RHTFATHMLNQGADLRTVQSLLGHVNLSTTGRYTHVTNEQLRKVYLNAHPRAKKEN 296


>gi|257898863|ref|ZP_05678516.1| phage integrase [Enterococcus faecium Com15]
 gi|293570233|ref|ZP_06681302.1| tyrosine recombinase XerD [Enterococcus faecium E980]
 gi|257836775|gb|EEV61849.1| phage integrase [Enterococcus faecium Com15]
 gi|291609640|gb|EFF38901.1| tyrosine recombinase XerD [Enterococcus faecium E980]
          Length = 295

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 103/292 (35%), Positives = 160/292 (54%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  S NT  +Y+RDL++  +FL  +++ S        +I +L  + + K  T++  
Sbjct: 12  LNIERGLSANTRQSYERDLEQYLHFLEEQKVASWQDVDRFLVIRFLEKMHEEKKATATVT 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R+F+ FL  E +   +P   ++ PKK   LP TL    +  L+E          
Sbjct: 72  RMISSLRRFHQFLRQERITDHDPMQHIDTPKKAQKLPSTLTLAEVEKLIEAP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATGMRVSEL+ L    L+L+   +   GKG+KER++ L   A+
Sbjct: 125 TTKTLGIRDRAILEVMYATGMRVSELIGLKLGDLHLSLGLVQTVGKGDKERIIPLGDYAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y      + +          +     LSRQ   ++LK L   AGI  K ++PH +
Sbjct: 185 QWLERYLDEARPLLVKDASEMHVFVNNHGKGLSRQGIWKNLKQLVREAGI-YKEVTPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLRT+Q LLGH DISTTQIYTH+   ++  + + + P A
Sbjct: 244 RHSFATHLLENGADLRTVQELLGHADISTTQIYTHITKKRMTDVYKQHFPRA 295


>gi|218706400|ref|YP_002413919.1| site-specific tyrosine recombinase XerD [Escherichia coli UMN026]
 gi|293406393|ref|ZP_06650319.1| xerD [Escherichia coli FVEC1412]
 gi|298382129|ref|ZP_06991726.1| tyrosine recombinase xerD [Escherichia coli FVEC1302]
 gi|300896210|ref|ZP_07114759.1| tyrosine recombinase XerD [Escherichia coli MS 198-1]
 gi|301027413|ref|ZP_07190750.1| tyrosine recombinase XerD [Escherichia coli MS 69-1]
 gi|218433497|emb|CAR14400.1| site-specific tyrosine recombinase [Escherichia coli UMN026]
 gi|291426399|gb|EFE99431.1| xerD [Escherichia coli FVEC1412]
 gi|298277269|gb|EFI18785.1| tyrosine recombinase xerD [Escherichia coli FVEC1302]
 gi|300359944|gb|EFJ75814.1| tyrosine recombinase XerD [Escherichia coli MS 198-1]
 gi|300394921|gb|EFJ78459.1| tyrosine recombinase XerD [Escherichia coli MS 69-1]
          Length = 298

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 174/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++  +L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGSTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|168242831|ref|ZP_02667763.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194449828|ref|YP_002047028.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194408132|gb|ACF68351.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205338181|gb|EDZ24945.1| tyrosine recombinase XerD [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 298

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 112/291 (38%), Positives = 173/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L+++  +L+ A  + L + L    +     +S  R
Sbjct: 15  LWLERNLAENTLSAYRRDLSMVVAWLHHRGKTLATAQADDLQTLLAERVEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+  L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAMRRFFQHLYREKYREDDPSAQLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGMVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|226945992|ref|YP_002801065.1| site-specific tyrosine recombinase XerD [Azotobacter vinelandii DJ]
 gi|226720919|gb|ACO80090.1| Site-specific tyrosine recombinase [Azotobacter vinelandii DJ]
          Length = 298

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 102/295 (34%), Positives = 160/295 (54%), Gaps = 11/295 (3%)

Query: 1   MMSS---ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            + +   E+  S +T +AY+ DL+    +L  + ++L       ++ +L           
Sbjct: 12  FLEALWLEKGLSAHTRAAYRSDLELFNGWLCERGLALVEVGRELILDHLAWRVDAGYKAR 71

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           S  R +S +R F+ +L  EG+   +P+  +ELP+    LPK+L +  +  LL   + +  
Sbjct: 72  STARFLSGLRGFFRYLLREGVIAGDPTLQVELPQLGRPLPKSLSEADVEALLAAPEDD-- 129

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                    +R   ++E+LYA G+RVSELV L    LNL +  + + GKG+KERLV L  
Sbjct: 130 -----DPLGLRDRAMLEVLYACGLRVSELVGLRLEQLNLRQGVVRVFGKGSKERLVPLGE 184

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
            A+  L+ Y      + + G    +   S +   ++RQ F   +K  A  AGI  K++SP
Sbjct: 185 EAIAWLERYLVEARPLLLGGRPSDVLFPSLRGEQMTRQTFWHRIKHHARLAGI-GKSLSP 243

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RHAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 244 HTLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHIARARLQELHARHHPRG 298


>gi|254483258|ref|ZP_05096490.1| tyrosine recombinase XerC [marine gamma proteobacterium HTCC2148]
 gi|214036481|gb|EEB77156.1| tyrosine recombinase XerC [marine gamma proteobacterium HTCC2148]
          Length = 304

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 92/298 (30%), Positives = 155/298 (52%), Gaps = 10/298 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNN-KEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +   R  S +TL  Y+RDL  +Q +    K+ + +      + ++++ L +R L  SS +
Sbjct: 16  LRDVRQLSPHTLENYQRDLASLQRYGEQIKKQTAAELDEADIRAWVSQLHRRGLAGSSIQ 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S  R F+N+L        NP+  ++ P+K   LPKTL  D +   L           
Sbjct: 76  RSLSAARSFFNYLSRINGHPRNPAAAVQAPRKPRKLPKTLDADQVDRYL--------MFE 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   + EL Y++G+R++EL +++ + ++   R + + GKGNK R V +  +AL
Sbjct: 128 DDSPTALRDHAMAELFYSSGLRLAELNSVNINDIDRGSRLLTVTGKGNKTRTVPVGSAAL 187

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  +      +    +      +S +   +S +     LK    +AG+ ++++ PH++
Sbjct: 188 KAIDKWLTVRPDIAADEDASVALFTSNRGQRISVRNIQARLKLQGRKAGM-RQDVHPHML 246

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKH 298
           RH+FASH+LE   DLR +Q LLGH +ISTTQIYTHL    L K+    HP AK+ K+ 
Sbjct: 247 RHSFASHMLESSGDLRAVQELLGHANISTTQIYTHLDFQHLAKVYDAAHPRAKRRKRD 304


>gi|150009884|ref|YP_001304627.1| tyrosine type site-specific recombinase [Parabacteroides distasonis
           ATCC 8503]
 gi|256838407|ref|ZP_05543917.1| tyrosine recombinase XerD [Parabacteroides sp. D13]
 gi|262382840|ref|ZP_06075977.1| tyrosine recombinase XerD [Bacteroides sp. 2_1_33B]
 gi|298374238|ref|ZP_06984196.1| tyrosine recombinase XerD [Bacteroides sp. 3_1_19]
 gi|301312384|ref|ZP_07218300.1| tyrosine recombinase XerD [Bacteroides sp. 20_3]
 gi|149938308|gb|ABR45005.1| tyrosine type site-specific recombinase [Parabacteroides distasonis
           ATCC 8503]
 gi|256739326|gb|EEU52650.1| tyrosine recombinase XerD [Parabacteroides sp. D13]
 gi|262295718|gb|EEY83649.1| tyrosine recombinase XerD [Bacteroides sp. 2_1_33B]
 gi|298268606|gb|EFI10261.1| tyrosine recombinase XerD [Bacteroides sp. 3_1_19]
 gi|300829567|gb|EFK60221.1| tyrosine recombinase XerD [Bacteroides sp. 20_3]
          Length = 301

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 160/294 (54%), Gaps = 8/294 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E++ S N++ AY  DL ++  F  +++  +   S + L  ++  L    +   SQ R
Sbjct: 15  LRLEKSLSANSIDAYLTDLDKLLRFAEDEKKDVKEISYDDLQQFIAQLRDIGIHPRSQAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            IS I+ FY FL  +    ++P++ LE PK    LP+ L  + I ++L+           
Sbjct: 75  IISGIKSFYRFLLLDNYITNDPTELLESPKIGLKLPEVLTVNEINSILDTI-------DL 127

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
              +  R   ++E+LY+ G+RVSEL  L    +   E  + ++GKG+K+RLV +S  AL 
Sbjct: 128 TLPEGQRNRAMLEVLYSCGLRVSELTGLRYSDIYPKEGFIRVEGKGSKQRLVPISEVALR 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y    +S+ +      +   S +   LSR +    +K     AGI  KN+SPH  R
Sbjct: 188 EIKNYLYDRNSVVVKKGFEDILFLSRRGTALSRIMVFHIIKQQTEAAGIH-KNVSPHTFR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           H+FA+HLLEGGA+LR IQ +LGH  I+TT+IYTH+  + L+K + ++HP ++  
Sbjct: 247 HSFATHLLEGGANLRAIQEMLGHEKITTTEIYTHIDREFLRKEILEHHPRSRPR 300


>gi|254508834|ref|ZP_05120944.1| tyrosine recombinase XerD [Vibrio parahaemolyticus 16]
 gi|219548220|gb|EED25235.1| tyrosine recombinase XerD [Vibrio parahaemolyticus 16]
          Length = 298

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 105/288 (36%), Positives = 167/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL++Y+ DL ++  +++     L   S + L  Y   L+      +S+ R +S
Sbjct: 18  ERGLSENTLASYRNDLSKLLQWMSKHNYRLDFISLSGLQEYQTWLADEGYKQTSRARMLS 77

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LL+          P   
Sbjct: 78  AIRRLFQYLHREKIRADDPSALLVSPKLPKRLPKDLSEAQVDALLDAP-------DPNDP 130

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 131 MELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVTGKGGKERLVPMGENAVDWIE 190

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +   S  +  N   +   S +   ++RQ F   +K  A  AGI  + +SPH++RHAF
Sbjct: 191 TFLEQGRSELLGENTSDVVFPSKRARQMTRQTFWHRIKHYAVIAGIDSEKLSPHVLRHAF 250

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 251 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHSEHHPRA 298


>gi|77457252|ref|YP_346757.1| site-specific tyrosine recombinase XerD [Pseudomonas fluorescens
           Pf0-1]
 gi|77381255|gb|ABA72768.1| integrase/recombinase [Pseudomonas fluorescens Pf0-1]
          Length = 298

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 99/291 (34%), Positives = 159/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  AY+ DL     +L +K + L  A    ++ +L    ++     S  R
Sbjct: 16  LWLEKGLSDNTRDAYRSDLALFNGWLQDKGLELINAGRELILDHLAWRLEQNYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R FY +L  E L   +P+  +++P+    LPK+L +  +  LL+           
Sbjct: 76  FLSGVRGFYRYLLREKLISVDPTLRVDMPQLGRPLPKSLSEADVEALLKAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEAIGQRDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   S +   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRDGRGELLGGRPSDVLFPSQRGEQMTRQTFWHRIKHQAKVAGIS-KSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQDLHAKHHPRG 298


>gi|81428639|ref|YP_395639.1| site-specific DNA tyrosine recombinase, XerD [Lactobacillus sakei
           subsp. sakei 23K]
 gi|78610281|emb|CAI55330.1| Site-specific DNA tyrosine recombinase, XerD [Lactobacillus sakei
           subsp. sakei 23K]
          Length = 294

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 102/290 (35%), Positives = 159/290 (54%), Gaps = 8/290 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT  +Y++DLK+ Q FL +++++        ++ +L   +  +   SS  R
Sbjct: 12  LKIERGLSENTRQSYRQDLKQYQQFLVSQKLTSFTEDRFIVLGFLQAQTTAQKAQSSITR 71

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            IS +R+FY +L  EG  + +P   ++ PK+   LP  L  + I  LL+           
Sbjct: 72  SISTLRKFYQYLAREGRIQKDPMLQIDSPKQGRHLPAVLSSEEIERLLKTP-------DT 124

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L    L+L+   +   GKG+KER++ +   A+ 
Sbjct: 125 STPLGLRDRAILEVLYATGLRVSELVHLKLTDLHLSLGLIQTLGKGDKERIIPIGDVAVD 184

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            +  Y +   +    G D      +     L+RQ   ++LKA+   AGI  K+++PH +R
Sbjct: 185 WINQYLERSRNRLTKGKDSPYLFVNFHGNGLTRQGIWKNLKAIVQAAGID-KDVTPHTLR 243

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           H+FA+ LLE GADLR +Q LLGH+DISTTQIYTH+    L ++ Q  HP 
Sbjct: 244 HSFATVLLENGADLRIVQELLGHSDISTTQIYTHISKKHLTEVYQRSHPR 293


>gi|269140272|ref|YP_003296973.1| site-specific tyrosine recombinase [Edwardsiella tarda EIB202]
 gi|267985933|gb|ACY85762.1| site-specific tyrosine recombinase [Edwardsiella tarda EIB202]
 gi|304560099|gb|ADM42763.1| Site-specific recombinase XerD [Edwardsiella tarda FL6-60]
          Length = 299

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 108/291 (37%), Positives = 167/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL++Y++DL+ +  +L   +++L  A+   L  +           SS  R
Sbjct: 16  LWLEKNLAENTLASYRQDLRTLAEWLAYHDLTLLTAAHGDLQDFFAQRMDGGYKASSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ Y +L  E LR D+PS  L  PK    LPK L +  +  LL+         A 
Sbjct: 76  LLSALRRCYQYLYREKLRSDDPSALLASPKLPQRLPKDLSEAQVDALLQAP-------AI 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 DTPLELRDKAMLELLYATGLRVSELVGLAQEDISLRQGVVRVIGKGNKERLVPLGEEAIY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  +     S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIEYYLEYGRPWLVNGQTVAALFPSNRARQMTRQTFWHRIKHYAVLAGIDAERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 299


>gi|269215886|ref|ZP_06159740.1| tyrosine recombinase XerD [Slackia exigua ATCC 700122]
 gi|269130836|gb|EEZ61912.1| tyrosine recombinase XerD [Slackia exigua ATCC 700122]
          Length = 315

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 149/294 (50%), Gaps = 9/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLS-AASTNHLISYLNHLSQRKLVTSSQ 59
            +S E+ SS  T+ +Y  DL++   FL+++ +  +   + + L SY+  LS R    +S 
Sbjct: 27  FLSIEKGSSDLTVRSYAADLEDYVAFLDSEGVHAARDVTRDALASYVADLSGRGYAAASI 86

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R +S ++ F+ FL  +GL   +P+  L LP     LP  L  D +  LL+Q   E    
Sbjct: 87  ERHVSALKGFHAFLVRDGLVASDPACALPLPGVPARLPDVLSIDQVNTLLDQEFREG--- 143

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR    +ELLY  G+R SEL  L A    L E  + I GKG++ER+V +  SA
Sbjct: 144 ----PLGVRNACALELLYGCGLRASELSGLDAGDAFLDEGILRIVGKGSRERIVPIGGSA 199

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
              L  Y +    +  +   L         G    +     +   A    I  K++ PH 
Sbjct: 200 ARCLASYLEDARPLLRSPRRLTPAVMLNARGGRLSRQSIHSIVREA-GHVIGIKDLHPHT 258

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           +RH+FA+HLLEGGADLR IQ +LGH+DISTTQIYTH+    +++     HP AK
Sbjct: 259 LRHSFATHLLEGGADLRAIQEMLGHSDISTTQIYTHVDRTHVREEYLSAHPRAK 312


>gi|15614092|ref|NP_242395.1| integrase/recombinase [Bacillus halodurans C-125]
 gi|34223074|sp|Q9KCP0|XERD_BACHD RecName: Full=Tyrosine recombinase xerD
 gi|10174146|dbj|BAB05248.1| integrase/recombinase [Bacillus halodurans C-125]
          Length = 299

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 104/297 (35%), Positives = 156/297 (52%), Gaps = 13/297 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLV 55
            +     ER  S NT+ +Y RDLK+   ++    +  S    +   ++ YL HL ++   
Sbjct: 11  FLHFQKVERGLSNNTIQSYGRDLKQYIQYVERVEEIRSARNITRETILHYLYHLREQGRA 70

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
            +S  R ++ IR F+ FL  E L   +P+  +E+PK    LPK L  + +  LL   +  
Sbjct: 71  ETSIARAVAAIRSFHQFLLREKLSDSDPTVHVEIPKATKRLPKALTIEEVEALLNSPQG- 129

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
                      +R   ++ELLYATGMRVSEL+ L+   ++L+   +   GKGNKER++ +
Sbjct: 130 ------RDPFSLRNKAMLELLYATGMRVSELIGLTLSDIHLSMGFVRCLGKGNKERIIPI 183

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
              A  A++ Y        M          +     LSRQ F + LK LA    I K  +
Sbjct: 184 GQVATEAVESYLANGRGKLMKKQSHDHVFVNHHGRPLSRQGFWKMLKQLAKNVNIDKP-L 242

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +PH +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +++ +   +HP A
Sbjct: 243 TPHTLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRMRDVYAHFHPRA 299


>gi|254492199|ref|ZP_05105373.1| tyrosine recombinase XerC [Methylophaga thiooxidans DMS010]
 gi|224462524|gb|EEF78799.1| tyrosine recombinase XerC [Methylophaga thiooxydans DMS010]
          Length = 302

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 93/295 (31%), Positives = 157/295 (53%), Gaps = 11/295 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ +R  S +T++ Y+RDL ++ +F   +E+S   +     L  ++  L ++ L + + +
Sbjct: 16  LAQQRRLSHHTVNNYRRDLTQLIDFCQGQELSHWHSVKPADLRQFIAFLHRKGLASRTIQ 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S  R  Y +L  +GL + NP+  ++ PK    LP TL  D +  LL+Q + +     
Sbjct: 76  RMLSATRSLYQYLIRQGLAETNPAQAVQAPKAEKRLPSTLDVDQMNALLDQTQAD----- 130

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
              +   R   ++EL Y++G+R++EL TL    ++  ++ + + GKGNK+R+  +   A+
Sbjct: 131 --TFVACRDRAIMELFYSSGLRLAELATLDLRDIDFGDQLVHVTGKGNKDRVCPVGAVAI 188

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            ALQ + +          D      + +   L  +   + L     + GI  + + PH +
Sbjct: 189 KALQDWLEKRDQTGFF--DQPAVFITQQGRRLGMRSIQKRLSFWGKKQGISDR-VHPHRL 245

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           RHAFASH+LE   DLR +Q LLGH+DISTTQIYTH+    L K+    HP AKK 
Sbjct: 246 RHAFASHMLESSGDLRAVQELLGHSDISTTQIYTHVDFQHLAKVYDSAHPRAKKR 300


>gi|170018860|ref|YP_001723814.1| site-specific tyrosine recombinase XerD [Escherichia coli ATCC
           8739]
 gi|169753788|gb|ACA76487.1| tyrosine recombinase XerD [Escherichia coli ATCC 8739]
          Length = 298

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 174/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYCRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|330959145|gb|EGH59405.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 298

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L           S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLPSAGREVILDHLAWRVDNAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLIAIDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEPIGQRDRAVLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEIHAKHHPRG 298


>gi|317476478|ref|ZP_07935727.1| tyrosine recombinase XerD [Bacteroides eggerthii 1_2_48FAA]
 gi|316907504|gb|EFV29209.1| tyrosine recombinase XerD [Bacteroides eggerthii 1_2_48FAA]
          Length = 316

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 96/296 (32%), Positives = 161/296 (54%), Gaps = 8/296 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E++ + NT  AY  DL+++ +FL  + I +   + + L  +   L    +   SQ R
Sbjct: 24  LKLEKSLAPNTFDAYMTDLQKLLHFLEGENIEVGNVTPDDLQRFAAGLHDIGIHPRSQAR 83

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S I+ F++FL      + +PS+ LE PK    +P+ L  + I  ++    ++      
Sbjct: 84  ILSGIKSFFHFLTVADYLETDPSELLEGPKIGFKIPEVLTVEEIDRIISAVDMD------ 137

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            + +  R   ++E LY+ G+RVSEL  L    L   E  + ++GKG+K+RLV +SP A+ 
Sbjct: 138 -KKEGQRNRAILETLYSCGLRVSELCNLKLSDLYFEEGFIKVEGKGSKQRLVPISPRAIK 196

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ +    +  K+          +    ++SR +    +K LA + GI  KNISPH  R
Sbjct: 197 EIKYWLTDRNLGKIKKGYEDYVFLARWGNNISRIMVFHMIKELAEKTGIT-KNISPHTFR 255

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           H+FA+HLLEGGA+LR IQ +LGH  I+TT+IYTH+  + L+  + ++HP   K +K
Sbjct: 256 HSFATHLLEGGANLRAIQCMLGHESIATTEIYTHIDRNMLRSEIIEHHPRNIKYRK 311


>gi|238921200|ref|YP_002934715.1| tyrosine recombinase XerD, [Edwardsiella ictaluri 93-146]
 gi|238870769|gb|ACR70480.1| tyrosine recombinase XerD, putative [Edwardsiella ictaluri 93-146]
          Length = 299

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 108/291 (37%), Positives = 167/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL++Y++DL+ +  +L   +++L  A+   L  +           SS  R
Sbjct: 16  LWLEKNLAENTLASYRQDLRTLAEWLACHDLTLLTAAHGDLQDFFAQRMDGGYKASSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ Y +L  E LR D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 76  LLSALRRCYQYLYRETLRGDDPSALLASPKLPQRLPKDLSEAQVDALLQAPSID------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -TPLELRDKAMLELLYATGLRVSELVGLAQEDISLRQGVVRVIGKGNKERLVPLGEEAIY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  +     S +   ++RQ F   +K  A  AGI    +SPH++R
Sbjct: 189 WIEYYLEYGRPWLVNGQTVAALFPSNRARQMTRQTFWHRIKHYAVLAGIDGDRLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 299


>gi|297205885|ref|ZP_06923280.1| tyrosine recombinase XerD [Lactobacillus jensenii JV-V16]
 gi|297149011|gb|EFH29309.1| tyrosine recombinase XerD [Lactobacillus jensenii JV-V16]
          Length = 300

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 92/296 (31%), Positives = 142/296 (47%), Gaps = 11/296 (3%)

Query: 1   MMSS---ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +     ER  S NT+ +Y+ DL +   +L+ ++I+        + SYL         TS
Sbjct: 12  FLRFCSLERGLSKNTVDSYQLDLNQFIEYLDKEKITDWPEDPLIIDSYLAKQRDEGKKTS 71

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           +  R I+ +R+FY +L  + +   +P   ++ PK+   LP  L +  +  LL Q      
Sbjct: 72  TISRGITTLRRFYRYLLRQHILVVDPLIQIDTPKQEKRLPLALSQKEVEQLLAQP----- 126

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                    +R   ++ELLYATGMRVSEL+ L    L+   + + + GKG+KERLV ++ 
Sbjct: 127 --DIKTTTGLRDRAILELLYATGMRVSELINLKEADLHTDLKIIRVLGKGSKERLVPVTD 184

Query: 178 SA-LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            A     +  K       +       F           +          ++     K+I+
Sbjct: 185 FALNWLDKYLKNVRDPALLKKGVACDFLFLNNRAGQLTRQAVWQSIKKYSKLAKIDKDIT 244

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           PH +RH FA+HLLE GADLR +Q +LGH+DISTTQIYT+L    +  + Q  HP A
Sbjct: 245 PHTLRHTFATHLLENGADLRVVQEILGHSDISTTQIYTNLSQKHIFDVYQKTHPRA 300


>gi|57234468|ref|YP_181457.1| tyrosine recombinase XerC [Dehalococcoides ethenogenes 195]
 gi|57224916|gb|AAW39973.1| tyrosine recombinase XerC [Dehalococcoides ethenogenes 195]
          Length = 307

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 106/296 (35%), Positives = 163/296 (55%), Gaps = 9/296 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ E+  S  TL  Y+ DL    N+L  K++S         L  Y++ L ++ +V  S  
Sbjct: 12  LTVEKNVSAYTLRNYRTDLIGFVNYLIEKKVSSFDKVDRYILRDYMSSLIEKGIVKGSIA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R FY +L  EGL + NP+     P+ +  LP+ L    +  LL         P 
Sbjct: 72  RKLSAVRSFYRYLMREGLIQKNPTLNASSPRLDKRLPEFLTTAEVNKLLR-------IPD 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               + +R    +ELLYA+G+RVSELV L    L+L    + + GKG+KER+V++   A+
Sbjct: 125 SSTPQGLRDKAFMELLYASGLRVSELVKLDIENLDLHSHQIRVWGKGSKERIVLMGLPAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            ++Q Y      +     +      +   G LS + F   L  LA +AGI+ K++ PH++
Sbjct: 185 QSIQTYLNLGRPLLKGKRNTPALFLNPNGGRLSARSFQERLDKLAHQAGIE-KHVHPHML 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           RH FA+HLL+GGADLR +Q LLGH+++STTQIYTH+   + +K+    HPLAK + 
Sbjct: 244 RHTFATHLLDGGADLRVVQELLGHSNLSTTQIYTHVTKSQARKVYMSSHPLAKPQN 299


>gi|261250247|ref|ZP_05942823.1| site-specific recombinase XerD [Vibrio orientalis CIP 102891]
 gi|260939363|gb|EEX95349.1| site-specific recombinase XerD [Vibrio orientalis CIP 102891]
          Length = 302

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 104/288 (36%), Positives = 166/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL++Y+ DL ++  +++     L   S + L  Y   L       +S+ R +S
Sbjct: 22  ERGLSENTLASYRTDLVKLLRWMSTNNYKLDFISLSGLQEYQAWLVDEGYKQTSRARMLS 81

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK L ++ +  LL+          P   
Sbjct: 82  AIRRLFQYLHREKVRGDDPSALLVSPKLPKRLPKDLSEEQVDALLDAP-------DPNDA 134

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 135 MELRDKAMLELLYATGLRVTELVSLTMENVSLRQGVVRVTGKGGKERLVPMGENAVDWIE 194

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +   S  +      +   S +   ++RQ F   +K  A  AGI  + +SPH++RHAF
Sbjct: 195 TFLQQGRSELLGETTSDVVFPSKRARQMTRQTFWHRIKHYAVVAGIDTEQLSPHVLRHAF 254

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 255 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHSEHHPRA 302


>gi|50119715|ref|YP_048882.1| site-specific tyrosine recombinase XerD [Pectobacterium
           atrosepticum SCRI1043]
 gi|49610241|emb|CAG73684.1| integrase/recombinase [Pectobacterium atrosepticum SCRI1043]
          Length = 299

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 168/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL+ +  +L + +  L  A    L ++L          +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLRSLAEWLAHHDNDLLHAQALDLQAFLADRIDGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+ +L  E  R D+PS  L  PK    LPK L +  ++ LL+   IE      
Sbjct: 76  LLSAMRRFFQYLYREKQRSDDPSAVLSSPKLPQRLPKDLSEAQVSALLDAPSIE------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDVSLRQGVVRVLGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S +   ++RQ F   +K  A  A I    +SPH++R
Sbjct: 189 WIEYYLEHGRPWLLNGQTLDVLFPSNRARQMTRQTFWHRIKHYAVLASIDSAKLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|238792839|ref|ZP_04636470.1| Tyrosine recombinase xerD [Yersinia intermedia ATCC 29909]
 gi|238727947|gb|EEQ19470.1| Tyrosine recombinase xerD [Yersinia intermedia ATCC 29909]
          Length = 299

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL  +  +L +    L  A +  L S+L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLHALTGWLEHHGSDLLRAGSQDLQSFLAERIEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+P+  L  PK    LPK L +  +  LL    ++      
Sbjct: 76  LLSAMRRLFQYLYREKLREDDPTALLSSPKLPQRLPKDLSEAQVDRLLNSPNVDI----- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 131 --PLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYMEHGRPWLINGQSLDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|323173892|gb|EFZ59521.1| tyrosine recombinase XerD [Escherichia coli LT-68]
          Length = 298

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 174/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      +    + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNCVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|163741192|ref|ZP_02148584.1| tyrosine recombinase XerD [Phaeobacter gallaeciensis 2.10]
 gi|161385545|gb|EDQ09922.1| tyrosine recombinase XerD [Phaeobacter gallaeciensis 2.10]
          Length = 337

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 123/295 (41%), Positives = 176/295 (59%), Gaps = 10/295 (3%)

Query: 7   ASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKISVI 66
            ++ NTL AY RDLK++ ++L +K +   +AS + + +YL       L  +++ R++S I
Sbjct: 31  GAARNTLLAYGRDLKDVASWLGHKNLDFGSASRDDIEAYLIACDAEGLARATRARRLSAI 90

Query: 67  RQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQWKR 126
           +Q Y F   EG R DNP+  ++ P +   LPKTL    +  LL+ A+    N +     R
Sbjct: 91  KQIYRFAFDEGWRSDNPAIQIKGPGRQKALPKTLEVIEVDRLLDAARQSGRNLSD----R 146

Query: 127 VRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQMY 186
           +R   ++ELLYATGMRVSELV L         R +++ GKG KER+V LSP A  AL  +
Sbjct: 147 LRNTCMMELLYATGMRVSELVGLPVAAARGDPRMLLVLGKGGKERMVPLSPPARDALAAW 206

Query: 187 KKTCSSM------KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             T  +       K      +LFPS  K+GHL+R  F   +K  A   G+  + +SPH +
Sbjct: 207 LTTRDAAEEAAVAKGAAPSRFLFPSRGKSGHLTRHRFYLLIKEFAVAGGLPPEAVSPHTL 266

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           RHAFA+HLL  GADLR IQ LLGH DI+TT+IYTH+L  +L +LV ++HPLA+K+
Sbjct: 267 RHAFATHLLTNGADLRAIQALLGHADIATTEIYTHVLDARLSELVLEHHPLARKD 321


>gi|256851002|ref|ZP_05556391.1| tyrosine recombinase XerD [Lactobacillus jensenii 27-2-CHN]
 gi|260661214|ref|ZP_05862128.1| tyrosine recombinase XerD [Lactobacillus jensenii 115-3-CHN]
 gi|282932045|ref|ZP_06337503.1| tyrosine recombinase XerD [Lactobacillus jensenii 208-1]
 gi|256616064|gb|EEU21252.1| tyrosine recombinase XerD [Lactobacillus jensenii 27-2-CHN]
 gi|260548151|gb|EEX24127.1| tyrosine recombinase XerD [Lactobacillus jensenii 115-3-CHN]
 gi|281303812|gb|EFA95956.1| tyrosine recombinase XerD [Lactobacillus jensenii 208-1]
          Length = 300

 Score =  185 bits (470), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 92/296 (31%), Positives = 142/296 (47%), Gaps = 11/296 (3%)

Query: 1   MMSS---ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +     ER  S NT+ +Y+ DL +   +L+ ++I+        + SYL         TS
Sbjct: 12  FLRFCSLERGLSKNTVDSYQLDLNQFIEYLDKEKITDWPEDPLIIDSYLAKQRDEGKKTS 71

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           +  R I+ +R+FY +L  + +   +P   ++ PK+   LP  L +  +  LL Q      
Sbjct: 72  TISRGITTLRRFYRYLLRQHILVVDPLIQIDTPKQEKRLPLALSQKEVEQLLAQP----- 126

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                    +R   ++ELLYATGMRVSEL+ L    L+   + + + GKG+KERLV ++ 
Sbjct: 127 --DIKTTTGLRDRAILELLYATGMRVSELINLKEADLHTDLKIIRVLGKGSKERLVPVTD 184

Query: 178 SA-LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            A     +  K       +       F           +          ++     K+I+
Sbjct: 185 FALSWLDKYLKNVRDPALLKKGVACDFLFLNNRAGQLTRQAVWQSIKKYSKLAKIDKDIT 244

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           PH +RH FA+HLLE GADLR +Q +LGH+DISTTQIYT+L    +  + Q  HP A
Sbjct: 245 PHTLRHTFATHLLENGADLRVVQEILGHSDISTTQIYTNLSQKHIFDVYQKTHPRA 300


>gi|229824242|ref|ZP_04450311.1| hypothetical protein GCWU000282_01546 [Catonella morbi ATCC 51271]
 gi|229786596|gb|EEP22710.1| hypothetical protein GCWU000282_01546 [Catonella morbi ATCC 51271]
          Length = 331

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 105/302 (34%), Positives = 161/302 (53%), Gaps = 12/302 (3%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLN-NKEISLSAASTNHLISYLNHLSQRKLVT 56
            +   S ER  S  TL+AY++DL   Q+F+  +    L   +   +  YL +L+++    
Sbjct: 37  FLQYISVERRYSQKTLAAYQQDLAAFQSFIETSGGGDLKQIAYQDVRLYLAYLNEQAYAK 96

Query: 57  SSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEA 116
           +S RRK+S +R F+ +   +G  + NP + ++   K   LP+  ++  +  L +      
Sbjct: 97  TSIRRKLSSLRSFFTYCLSQGWIETNPMELVQYQVKKKTLPQFFYEQELTQLFDSLYKRE 156

Query: 117 ENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILS 176
           ++ A       R  +L+E+LYATGMRVSEL  LS   LNL  + + + GKGNKER+V L 
Sbjct: 157 DDAA------WRDRMLLEVLYATGMRVSELSELSLERLNLEVQLIRVLGKGNKERIVPLG 210

Query: 177 PSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            SA  A++ Y           N  +L  +        RQ+  R    +  +A   K  I 
Sbjct: 211 DSATQAIRDYLSHLRPKIDRNNSPYLLLTDKGAPMSPRQIRTRLKSLVEEQAMNLK--IY 268

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH +RH+FA+HLL  GADLRT+Q LLGH ++S+TQIYTH+  D+L+      HP AK+ K
Sbjct: 269 PHKLRHSFATHLLNKGADLRTVQELLGHANLSSTQIYTHVTKDQLRSQYLKAHPRAKQAK 328

Query: 297 KH 298
           + 
Sbjct: 329 QD 330


>gi|39933583|ref|NP_945859.1| tyrosine recombinase XerD [Rhodopseudomonas palustris CGA009]
 gi|39647429|emb|CAE25950.1| site-specific integrase/recombinase XerD [Rhodopseudomonas
           palustris CGA009]
          Length = 338

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 135/299 (45%), Positives = 196/299 (65%), Gaps = 4/299 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++E+ +S NTL AY+RDL ++ +FL+ + +S+ +A T  L SYL  L  R   TSS  
Sbjct: 40  MIAAEQGASANTLDAYRRDLADLSHFLSRRRLSIGSADTAALRSYLADLDNRGFATSSVA 99

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +R  + FL  E +R D+P+  L  PK+   LPK L    +  LL  A+ E +   
Sbjct: 100 RRLSALRHLFRFLLSERIRADDPAAILAGPKRGRSLPKVLSIADVDQLLACARQEIDAAE 159

Query: 121 PG-QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
            G + +  R+  L+E+LYATG+RVSELV+L         R ++++GKG+KERLV L+  A
Sbjct: 160 GGARLRAARLNCLLEVLYATGLRVSELVSLPLSAARRDARMIVVRGKGDKERLVPLNAGA 219

Query: 180 LHALQMYKKTCSSMKMTGN---DLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
             A+  Y +  ++ K   +     WLFPS  ++G+L+RQ FARDLK LAARAG+  + +S
Sbjct: 220 KQAMARYLEEMAAAKAPKDGPAPKWLFPSFGESGYLTRQHFARDLKDLAARAGLAPRLVS 279

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           PH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH++ ++L+ LV+D HPL +  
Sbjct: 280 PHVLRHAFASHLLHNGADLRIVQTLLGHSDISTTQIYTHVVEERLKSLVRDLHPLGEGR 338


>gi|308050773|ref|YP_003914339.1| tyrosine recombinase XerD [Ferrimonas balearica DSM 9799]
 gi|307632963|gb|ADN77265.1| tyrosine recombinase XerD [Ferrimonas balearica DSM 9799]
          Length = 295

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 104/290 (35%), Positives = 165/290 (56%), Gaps = 8/290 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           + ++R  S NTL+AY+ DL     FL+ ++  L+ A +  +  YL H        +S  R
Sbjct: 14  LWAQRGLSDNTLAAYRSDLCRFAEFLSERDTPLARADSLDIRDYLAHRKSIGAAKTSTAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+  L   G R+ +P   +  PK +  LP +L +  +  LL+  + +      
Sbjct: 74  SLSALRRFFADLVRRGEREADPMALIAQPKMDRKLPDSLSEAEVEALLDAPECD------ 127

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
               ++R   ++ELLYATG+RVSEL  L    ++L +  + + GKG KERLV +   A H
Sbjct: 128 -DPIQLRDKAMLELLYATGLRVSELTGLQMEQVSLRQGVVRVVGKGGKERLVPMGEQAQH 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L++Y +    M +  N   +   S +   ++RQ F   +K  A ++GI K  +SPH +R
Sbjct: 187 QLEVYLREARGMLLGVNRSDVLFPSKRGVQMTRQTFWHRVKFYAQQSGITKP-LSPHTLR 245

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +L +L +++HP 
Sbjct: 246 HAFATHLLNHGADLRVVQLLLGHSDLSTTQIYTHVAQARLTELHREHHPR 295


>gi|329296874|ref|ZP_08254210.1| tyrosine recombinase XerD [Plautia stali symbiont]
          Length = 297

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 109/291 (37%), Positives = 172/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           + +ER  + NTL++Y++DL+ +  +L++ E +L +     L  +L    +     +S  R
Sbjct: 14  LWTERNLAQNTLASYRQDLQTLTAWLHHHERTLLSLEAADLQQFLAERIEGGYKATSSAR 73

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR D+PS  L  PK    LPK L ++ +  LL+         A 
Sbjct: 74  TLSAMRRLFQYLYREKLRSDDPSALLSAPKLPQRLPKDLSENQVERLLQAP-------AT 126

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 127 DIPLELRDKAMLELLYATGLRVSELVGLTLSDVSLRQGVVRVIGKGNKERLVPLGEEAIY 186

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 187 WLEHYMEHGRPWLLNGQTIDVLFPSNRAQQMTRQTFWHRIKHYATLAGIDSEKLSPHVLR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 247 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 297


>gi|330504633|ref|YP_004381502.1| site-specific tyrosine recombinase XerD [Pseudomonas mendocina
           NK-01]
 gi|328918919|gb|AEB59750.1| site-specific tyrosine recombinase XerD [Pseudomonas mendocina
           NK-01]
          Length = 313

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 102/295 (34%), Positives = 164/295 (55%), Gaps = 11/295 (3%)

Query: 1   MMSS---ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            + +   E+  S +T +AY+ DL+    +L+ + ++L     + ++ +L    ++     
Sbjct: 27  FLEAQWLEKGLSAHTQAAYRSDLEHFNAWLDARGLALQHIGRDAILDHLAWRLEQGYQAR 86

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           S  R +S +R FY FL  E L  ++P+  +ELP+    LPK+L +  +  LL+       
Sbjct: 87  STARFLSGVRGFYRFLLREMLISEDPTLQVELPQIGRPLPKSLSEADVEALLQAP----- 141

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                    +R   ++E+LYA G+RVSELV L+   +NL +  + + GKG+KERLV L  
Sbjct: 142 --DLDDPIGLRDRAMLEVLYACGLRVSELVGLTLEQVNLRQGVLRVFGKGSKERLVPLGE 199

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
            A+  ++ Y +    + + G    +   S +   ++RQ F   +K  A  AGI  K +SP
Sbjct: 200 EAIAWIERYMREARPLLLGGKPSDVLFPSLRGEQMTRQTFWHRIKHQARVAGIS-KALSP 258

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RHAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 259 HTLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHIARARLQELHAQHHPRG 313


>gi|94266574|ref|ZP_01290258.1| Tyrosine recombinase XerD [delta proteobacterium MLMS-1]
 gi|93452792|gb|EAT03324.1| Tyrosine recombinase XerD [delta proteobacterium MLMS-1]
          Length = 325

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 95/296 (32%), Positives = 153/296 (51%), Gaps = 14/296 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLS-----AASTNHLISYLNHLSQRKLVT 56
           +++ER  + NTL+AY  DL    +FL  +  + +       +  HL +YL    +R++  
Sbjct: 39  LAAERRLAANTLTAYHTDLLSFFDFLARRRPTPAISGPAEITPEHLRAYLEACRRRQIAA 98

Query: 57  SSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEA 116
            S  R++S +R F+ FL  E L   +PS  L+LPK    LPK L+ D +  LL       
Sbjct: 99  RSNARRLSALRAFFRFLRRENLIPADPSALLDLPKPGRPLPKVLNLDEVNQLLA------ 152

Query: 117 ENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILS 176
             PA      +R   ++ LLYATGMRVSELV L    +N      ++     +  +   +
Sbjct: 153 -GPAAATPLALRDHAMLHLLYATGMRVSELVNLPVAAVNQAGHLRVLGKGSKERLIPFGA 211

Query: 177 PSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            +     +   +    +       +LF ++     ++R  F + ++  A    I K+ + 
Sbjct: 212 AAGRSLARYITQGRPRLLKKRRSDFLFVTNR-GTAMTRLRFWQIIRDRARVCRIDKE-VG 269

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           PH++RH+FA+HLLE GADLR +Q +LGH DI+TTQIYTH+   +L+K+ + +HP  
Sbjct: 270 PHVLRHSFATHLLEHGADLRAVQAMLGHADIATTQIYTHVDAQRLKKIHRQFHPRG 325


>gi|157162354|ref|YP_001459672.1| site-specific tyrosine recombinase XerD [Escherichia coli HS]
 gi|157068034|gb|ABV07289.1| tyrosine recombinase XerD [Escherichia coli HS]
          Length = 298

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 109/290 (37%), Positives = 174/290 (60%), Gaps = 7/290 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R
Sbjct: 15  LWLEKNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAVRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP 
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPR 297


>gi|86147402|ref|ZP_01065715.1| tyrosine recombinase [Vibrio sp. MED222]
 gi|85834830|gb|EAQ52975.1| tyrosine recombinase [Vibrio sp. MED222]
          Length = 304

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 164/288 (56%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL +Y+ DL ++  ++      L   S + L  Y   L+      +S+ R +S
Sbjct: 24  ERGLSENTLVSYRTDLSKLLTWMEKNNYRLDFISLSGLQDYQGWLADADFKQTSRARMLS 83

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK L ++ + +LLE          P   
Sbjct: 84  AIRRLFQYLHREKVRADDPSALLISPKLPKRLPKDLSEEQVDSLLEAP-------DPNDP 136

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 137 IELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVIGKGGKERLVPMGENAVDWIE 196

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +      +  N   +   S +   ++RQ F   +K  +  AGI    +SPH++RHAF
Sbjct: 197 TFIEQGRPQLLGDNSSDVVFPSKRAKQMTRQTFWYRIKHYSVIAGIDTDLLSPHVLRHAF 256

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+++   +HP A
Sbjct: 257 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQIHAQHHPRA 304


>gi|323697647|ref|ZP_08109559.1| integrase family protein [Desulfovibrio sp. ND132]
 gi|323457579|gb|EGB13444.1| integrase family protein [Desulfovibrio desulfuricans ND132]
          Length = 316

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 79/295 (26%), Positives = 148/295 (50%), Gaps = 12/295 (4%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSA---ASTNHLISYLNHLSQRKLVTS 57
            +  E+  S  T+ +Y  DL++ + FL  ++ SL      + +H+  +L  L +R++  +
Sbjct: 21  FLEVEKGYSPATIRSYGTDLEQFEEFLRGRKASLERPARLNRDHVRGFLAELHRRQMTKT 80

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           S  RK+S +R ++ +L    +   +P   +  PK+    P+ L+ D   +L+E       
Sbjct: 81  SMGRKLSSLRAYFKYLLRHKVITKDPVAGIRNPKQEKHHPQVLNVDQAVSLMEA------ 134

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                  + +R   L E+LY +G+R+SE + L  + ++ ++   +      +  + +   
Sbjct: 135 -RVEPDPEGLRDVALAEVLYGSGLRISEAIGLDLNDVD-SDVIRVTGKGSKERIVPLSDA 192

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           +     +   +  + +K    +  LF SS     L R+   R +  L   AG+    + P
Sbjct: 193 AVARIRRYLGQRHAFLKGNYAEQALFLSSRAGKRLDRRQANRIVARLGKLAGLPLD-VHP 251

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+H+LE GADLR++Q LLGH +++TTQ YTHL   ++ ++    HPLA
Sbjct: 252 HTLRHSFATHMLEAGADLRSVQELLGHENLTTTQRYTHLDMQRIMQVYDHAHPLA 306


>gi|95929136|ref|ZP_01311880.1| Tyrosine recombinase XerD [Desulfuromonas acetoxidans DSM 684]
 gi|95134634|gb|EAT16289.1| Tyrosine recombinase XerD [Desulfuromonas acetoxidans DSM 684]
          Length = 298

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 99/291 (34%), Positives = 150/291 (51%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +S ER  S NTL +Y RDL+    FL  + I  + A   N ++ +   L ++ +   S+ 
Sbjct: 14  LSIERGLSANTLESYARDLQRYIGFLEERHINDVIAIRQNDVLDFFTELKEQGMGVRSRA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ +R F+++   E    +NP   L  PK    LP TL    +  LL+          
Sbjct: 74  RLLAALRGFHHYAVDEYQLANNPVARLTTPKMLQTLPDTLSPADVDALLD-------IND 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            GQ    R   ++ELLYATGMRVSELV L    L+L    + + GKG+K+R++ +   A+
Sbjct: 127 DGQALTRRDIAMLELLYATGMRVSELVGLKLDDLHLNSGYLRVFGKGSKQRIIPIGEIAI 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L+ Y            +L       ++G    +     +    A      KN++PH +
Sbjct: 187 DTLRDYLARVRPELDRQRNLSPCVFLNRSGKGLTRQGFWKMIKRRALEAGITKNVTPHTL 246

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           RH+FA+HLLE GADLR +Q+LLGH DISTTQIYTH+  + ++ + Q +HP 
Sbjct: 247 RHSFATHLLENGADLRVVQMLLGHVDISTTQIYTHVTREHVRHVHQSFHPR 297


>gi|196047758|ref|ZP_03114951.1| tyrosine recombinase XerC [Bacillus cereus 03BB108]
 gi|196021406|gb|EDX60120.1| tyrosine recombinase XerC [Bacillus cereus 03BB108]
          Length = 299

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 101/294 (34%), Positives = 150/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDITYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSM--KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +       + T     +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DALITYIENGRKQLAEKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++S TQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSATQIYTHVSKERLRSVYMKHHPRA 299


>gi|261337541|ref|ZP_05965425.1| tyrosine recombinase XerD [Bifidobacterium gallicum DSM 20093]
 gi|270277948|gb|EFA23802.1| tyrosine recombinase XerD [Bifidobacterium gallicum DSM 20093]
          Length = 306

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 101/300 (33%), Positives = 156/300 (52%), Gaps = 10/300 (3%)

Query: 1   MMS---SERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVT 56
            ++    ER  S  TL AY+ DL++   FL+ + ++  +   T  +  ++ HL  + L  
Sbjct: 10  FLTSMDVERGLSRATLDAYRTDLEQYLTFLDARGLNEPTRIRTEDVEQFVQHLDAQGLQP 69

Query: 57  SSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEA 116
           +S  R+++ +R F+ FL  E     + + T+  PK    LP  L  D +  LL+ A+   
Sbjct: 70  ASIARRLACVRMFHRFLLQERAVAVDVTATMHAPKTGEHLPDVLSVDDVFQLLDTAQ--- 126

Query: 117 ENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILS 176
           +  + G     R + L+E+LYATG RVSE V L+   ++ T+R M + GKG+K+RLV   
Sbjct: 127 QMASTGDVVATRDWALLEMLYATGARVSEAVGLNLDDIDETDRVMRLTGKGSKQRLVPFG 186

Query: 177 PSALHALQMYKKT---CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKK 233
            +A  ALQ Y          K  G          K G    +  A ++   AA      +
Sbjct: 187 STAAQALQQYLDASRPVLEAKAKGERELRAVWLNKRGKRLSRQSAWEVLQTAAGRAKLTR 246

Query: 234 NISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
            I PH +RH+FA+HL++GGAD+R++Q LLGH  + TTQIYTH+ PD L +     HP A+
Sbjct: 247 PIHPHTLRHSFATHLIQGGADVRSVQELLGHASVQTTQIYTHVSPDSLIEAYAMAHPRAR 306


>gi|332881238|ref|ZP_08448888.1| tyrosine recombinase XerD [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332680614|gb|EGJ53561.1| tyrosine recombinase XerD [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 317

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 109/295 (36%), Positives = 161/295 (54%), Gaps = 9/295 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NTL AY  DL+++  FL    +     S + L  ++  L+   +   S  R
Sbjct: 27  LKLERGLSGNTLDAYTEDLRKLLGFLWEGGLDFRTVSVDDLHQFMAELADVGIGPRSMAR 86

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR FY FL  E     +P++ LE PK    LP+ L    I  ++            
Sbjct: 87  ILSGIRSFYRFLYVEKEIVQDPTELLESPKIGRHLPEVLTVAEIDAMIAGI-------DL 139

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q +  R   ++E+LY+ G+RVSEL  L    L L E  + ++GKG KERLV +S  A+ 
Sbjct: 140 SQPEGQRNRAILEMLYSCGLRVSELCGLRISDLFLEEGFIRVKGKGGKERLVPISGRAVR 199

Query: 182 ALQMYKKTCSSMKMT-GNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            L+ +    + + +  GN+ ++F S  +   LSR      +K LA  AGIQKK ISPH  
Sbjct: 200 ELENWFLCRNLIHIKPGNEDFVFLSLRRGASLSRITIFYWVKELAVAAGIQKK-ISPHTF 258

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           RH+FA+HLLEGGA+LR IQ +LGH  ISTT+IYTH+   +L++ + ++HP   ++
Sbjct: 259 RHSFATHLLEGGANLRAIQAMLGHESISTTEIYTHIDRSRLRREIMEHHPRNIRD 313


>gi|299538357|ref|ZP_07051640.1| tyrosine recombinase xerD [Lysinibacillus fusiformis ZC1]
 gi|298725944|gb|EFI66536.1| tyrosine recombinase xerD [Lysinibacillus fusiformis ZC1]
          Length = 300

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 103/295 (34%), Positives = 160/295 (54%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S+NTL++Y+RDL+   +FL   E     S      ++ +L  L  +   + +
Sbjct: 14  FIQVERQLSVNTLASYRRDLESYVHFLKEAEGMSDFSVVERTTILRHLEQLRAQGKTSRT 73

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R IS IR F+ FL  E   + +P+  LE+P     LP  L  + I  LL         
Sbjct: 74  VARHISSIRSFHQFLLREKRAETDPTVHLEMPTIEQKLPNILSIEEIEALLTAPN----- 128

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
               + + +R   ++ELLY +GMR+SEL+ L    ++LT   + + GKG KER++ L  S
Sbjct: 129 --KSKPQGIRDLAMLELLYGSGMRISELIALDLADIHLTMGFVRVFGKGGKERIIPLGKS 186

Query: 179 ALHALQMYKK-TCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           AL A+  Y       ++        F  + +   L+RQ   + +K  A +AGIQ + ++P
Sbjct: 187 ALSAINAYLNGARGQLQGKYPKTDAFFINQRGKRLTRQGCWKLMKEHALKAGIQHE-LTP 245

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HL+E GADLR +Q +LGH DISTTQIYTH+   +L ++ + +HP A
Sbjct: 246 HTLRHSFATHLVENGADLRAVQEMLGHADISTTQIYTHISKTRLSEVYKQFHPRA 300


>gi|300088077|ref|YP_003758599.1| tyrosine recombinase XerD [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527810|gb|ADJ26278.1| tyrosine recombinase XerD [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 303

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 103/299 (34%), Positives = 158/299 (52%), Gaps = 13/299 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNF----LNNKEIS--LSAASTNHLISYLNHLSQRKLV 55
           +  E+  S NT  AY  DL ++ +F    L  +         +   ++SYL  L +R   
Sbjct: 12  LMVEKGFSGNTRDAYHNDLYQLADFSTRCLRQRGDQDLWDNFNRQDMLSYLLDLKERNYA 71

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
            ++  RK++  + F++FL  E   + NP+D +E PK    LP  +    +  LLEQ  + 
Sbjct: 72  VTTVVRKLAAAKSFFSFLLEENKIRQNPTDNIESPKVGKPLPDAISVQQVKALLEQPTL- 130

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
                 G  +  R   ++ELLYA+GMRVSEL+ L    ++  E  +   GKGNKER++ +
Sbjct: 131 -----AGGPEAKRDRAMLELLYASGMRVSELIGLDLADVDCDEEQVRCFGKGNKERIIPI 185

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
            P A   +  Y +      +  ND      + +   L+RQ   + LK  A  AG+    +
Sbjct: 186 HPQAARIVSEYIEEVRPRLVRSNDEKALFLNRRGERLTRQGLWQILKEYAVAAGLNG-QV 244

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           +PH +RH+FA+H+L GGADLR++Q LLGH +ISTTQIYTHL  D +++     HP A+K
Sbjct: 245 TPHTLRHSFATHMLNGGADLRSVQELLGHANISTTQIYTHLTSDHIRRAYDSAHPRARK 303


>gi|325956642|ref|YP_004292054.1| tyrosine recombinase xerD [Lactobacillus acidophilus 30SC]
 gi|325333207|gb|ADZ07115.1| tyrosine recombinase xerD [Lactobacillus acidophilus 30SC]
          Length = 301

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 166/291 (57%), Gaps = 10/291 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT+SAY++DL+E  +F+  + +S      + + ++L         TSS  R 
Sbjct: 18  QVERGLSTNTISAYRQDLEEYLSFIKKEGMSSWPTEASDVDAFLARQRDLNKATSSISRL 77

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           IS +R+FY +L  + ++K NP   ++LPKK   LP  L  + +  LLEQ  +E       
Sbjct: 78  ISSMRKFYQWLARQNIQKLNPMLEIDLPKKERRLPTALSGEEVNRLLEQPDVE------- 130

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
           Q   +R   ++E LYATGMRVSEL+ L    ++     + + GKG+KERL+ +SP ALH 
Sbjct: 131 QKLGLRDRAILETLYATGMRVSELINLELQDIHEDLGLIRVLGKGSKERLIPISPVALHW 190

Query: 183 LQMYKKTCSS--MKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           +  Y+K      +  +G +      + + G L+RQ   + +K     AGI  K+++PH +
Sbjct: 191 IDKYQKQVRDPLILKSGKNDEHLFLNNRGGKLTRQAIWQMIKKYCQMAGIT-KDVTPHTL 249

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           RH FA+HLLE GADLR +Q +LGH+DISTTQIYT+L    + ++ Q  HP 
Sbjct: 250 RHTFATHLLENGADLRVVQEILGHSDISTTQIYTNLSQKHILQVYQKTHPR 300


>gi|88705495|ref|ZP_01103205.1| site-specific recombinase [Congregibacter litoralis KT71]
 gi|88700008|gb|EAQ97117.1| site-specific recombinase [Congregibacter litoralis KT71]
          Length = 312

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 90/299 (30%), Positives = 159/299 (53%), Gaps = 11/299 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           + S R  S +T++AY+RDL   + F + + +        +H+  +L    +R L  +S +
Sbjct: 22  LRSVRRLSPHTVAAYQRDLGSFRAFCDAQSLQDCDEVQESHVRQWLAQGHRRSLAPNSLQ 81

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +R ++ +   +  R+ NP+  ++ P+K   LP TL  D +   L           
Sbjct: 82  RQLSALRAYFEWESSDTGRRRNPALAVQAPRKRRKLPGTLEADQVGVYLRA--------D 133

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                ++R   + EL Y++G+R+ EL  ++ + ++  +  + + GKG+K R V +  +A+
Sbjct: 134 AEDPLQLRDLAMAELFYSSGLRLGELRAVNLYDIDRGQSLISVTGKGSKTRTVPVGSAAI 193

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  Y        ++ +D      S++   +S +     ++ LA R G+  +++ PH++
Sbjct: 194 AAIDAYLPHR-PAAVSDDDQEALFLSSRGRRISERSIQSRVQLLAERNGL-GRDVHPHML 251

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           RH+FASHLLE   DLR +Q LLGH+DISTTQIYTHL    L K+    HP A+K+K   
Sbjct: 252 RHSFASHLLESSGDLRAVQELLGHSDISTTQIYTHLDFQHLAKVYDGSHPRARKQKDDD 310


>gi|330936913|gb|EGH41038.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           pisi str. 1704B]
          Length = 298

 Score =  185 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 159/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLISAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGVRGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   ++ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEESIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQELHAKHHPRG 298


>gi|229031461|ref|ZP_04187461.1| Tyrosine recombinase xerC [Bacillus cereus AH1271]
 gi|228729750|gb|EEL80730.1| Tyrosine recombinase xerC [Bacillus cereus AH1271]
          Length = 299

 Score =  185 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 150/294 (51%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDVTYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +  L E          
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELEELFEV-------SD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKTCSSM--KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
            AL  Y +         T     +   + K   L+ +     L  L  +A +  + ISPH
Sbjct: 187 DALITYIENGRKQLAHKTEEHSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMR-ISPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 246 MLRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|46201486|ref|ZP_00208119.1| COG4974: Site-specific recombinase XerD [Magnetospirillum
           magnetotacticum MS-1]
          Length = 305

 Score =  185 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 121/296 (40%), Positives = 180/296 (60%), Gaps = 7/296 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MM  ER +S NTL AY RDL +   FL+ +  S   A    + +Y+   ++  +   +Q 
Sbjct: 15  MMQVERGASPNTLDAYGRDLADFAEFLDGRGQSPLNAEGRSVAAYIARQAEIGMAARTQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S ++QFY F   E LR D+P+  ++ P+    LPK L K+ +  LL+ A+      A
Sbjct: 75  RRLSCLKQFYGFAFAERLRPDDPTANIDAPRLGRPLPKYLRKEEVTALLDAAR------A 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 + +  L+E LYATG+RVSELV+L    +      ++++GKG+KER+V LS  A 
Sbjct: 129 LEGRDGILMTALMETLYATGLRVSELVSLPLSAVARDPNVLVVRGKGSKERMVPLSDPAR 188

Query: 181 HALQMYKKTC-SSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
            AL  +K    + +  +    WLFPSS + GHL+R  FA+ L   A  AG+    +SPH+
Sbjct: 189 AALIAWKAERETMVPKSRPSRWLFPSSGRLGHLTRSGFAKMLARAAVLAGLDPFKVSPHV 248

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           +RH+FASHLL GGADLR++Q +LGH DI+TT+IYTHL+ D+  +LV+ +HPLA K+
Sbjct: 249 LRHSFASHLLAGGADLRSVQEMLGHADIATTEIYTHLIDDEASRLVRAHHPLAAKK 304


>gi|330985052|gb|EGH83155.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 298

 Score =  185 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 98/291 (33%), Positives = 158/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLPSAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQELHAKHHPRG 298


>gi|163851935|ref|YP_001639978.1| tyrosine recombinase XerD [Methylobacterium extorquens PA1]
 gi|163663540|gb|ABY30907.1| tyrosine recombinase XerD [Methylobacterium extorquens PA1]
          Length = 328

 Score =  185 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 155/294 (52%), Gaps = 2/294 (0%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER ++ NTL+AY+RDL +   +L    I    A    + +Y+  L  R L  SS  
Sbjct: 22  MLAAERGAAANTLAAYRRDLDDYLGYLAQGGIDPEEAQAEQVRAYIASLEPRGLKASSAA 81

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S IR F+ FL  EG  + +P+  +  P++   LPK L    +  LL  A+   E   
Sbjct: 82  RRLSCIRGFHRFLYAEGYAETDPTAPVAAPRRAKGLPKVLSVAEVDRLLATARERVEAAG 141

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             + +      ++ LL         +  L A   +             K     L P   
Sbjct: 142 DDRAEARAAARMLCLLELLYATGLRVSELVALPRSAAATRERYLVVKGKGGRERLVPLTD 201

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A +  +   + +   G+ L+   S   +GHL+RQ FARDLK  AA AG++   +SPH++
Sbjct: 202 LAREAMRTHVAHLTAEGSWLFPAESE--SGHLTRQAFARDLKTAAAAAGLRTDRVSPHVL 259

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L+ +V+D HPL  +
Sbjct: 260 RHAFASHLLQNGADLRIVQELLGHADISTTQIYTHVLDERLKGMVRDLHPLNDR 313


>gi|260775484|ref|ZP_05884381.1| site-specific recombinase XerD [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608665|gb|EEX34830.1| site-specific recombinase XerD [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 302

 Score =  185 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 105/291 (36%), Positives = 167/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           M  ER  S NTL++Y+ DL ++  ++      L   S + L  Y + L  +    +S+ R
Sbjct: 19  MWLERGLSENTLASYRNDLSKLLQWMTENNYRLDFISLSGLQDYQSWLMDQGYKQTSRAR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR+ + +L  E +R D+PS  L  PK    LPK L ++ +  LL           P
Sbjct: 79  MLSAIRRLFQYLHREKVRADDPSALLVSPKLPKRLPKDLSEEQVEALLNAP-------DP 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+ 
Sbjct: 132 NDAMELRDKAMLELLYATGLRVTELVSLTMENVSLRQGVVRVTGKGGKERLVPMGENAVD 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ + +   S  +      +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 192 WIETFIQQGRSELLGETTSDVVFPSKRARQMTRQTFWYRIKHYAVLAGIDTEMLSPHVLR 251

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 252 HAFATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHSEHHPRA 302


>gi|83313028|ref|YP_423292.1| site-specific recombinase XerD [Magnetospirillum magneticum AMB-1]
 gi|82947869|dbj|BAE52733.1| Site-specific recombinase XerD [Magnetospirillum magneticum AMB-1]
          Length = 308

 Score =  185 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 119/295 (40%), Positives = 179/295 (60%), Gaps = 7/295 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MM  ER +S NTL AY RDL +   FL+ +  S   A    + +Y+   ++  +   +Q 
Sbjct: 15  MMQVERGASPNTLDAYGRDLADFAEFLDGRGFSPLRADARAVAAYIARQAEIGMAARTQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S ++QFY F+  E LR D+P+  ++ P+    LPK L ++ +  LL+ A+      A
Sbjct: 75  RRLSCLKQFYGFVFAERLRPDDPTANIDAPRLGRPLPKYLRREEVTALLDAAR------A 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 + +  L+E LYA G+RVSELV+L    +      ++++GKG+KER+V LS  A 
Sbjct: 129 LEGSDGILMTALLETLYAAGLRVSELVSLPLSAVARDPSVLVVRGKGSKERMVPLSDPAR 188

Query: 181 HALQMYKKTCSSM-KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
            AL  +K    ++   +    WLFPSS   GHL+R  FA+ L  +A  AG+    +SPH+
Sbjct: 189 AALLAWKVERQTLVPKSKPSRWLFPSSGALGHLTRSGFAKMLGRVAVLAGLDPAKVSPHV 248

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           +RH+FASHLL GGADLR++Q +LGH DI+TT+IYTHL+ D+  +LV+ +HPLA K
Sbjct: 249 LRHSFASHLLAGGADLRSVQEMLGHADIATTEIYTHLIDDEAGRLVRAHHPLAAK 303


>gi|330950740|gb|EGH51000.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae Cit
           7]
          Length = 298

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 96/291 (32%), Positives = 158/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLISAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   ++ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEESIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   S++   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSSRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQELHAKHHPRG 298


>gi|283782472|ref|YP_003373227.1| tyrosine recombinase XerC [Pirellula staleyi DSM 6068]
 gi|283440925|gb|ADB19367.1| tyrosine recombinase XerC [Pirellula staleyi DSM 6068]
          Length = 323

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 92/311 (29%), Positives = 151/311 (48%), Gaps = 24/311 (7%)

Query: 1   MMS---SERASSINTLSAYKRDLKEMQNFLNN---KEISLSAASTNHLISYLNHLSQRKL 54
            +     ER ++  T  +Y+ DL  + ++L     +E   S  +   L  Y++ L +   
Sbjct: 8   FLRYLVVERGAAELTSKSYREDLTSLADYLTQAYGREPKPSEITPLDLRGYVSALHEAGY 67

Query: 55  VTSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKI 114
             +S  R+++ +R FY F   EG+   NP+  L  P+K+  LP  L  D +  LLE    
Sbjct: 68  AKTSIARRLASLRTFYKFAQREGMADSNPAKPLRNPRKDRKLPHFLAGDELGKLLEAPPA 127

Query: 115 EAENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVI 174
           +           +R   ++E LY+ G+RVSELV ++   L+L E  + I+GKG+KERL  
Sbjct: 128 D-------DPAGLRDRAMLETLYSAGLRVSELVGMNDEDLDLDEGVVRIRGKGSKERLAP 180

Query: 175 LSPSALHALQMYKKTC----------SSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKAL 224
           L   AL A++ +                            ++     L+ +  AR L+  
Sbjct: 181 LGSFALRAIKKWLAHRKLASISVSSTRKSASKAGHGTPVFTNKFGKRLTTRSVARMLEKY 240

Query: 225 AARAGIQKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKL 284
               G+  +  +PH +RH FA+HLL+ GAD+R++Q LLGH  + TTQIYTH+    L+ +
Sbjct: 241 LKLTGLDLRT-TPHTLRHTFATHLLDRGADIRSVQELLGHKSLVTTQIYTHVSTAALKAV 299

Query: 285 VQDYHPLAKKE 295
            +  HP A+ +
Sbjct: 300 YERAHPRARNK 310


>gi|238855202|ref|ZP_04645521.1| tyrosine recombinase XerD [Lactobacillus jensenii 269-3]
 gi|260664565|ref|ZP_05865417.1| tyrosine recombinase XerD [Lactobacillus jensenii SJ-7A-US]
 gi|282932504|ref|ZP_06337929.1| tyrosine recombinase XerD [Lactobacillus jensenii 208-1]
 gi|313471969|ref|ZP_07812461.1| tyrosine recombinase XerD [Lactobacillus jensenii 1153]
 gi|238832094|gb|EEQ24412.1| tyrosine recombinase XerD [Lactobacillus jensenii 269-3]
 gi|260561630|gb|EEX27602.1| tyrosine recombinase XerD [Lactobacillus jensenii SJ-7A-US]
 gi|281303453|gb|EFA95630.1| tyrosine recombinase XerD [Lactobacillus jensenii 208-1]
 gi|313449040|gb|EFR61308.1| tyrosine recombinase XerD [Lactobacillus jensenii 1153]
          Length = 300

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 94/296 (31%), Positives = 147/296 (49%), Gaps = 11/296 (3%)

Query: 1   MMSS---ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +     ER  S NT+++Y+ DL +   +L+ ++IS        + SYL         TS
Sbjct: 12  FLRFCSLERGLSKNTVNSYQLDLNQFVEYLDKEKISDWPEDPLVIDSYLAKQRDEGKKTS 71

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           +  R I+ +R+FY +L  + +   +P   ++ PK+   LP  L +  ++ LL Q  +   
Sbjct: 72  TISRGITTLRRFYRYLLRQHILVVDPLIQIDTPKQEKRLPLALSQKEVSELLAQPNL--- 128

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                    +R   ++ELLYATGMRVSEL+ L    L+   + + + GKG+KERLV ++ 
Sbjct: 129 ----NTATGLRDRAILELLYATGMRVSELINLKETDLHTDLKIIRVLGKGSKERLVPVTD 184

Query: 178 SALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            AL+ +  Y K       +       F           +          ++     K+I+
Sbjct: 185 FALNWVDKYLKEVRDPALLKKGVACDFLFLNNRAGQLTRQAVWQSIKKYSKLARIDKDIT 244

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           PH +RH FA+HLLE GADLR +Q +LGH+DISTTQIYT+L    +  +    HP A
Sbjct: 245 PHTLRHTFATHLLENGADLRVVQEILGHSDISTTQIYTNLSQKHIFDVYLKTHPRA 300


>gi|330975463|gb|EGH75529.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           aptata str. DSM 50252]
          Length = 298

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 158/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLISAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   ++ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEESIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQELHAKHHPRG 298


>gi|317128498|ref|YP_004094780.1| tyrosine recombinase XerD [Bacillus cellulosilyticus DSM 2522]
 gi|315473446|gb|ADU30049.1| tyrosine recombinase XerD [Bacillus cellulosilyticus DSM 2522]
          Length = 296

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 102/293 (34%), Positives = 150/293 (51%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           +  ER  S NT  AY RDL     ++     +  ++  +   ++ YL  L       ++ 
Sbjct: 12  LIVERGLSKNTTEAYNRDLTAYIQYIESHENKKDVNEINRPAIMQYLYFLKDNGRAPTTI 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS IR F+ FL  E L   +P+  +  PK+   LPK L    +  L+          
Sbjct: 72  TRNISSIRAFHQFLLRERLSSSDPTIHISRPKQEKKLPKILSTTEVEALISA-------S 124

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++E+LYATG+RVSEL  LS   L+L    +   GKGNKER++ +   A
Sbjct: 125 VKNPALNIRNKAMLEVLYATGIRVSELCQLSLSDLHLDMGFIRCIGKGNKERIIPIGNVA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             AL+ Y +      +      +   +     +SRQ F + +K LA  A I KK ++PH 
Sbjct: 185 TKALETYLQKSRPTLLKKQAHSILFVNHHGNKMSRQGFWKIIKLLAKEANI-KKELTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +++ +   YHP A
Sbjct: 244 LRHSFATHLLENGADLRAVQEMLGHVDISTTQIYTHITKTRMKDVYSRYHPRA 296


>gi|148981819|ref|ZP_01816536.1| site-specific tyrosine recombinase XerD [Vibrionales bacterium
           SWAT-3]
 gi|145960727|gb|EDK26067.1| site-specific tyrosine recombinase XerD [Vibrionales bacterium
           SWAT-3]
          Length = 304

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 164/288 (56%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL +Y+ DL ++  ++      L   S + L  Y + L       +S+ R +S
Sbjct: 24  ERGLSENTLVSYRTDLSKLLTWMEQNNYRLDFISLSGLQDYQSWLVDADFKQTSRARMLS 83

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK L ++ +  LL+          P   
Sbjct: 84  AIRRLFQYLHREKVRADDPSALLISPKLPQRLPKDLSEEQVDALLDAP-------DPNDP 136

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 137 IELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVIGKGGKERLVPMGENAVDWIE 196

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +      +  N   +   S +   ++RQ F   +K  A  AGI  + +SPH++RHAF
Sbjct: 197 SFIEQGRPQLLGENSSDVVFPSKRAKQMTRQTFWYRIKHYAVIAGIDTELLSPHVLRHAF 256

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+++   +HP A
Sbjct: 257 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQIHTQHHPRA 304


>gi|167032086|ref|YP_001667317.1| site-specific tyrosine recombinase XerD [Pseudomonas putida GB-1]
 gi|166858574|gb|ABY96981.1| tyrosine recombinase XerD [Pseudomonas putida GB-1]
          Length = 298

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 100/291 (34%), Positives = 161/291 (55%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + +SL  A    ++ +L     +     S  R
Sbjct: 16  LWLEKGLSDNTRVSYRSDLALFNGWLQEQAVSLPDAGRELILDHLAWRLDQGYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R F+ +L  E L   +P+  +++P+    LPK+L +  +  LL+           
Sbjct: 76  FLSGLRGFFRYLLRERLVAIDPTLQVDMPQLGKPLPKSLSEADVEALLQAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
           G+    R   ++E+LYA G+RV+ELV+L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 GEAIGQRDRAMLEVLYACGLRVTELVSLTLDQVNLRQGVLRVMGKGSKERLVPMGEEAVV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y++   +  + G    +   S +   ++RQ F   +K  A  AGI K  +SPH +R
Sbjct: 189 WLERYQRDGRAELLNGRPSDVLFPSLRGEQMTRQTFWHRIKHHARVAGIDKP-LSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVAKARLQQLHAQHHPRG 298


>gi|315127593|ref|YP_004069596.1| site-specific tyrosine recombinase XerD [Pseudoalteromonas sp.
           SM9913]
 gi|315016107|gb|ADT69445.1| site-specific tyrosine recombinase XerD [Pseudoalteromonas sp.
           SM9913]
          Length = 308

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 160/291 (54%), Gaps = 11/291 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NTLSAY+ DL +   FL  K  SL   ++  + SYL H     L   S  R
Sbjct: 29  LYLEQGVSENTLSAYRSDLDKFCQFL--KGESLMTVTSLDVESYLAHRVDLGLKPRSTAR 86

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            IS +++FY +   E +  D+P   +  PK    LPKTL +  +  LL    IE      
Sbjct: 87  SISALKRFYQYFVREKIISDSPMVNIAQPKAGQSLPKTLSEAEVEALLSAPNIE------ 140

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +   +R   ++ELLYATG+RV+ELV L    +NL +  + ++GKGNKERLV L   A++
Sbjct: 141 -EPMGLRDKAMLELLYATGLRVTELVGLRMEQINLRQAVVFVKGKGNKERLVPLGEEAMY 199

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ + K   +  +     ++FPS    G   +  + R        +      +SPH +R
Sbjct: 200 WLEQFLKLGRAQMIKHATDFVFPSKRGVGMTRQTFWHRIKHYAILASVESP--LSPHTLR 257

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q++LGH+D+STTQIYTH+  ++L+ +  ++HP A
Sbjct: 258 HAFATHLLNHGADLRVVQMMLGHSDLSTTQIYTHVANERLKSVHAEHHPRA 308


>gi|298373800|ref|ZP_06983789.1| tyrosine recombinase XerD [Bacteroidetes oral taxon 274 str. F0058]
 gi|298274852|gb|EFI16404.1| tyrosine recombinase XerD [Bacteroidetes oral taxon 274 str. F0058]
          Length = 307

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 98/294 (33%), Positives = 157/294 (53%), Gaps = 1/294 (0%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
            ++ E++ S NT+ AY RDL  +  +L+   I    A+  +L + +  L+   +   S+ 
Sbjct: 15  FLTMEKSMSENTVVAYIRDLHTLSEYLDGIGIDYRQATLTNLKNLIVELTDLGISGRSRA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS I+ FY F   + L + +P++ LE P+    LP  L  + I  ++    +   +  
Sbjct: 75  RMISGIKSFYRFCIIDRLLEADPTEQLEQPQLPLYLPDVLSVEEIDRIIVTIDLSEVDKY 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   ++E+LY +G+RVSELV      +N  E+ + I GKGNKERLV LS  A+
Sbjct: 135 TKLNIGHRNLAIVEVLYGSGVRVSELVYAKISDINFDEKFIKILGKGNKERLVPLSDPAI 194

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  +      +            + +   ++RQ+    +K +  +AGI  K +SPH  
Sbjct: 195 RAINNWFLARRVLTPKPKHEDYIFLNRRGARMTRQMVFLAIKNMVEKAGIT-KTVSPHTF 253

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH+FA+HLLE GA+LR IQ LLGH  I+TT+IYTH+    L++ + ++HP  KK
Sbjct: 254 RHSFATHLLENGANLRAIQQLLGHASITTTEIYTHVGISHLRQEIMNFHPRNKK 307


>gi|56420850|ref|YP_148168.1| site-specific tyrosine recombinase XerD [Geobacillus kaustophilus
           HTA426]
 gi|56380692|dbj|BAD76600.1| integrase/recombinase [Geobacillus kaustophilus HTA426]
          Length = 298

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 105/295 (35%), Positives = 162/295 (54%), Gaps = 12/295 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           ++ ER  + NT+ +Y+RDLK+   +L    +  +       H++ +L  LS++     + 
Sbjct: 12  LTVERNLAHNTIVSYERDLKKYVRYLRQVEQLQAWGEVERLHILHFLKFLSEQGQSARTI 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R ++ IR F+ FL  E +   +P+  +E P+    LPK L  + +  LL   ++     
Sbjct: 72  ARHLASIRSFHQFLLREKIAAQDPTVHIETPQFERTLPKVLSVEEVEALLAAPQV----- 126

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATGMRVSELV L+   ++LT   +   GKG KER+V +   A
Sbjct: 127 --STPFGLRDKAMLELLYATGMRVSELVQLNLSDVHLTMGFVRCYGKGRKERIVPIGRMA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLF--PSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           + AL  Y +      +            +     L+RQ F + LK LA  AGI+K+ ++P
Sbjct: 185 IEALAHYLERGRPQLVNPRRRATEALFLNHYGQRLTRQGFWKILKRLAKEAGIEKE-LTP 243

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR +Q LLGH DISTTQ+YTH+   +L+ + + YHP A
Sbjct: 244 HTLRHSFATHLLENGADLRAVQELLGHADISTTQMYTHVTKTRLKDVYKQYHPRA 298


>gi|315038190|ref|YP_004031758.1| tyrosine recombinase XerD [Lactobacillus amylovorus GRL 1112]
 gi|312276323|gb|ADQ58963.1| tyrosine recombinase XerD [Lactobacillus amylovorus GRL 1112]
          Length = 301

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 167/291 (57%), Gaps = 10/291 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT+SAY++DL+E  +F+  + +S      + + ++L         TSS  R 
Sbjct: 18  QVERGLSTNTISAYRQDLEEYLSFIKKEGMSSWPTEASDVDAFLARQRDLNKATSSISRL 77

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           IS +R+FY +L  + ++K NP   ++LPKK   LP  L ++ +  LLEQ  +E       
Sbjct: 78  ISSMRKFYQWLARQNIQKLNPMLEIDLPKKERRLPTALSREEVNRLLEQPDVE------- 130

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
           Q   +R   ++E LYATGMRVSEL+ L    ++     + + GKG+KERL+ +SP ALH 
Sbjct: 131 QKLGLRDRAILETLYATGMRVSELINLELQDIHEDLGLIRVLGKGSKERLIPISPVALHW 190

Query: 183 LQMYKKTCSS--MKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           +  Y+K      +  +G +      + + G L+RQ   + +K     AGI  K+++PH +
Sbjct: 191 IDKYQKQVRDPLILKSGKNDEHLFLNNRGGKLTRQAIWQMIKKYCQMAGIT-KDVTPHTL 249

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           RH FA+HLLE GADLR +Q +LGH+DISTTQIYT+L    + ++ Q  HP 
Sbjct: 250 RHTFATHLLENGADLRVVQEILGHSDISTTQIYTNLSQKHILQVYQKTHPR 300


>gi|294637959|ref|ZP_06716226.1| tyrosine recombinase XerC [Edwardsiella tarda ATCC 23685]
 gi|291088891|gb|EFE21452.1| tyrosine recombinase XerC [Edwardsiella tarda ATCC 23685]
          Length = 303

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 85/297 (28%), Positives = 142/297 (47%), Gaps = 13/297 (4%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M+  ER  S  T+  Y+R L  +   L    +    A  +  + + +    ++ L  +S 
Sbjct: 18  MLRVERQLSPRTVDTYRRQLAAIIALLQESGVTDWLALDSARVRALVARSRRQGLEPASL 77

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
             ++S +R F ++    G    NP+  +  P++   LPK L  D +  LL          
Sbjct: 78  ALRLSALRSFLDWQVSCGALAANPAKGVAAPRQGRHLPKNLDVDDVNRLLA--------I 129

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  VR   ++EL+Y  G+R+SELV L    L+L    + + GKG+KER + +   A
Sbjct: 130 DESDTLAVRDRAMLELMYGGGLRLSELVGLDCRHLDLATGEVWVLGKGSKERRLPIGREA 189

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  ++ +     +++   + L++       G +S +   +       + G+   +I PH 
Sbjct: 190 VRWVEKWLALRIALQPQDDALFISSR---GGRISPRNVQKRFAEWGVKQGVTS-HIHPHK 245

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           +RH+FA+HLLE   DLR +Q LLGH ++STTQIYTHL    L  +    HP AK+ K
Sbjct: 246 LRHSFATHLLESSGDLRAVQELLGHANLSTTQIYTHLDFQHLANVYDAAHPRAKRGK 302


>gi|289625892|ref|ZP_06458846.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646210|ref|ZP_06477553.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|298488278|ref|ZP_07006311.1| Site-specific recombinase XerD [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157217|gb|EFH98304.1| Site-specific recombinase XerD [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330867528|gb|EGH02237.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 298

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 158/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLPSAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEMHAKHHPRG 298


>gi|261417849|ref|YP_003251531.1| site-specific tyrosine recombinase XerD [Geobacillus sp. Y412MC61]
 gi|297529517|ref|YP_003670792.1| tyrosine recombinase XerD [Geobacillus sp. C56-T3]
 gi|319767339|ref|YP_004132840.1| tyrosine recombinase XerD [Geobacillus sp. Y412MC52]
 gi|261374306|gb|ACX77049.1| tyrosine recombinase XerD [Geobacillus sp. Y412MC61]
 gi|297252769|gb|ADI26215.1| tyrosine recombinase XerD [Geobacillus sp. C56-T3]
 gi|317112205|gb|ADU94697.1| tyrosine recombinase XerD [Geobacillus sp. Y412MC52]
          Length = 298

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 105/295 (35%), Positives = 162/295 (54%), Gaps = 12/295 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN--NKEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           ++ ER  + NT+ +Y+RDLK+   +L    +  +       H++ +L  LS++     + 
Sbjct: 12  LTVERNLAHNTIVSYERDLKKYVRYLRQVEQLQAWGEVERLHILHFLKFLSEQGQSARTI 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R ++ IR F+ FL  E +   +P+  +E P+    LPK L  + +  LL   ++     
Sbjct: 72  ARHLASIRSFHQFLLREKIAAQDPTVHIETPQFERTLPKVLSVEEVEALLAAPQV----- 126

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++ELLYATGMRVSELV L+   ++LT   +   GKG KER+V +   A
Sbjct: 127 --STPFGLRDKAMLELLYATGMRVSELVQLNLADVHLTMGFVRCYGKGRKERIVPIGRMA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLF--PSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           + AL  Y +      +            +     L+RQ F + LK LA  AGI+K+ ++P
Sbjct: 185 IEALAHYLERGRPQLVNPRRRATEALFLNHYGQRLTRQGFWKILKRLAKEAGIEKE-LTP 243

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR +Q LLGH DISTTQ+YTH+   +L+ + + YHP A
Sbjct: 244 HTLRHSFATHLLENGADLRAVQELLGHADISTTQMYTHVTKTRLKDVYKQYHPRA 298


>gi|193215186|ref|YP_001996385.1| tyrosine recombinase XerD [Chloroherpeton thalassium ATCC 35110]
 gi|193088663|gb|ACF13938.1| tyrosine recombinase XerD [Chloroherpeton thalassium ATCC 35110]
          Length = 305

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 101/291 (34%), Positives = 151/291 (51%), Gaps = 4/291 (1%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT ++Y  DL     ++ +   +L       +  ++  L    L  SS  R
Sbjct: 19  LRLERNLSENTKASYAHDLTRYLLYVQDSHENLDEVRAEDVRKFITELHDLGLEASSISR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            IS IR  + FL  E   + N ++ + LPK    LP  L++  +  LLE          P
Sbjct: 79  NISAIRSLHKFLSAEKKIRKNVAEEVILPKLGKYLPTVLNQQEVDKLLEMP---LHPENP 135

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E LYATG+RVSELV L    L        I GKG KERLV +  SA+H
Sbjct: 136 KPKLAIRDKAILEFLYATGVRVSELVELKQQNLFFDSGFARIFGKGAKERLVPVGSSAIH 195

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           A++ Y+KT     +          + +   L+R      ++  A +AGI+ K+ISPH +R
Sbjct: 196 AVETYQKTIRIKLVNRASADFLFLNARGKKLTRMSIYNIVQEYAQQAGIE-KSISPHTLR 254

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLEGGADLR++Q +LGH+ I  TQIYTH+    ++++ + +HP  
Sbjct: 255 HSFATHLLEGGADLRSVQEMLGHSSIKATQIYTHVDRAFIKEVHKSFHPRG 305


>gi|182680307|ref|YP_001834453.1| integrase family protein [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182636190|gb|ACB96964.1| integrase family protein [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 325

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 133/299 (44%), Positives = 189/299 (63%), Gaps = 4/299 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+ +ER ++ NTL AY RDL +    L ++  SL  A++  +  YL  L  + L  SS  
Sbjct: 16  MIGAERGAARNTLEAYGRDLTDYAQALADRGRSLLDATSEDIRHYLGDLETQGLKPSSSA 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLL---EQAKIEAE 117
           R++S IRQF+ FL  E  R D+P+  LE P+++  LPKTL    +  LL   ++   +  
Sbjct: 76  RRLSAIRQFHRFLASESHRSDDPALILEGPRRSRGLPKTLTMAEVERLLTVSKEGLEDPA 135

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
            P   + +  R   L+ELLYATG+RVSELV+L    +   +  + I+GKG +ERLV L P
Sbjct: 136 RPLGERVRAARTACLLELLYATGLRVSELVSLPDSAMRGADPLITIRGKGGRERLVPLPP 195

Query: 178 SALHALQMYKKTCSSMKMT-GNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            A  A+  Y+       +      WLFP+ ++TG+LSRQ FARDLK +AA AGI    IS
Sbjct: 196 VARRAITFYRDLLHQKHLGLSKGGWLFPADSETGYLSRQAFARDLKVVAAAAGIDTARIS 255

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           PH++RHAFASHLL+ GADLR +Q LLGH DI+TTQIYTH+L ++++ +V+D HPLA+++
Sbjct: 256 PHVLRHAFASHLLQNGADLRIVQELLGHADIATTQIYTHVLDERMKAMVRDLHPLAEEK 314


>gi|294674930|ref|YP_003575546.1| tyrosine recombinase XerD [Prevotella ruminicola 23]
 gi|294472077|gb|ADE81466.1| tyrosine recombinase XerD [Prevotella ruminicola 23]
          Length = 303

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 110/295 (37%), Positives = 169/295 (57%), Gaps = 8/295 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  +R  S NTL AY+RDL+++ ++L ++++++S  +   L  +   L    +   SQ R
Sbjct: 15  LKLQRNMSGNTLDAYQRDLRKLLDYLEHEQLAISDVTLADLEHFSASLHDIGIHPRSQCR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR F+ F+  +G R D+P++ LE P+    LP+ L    +  L E           
Sbjct: 75  ILSGIRSFFKFVQLDGYRDDDPTELLESPQIGDHLPEVLTTQEVDRLEESI-------DL 127

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +W+  R   +IE+L++ G+RVSELV L    L L E  + + GKG+KERLV +SP A+ 
Sbjct: 128 SKWEGHRNRAIIEVLFSCGLRVSELVNLKLSDLYLDEEYVRVLGKGSKERLVPISPKAIQ 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ +    + MK+   +      + +  HL+R +    +KA A  A IQ K ISPH +R
Sbjct: 188 ELRFWFNVRNLMKIKPGEEDYVFLNRRGAHLTRTMILIMIKAQAKEARIQ-KTISPHTLR 246

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           H+FA+ LLEGGADLR IQ LLGH DI TT+IYTH+    L++ + ++HP  KK  
Sbjct: 247 HSFATALLEGGADLRFIQALLGHEDIGTTEIYTHIDTSTLRQEILEHHPRNKKTN 301


>gi|218530686|ref|YP_002421502.1| tyrosine recombinase XerD [Methylobacterium chloromethanicum CM4]
 gi|218522989|gb|ACK83574.1| tyrosine recombinase XerD [Methylobacterium chloromethanicum CM4]
          Length = 328

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 154/294 (52%), Gaps = 2/294 (0%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER ++ NTL+AY+RDL +   +L    I    A    + +Y+  L  R L  SS  
Sbjct: 22  MLAAERGAAANTLAAYRRDLDDYLGYLAQGGIDPEEAQAEQVRAYIASLEPRGLKASSAA 81

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S IR F+ FL  EG  + +P+  +  P++   LPK L    +  LL  A+   E   
Sbjct: 82  RRLSCIRGFHRFLYAEGYSETDPTAPVAAPRRAKGLPKVLSVAEVDRLLATARERVEAAG 141

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             + +      ++ LL         +  L A   +             K     L P   
Sbjct: 142 DDRAEARAAARMLCLLELLYATGLRVSELVALPRSAAATRERYLVVKGKGGRERLVPLTD 201

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A +  +   + +   G  L+   S   +GHL+RQ FARDLK  AA AG++   +SPH++
Sbjct: 202 LAREAMRTHVAHLTAEGAWLFPAESE--SGHLTRQAFARDLKTAAAAAGLRTDRVSPHVL 259

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L+ +V+D HPL  +
Sbjct: 260 RHAFASHLLQNGADLRIVQELLGHADISTTQIYTHVLDERLKGMVRDLHPLNDR 313


>gi|302335890|ref|YP_003801097.1| tyrosine recombinase XerD [Olsenella uli DSM 7084]
 gi|301319730|gb|ADK68217.1| tyrosine recombinase XerD [Olsenella uli DSM 7084]
          Length = 321

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 101/307 (32%), Positives = 157/307 (51%), Gaps = 15/307 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER SS NTL AY RDL      L  +      A S + + +YL  L++  L  SS +
Sbjct: 14  LAIERGSSPNTLEAYGRDLGRYVAHLRGRGADDPDAVSRHDIEAYLETLAEGGLSPSSVQ 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ I+ F+ F+  E + +++P+  L LP+K   LP TL  + +  LL++   +A  PA
Sbjct: 74  RSVAAIKGFHRFMVSEQITENHPTADLPLPRKALHLPDTLSHEQVFRLLDEPFQDACRPA 133

Query: 121 P-----------GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNK 169
           P           G  +  R   ++E+LY  G+RVSEL +L    + L +  + I GKG+K
Sbjct: 134 PRALADGGTDDSGAARFYRDKAILEVLYGCGLRVSELCSLELRDVLLDDEVLRILGKGSK 193

Query: 170 ERLVILSPSALHALQMYK-KTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARA 228
           ER+V +  +A  AL  Y       +             ++   +SRQ     ++      
Sbjct: 194 ERVVPILGTAARALGSYLEDWRPLLLKPPRICPAVFLGSRGTKISRQAVFGIVERYGRLT 253

Query: 229 GIQKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDY 288
           GI+   + PH +RH++A+HLLEGG DLR +Q LLGH  ISTTQ+YTH+    ++      
Sbjct: 254 GIEG--LHPHSLRHSYATHLLEGGMDLRAVQELLGHASISTTQLYTHVDRTHVRMAYLAA 311

Query: 289 HPLAKKE 295
           HP A + 
Sbjct: 312 HPRADRR 318


>gi|254515505|ref|ZP_05127565.1| tyrosine recombinase XerC [gamma proteobacterium NOR5-3]
 gi|219675227|gb|EED31593.1| tyrosine recombinase XerC [gamma proteobacterium NOR5-3]
          Length = 311

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 92/299 (30%), Positives = 159/299 (53%), Gaps = 11/299 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           + S R  S +T++AY+RDL   ++F     ++  S    +H+  +L    +  L  +S +
Sbjct: 22  LRSVRRLSSHTVTAYRRDLDSFEDFCQQHSVTGCSDVQESHVRQWLAQGHRTGLAPNSLQ 81

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +R ++ +   +  ++ NP+  ++ P+K   LP TL  D +   L           
Sbjct: 82  RRLSALRAYFQWESSDTGQRRNPALAVQAPRKRRKLPGTLEADQVGVYLRA--------D 133

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                ++R   + ELLY++G+R++EL  ++ H ++ ++  + + GKG+K R V +   A+
Sbjct: 134 DNDPLQLRDLAMAELLYSSGLRLAELRAVNIHDIDRSQSLISVTGKGSKTRTVPVGRIAI 193

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  Y     +     ++  LF S      +S +     ++ LA R G+  +++ PH++
Sbjct: 194 EAIDAYLPHRPTPTSAADEQALFVSGR-GRRISERSIQARIQLLAQRNGL-GRDVHPHML 251

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           RH+FASHLLE   DLR +Q LLGH+DISTTQIYTHL    L K+    HP A+K K   
Sbjct: 252 RHSFASHLLESSGDLRAVQELLGHSDISTTQIYTHLDFQHLAKVYDGAHPRARKRKDEN 310


>gi|262089688|gb|ACY24783.1| XerD tyrosine recombinase [uncultured organism]
          Length = 323

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 99/288 (34%), Positives = 157/288 (54%), Gaps = 8/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           E+  S NT  +Y+RDL +   +LN +   L       +  YL+   Q+KL + +  R +S
Sbjct: 44  EKGLSHNTQESYRRDLSQFAMWLNQQGRQLIGVDPALVQDYLDIRLQQKLSSRTSARFLS 103

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            +R  Y +L  E    ++P   ++ PK +  LPK+L +  +  LL               
Sbjct: 104 CVRGLYRYLLRESRISESPVALIDNPKLSRSLPKSLSETDVEALLAAP-------DLSDP 156

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++E+LYA G+RV+ELV L+   +NL +  + + GKG+KERL+ +   A   L 
Sbjct: 157 VGLRDRTMLEVLYACGLRVTELVELTMPQINLRQNVVRVMGKGSKERLIPMGEEAAAWLV 216

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            Y +    + +      +   ST+   ++RQ F   +K  A  AGI KK++SPH +RHAF
Sbjct: 217 RYLREARPVLLNNMPDEVVFPSTRAQPMTRQTFWYRIKHWAMVAGI-KKDLSPHTLRHAF 275

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+   ++++    +HP  
Sbjct: 276 ATHLLNHGADLRVVQLLLGHSDLSTTQIYTHVAKLRMKQQHAQHHPRG 323


>gi|296447748|ref|ZP_06889663.1| tyrosine recombinase XerD [Methylosinus trichosporium OB3b]
 gi|296254725|gb|EFH01837.1| tyrosine recombinase XerD [Methylosinus trichosporium OB3b]
          Length = 314

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 126/296 (42%), Positives = 183/296 (61%), Gaps = 4/296 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER ++ NTL AY+RDL++    L          +T+ L +YL  L  R +  ++  
Sbjct: 16  MLAAERGAARNTLDAYRRDLEDYVAHLERTGAEPLGVTTDGLRAYLATLQSRGMTAATSA 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKI---EAE 117
           R++S +RQF+ FL  +  R D+PS  LE P++ H  P  L  D +  LLE A+    +  
Sbjct: 76  RRLSALRQFHKFLYVDRYRADDPSTPLEGPRRQHSAPDILAMDEVERLLETAREGLEDES 135

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
             A  + +  R++ L+E LYATG+RVSELV+L A      +    ++GKG+KERL  ++P
Sbjct: 136 RAAGERLRAARLYALLETLYATGLRVSELVSLPASAARSRDSFFTVRGKGSKERLAPMTP 195

Query: 178 SALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            A  AL +++           +  +LFPS    GHL+RQ FARDLK  AA AG+  ++IS
Sbjct: 196 RAKAALTVFRALLAKHAPGLADSHFLFPSDAAEGHLTRQAFARDLKTAAAAAGLSARDIS 255

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           PH +RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++++ +V+D HPL 
Sbjct: 256 PHALRHAFASHLLQNGADLRVVQELLGHADISTTQIYTHVLDERIRAMVRDLHPLG 311


>gi|257063600|ref|YP_003143272.1| tyrosine recombinase XerD [Slackia heliotrinireducens DSM 20476]
 gi|256791253|gb|ACV21923.1| tyrosine recombinase XerD [Slackia heliotrinireducens DSM 20476]
          Length = 309

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 98/292 (33%), Positives = 148/292 (50%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSA-ASTNHLISYLNHLSQRKLVTSSQR 60
           +S ER SS  T+ +Y  DL +  +FL  + +  SA  + + +++Y   L +R    SS  
Sbjct: 22  LSVERGSSSLTVGSYATDLNDYISFLGERGVPDSAAITRDDVVAYEYDLRRRGYADSSIE 81

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S ++ F+ FL  EG+ K NP+D + LPK    LP  L    +  LL+Q   +     
Sbjct: 82  RHLSALKGFHRFLVGEGVTKGNPADLVSLPKVPDRLPDVLSVSEVNELLDQPFKDG---- 137

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R    +ELLY  G+R SEL++L    +   E  + + GKG++ER+V +  SA 
Sbjct: 138 ---PLGLRDQAALELLYGCGLRASELISLDLGDVFFAEGILRVMGKGSRERIVPIGGSAQ 194

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L  Y +     K+                      A       A A I + ++ PH +
Sbjct: 195 RVLLDYLENGRP-KLAKPSKTDGAVILNARGGRLSRQALHTIVRTAGATIGRPDLHPHTL 253

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+H+LEGGADLRTIQ +LGH+DISTTQIY H+    +++     HP A
Sbjct: 254 RHSFATHMLEGGADLRTIQEILGHSDISTTQIYVHVDRSHIREEYLAAHPRA 305


>gi|293376592|ref|ZP_06622820.1| tyrosine recombinase XerD [Turicibacter sanguinis PC909]
 gi|292644818|gb|EFF62900.1| tyrosine recombinase XerD [Turicibacter sanguinis PC909]
          Length = 305

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 110/295 (37%), Positives = 167/295 (56%), Gaps = 10/295 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  +R  S+NT  +Y+RDL E   +L N+ +  L      H+  YL  L +R L T S  
Sbjct: 16  LLIDRGLSLNTKISYERDLTEYLLYLQNQSVHQLDEIRREHVQQYLITLYERNLNTKSVA 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S IR F+ +L  E +   NP + +E PK    LP+ L  D + +LL           
Sbjct: 76  RHLSAIRSFHQYLMIEKISNTNPCELIESPKLKRHLPEILSIDEVEHLLSS-------FN 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++EL+YA+G+RVSEL+ L    ++L+   +   GKG+KER+V +   A 
Sbjct: 129 TKTVNDIRNKAMVELMYASGLRVSELLQLKLDDVHLSMMFVRCVGKGDKERIVPIGEVAT 188

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             LQ+Y  T     +  ++ WLF +      ++RQ F + LK  A  AGI+K+ ISPH +
Sbjct: 189 ELLQLYLDTARPKLLKKSNDWLFLNRF-GEVMTRQGFWKILKKQAKEAGIEKE-ISPHKL 246

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           RH+FA+HL+E G DLR +Q +LGH+DISTTQIYTH+  + L+ +   YHP ++K+
Sbjct: 247 RHSFATHLIENGVDLRLVQEMLGHSDISTTQIYTHISKEHLKDVYDLYHPRSQKD 301


>gi|118579574|ref|YP_900824.1| tyrosine recombinase XerD [Pelobacter propionicus DSM 2379]
 gi|118502284|gb|ABK98766.1| tyrosine recombinase XerD subunit [Pelobacter propionicus DSM 2379]
          Length = 295

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 109/296 (36%), Positives = 159/296 (53%), Gaps = 12/296 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVT 56
            +   + ER  + NT  AY RDL    +FL  +  +  +  +   + S+L  L    L  
Sbjct: 8   FLGYIAVERGLATNTRQAYSRDLGRYLDFLAERGKNEPAEVTAADIASFLVRLRDEGLAP 67

Query: 57  SSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEA 116
           +S+ R +S IR F+ FL  E    DNPS  LE P+  H LP  L    +  L        
Sbjct: 68  ASRARCLSAIRMFHKFLMIEKYCDDNPSAILEAPRTLHKLPAFLEPAEVDRLFSAC---- 123

Query: 117 ENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILS 176
              A    + +R   ++ELLYATG+RVSELVT++   +NL    +++ GKG+KERLV + 
Sbjct: 124 ---AGTSGEDLRDRAMLELLYATGLRVSELVTITLRQVNLDVGYLMVVGKGDKERLVPIG 180

Query: 177 PSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
            SA   ++ Y +                 S     +SRQ F   ++  A  A I  K+IS
Sbjct: 181 ESARGRVRRYIEEARYRLDPQGRTPHLFLSRLGDAMSRQAFWNLIRKRAKLAAI-AKDIS 239

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           PH +RH+FA+HLLE GADLR++QI+LGH D+S+TQIYTH+  ++L++L Q+ HP  
Sbjct: 240 PHTLRHSFATHLLENGADLRSVQIMLGHADLSSTQIYTHVTRERLKRLHQEIHPRG 295


>gi|187250446|ref|YP_001874928.1| integrase family protein [Elusimicrobium minutum Pei191]
 gi|186970606|gb|ACC97591.1| Integrase family protein [Elusimicrobium minutum Pei191]
          Length = 291

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 96/291 (32%), Positives = 150/291 (51%), Gaps = 9/291 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +S ER  S NT+ AY  D+ +   F      +      + +  Y+ HL Q+ L   S  R
Sbjct: 10  LSFERQLSKNTIYAYTNDVGDFFAFCEENNTAPQNVRPDFIDEYIYHLKQKGLSPKSVFR 69

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           K   ++ FY +L   G  K++P   L  PK    +P+TL K+ I+ LL           P
Sbjct: 70  KTQAVKSFYKYLIINGDIKEDPCRFLLSPKLTQKIPETLTKEEISRLLS--------FPP 121

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
             +  +R   ++EL YA G+RVSELV+L   ++NL ++ ++  GKG K+R + +   A+ 
Sbjct: 122 KTFAEIRTLTILELFYACGLRVSELVSLRIESVNLKDKWVLAYGKGAKQRFIPIHDRAVK 181

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L++Y                   +     +SR    +D+  L   AGI+ +++ PH+ R
Sbjct: 182 VLEIYLSEREKYLKGKESASEIFINKNGKKISRMSVWKDVNDLGRLAGIE-RSLHPHLFR 240

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H FA+HLL GGADLR++Q +LGH D+ TTQIYTHL    L++  + +HP  
Sbjct: 241 HTFATHLLIGGADLRSLQEMLGHADLQTTQIYTHLDVQSLKEKHKKFHPRG 291


>gi|270308039|ref|YP_003330097.1| site-specific recombinase [Dehalococcoides sp. VS]
 gi|270153931|gb|ACZ61769.1| site-specific recombinase [Dehalococcoides sp. VS]
          Length = 307

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 107/296 (36%), Positives = 163/296 (55%), Gaps = 9/296 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +S E+  S  TL  Y+ DL    N+L  K++S         L  Y++ L  + +V  S  
Sbjct: 12  LSVEKNVSAYTLRNYRTDLIGFVNYLIEKKVSSFDRVDRYILRDYMSSLIAKGIVKGSIA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R FY +L  EGL + NP+     P+ +  LP+ L    ++ LL         P 
Sbjct: 72  RKLSAVRSFYRYLMREGLIQKNPTLNASSPRLDKRLPEFLTTAEVSKLLR-------MPD 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               + +R    +ELLYA+G+RVSELV L    L+L    + + GKG+KER+V++   A+
Sbjct: 125 SSTPQGLRDKAFMELLYASGLRVSELVKLDIENLDLHSHQIRVWGKGSKERIVLMGLPAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            ++Q Y      +     +      +   G LS + F   L  LA +AGI+ K++ PH++
Sbjct: 185 QSIQTYLNLGRPLLKGKRNTPALFLNPNGGRLSARSFQERLDKLAHQAGIE-KHVHPHML 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           RH FA+HLL+GGADLR +Q LLGH+++STTQIYTH+   + +K+    HPLAK + 
Sbjct: 244 RHTFATHLLDGGADLRVVQELLGHSNLSTTQIYTHVTKSQARKVYMSSHPLAKPQN 299


>gi|238796542|ref|ZP_04640049.1| Tyrosine recombinase xerD [Yersinia mollaretii ATCC 43969]
 gi|238719520|gb|EEQ11329.1| Tyrosine recombinase xerD [Yersinia mollaretii ATCC 43969]
          Length = 299

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL  +  +L++    L  A +  L S+L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLHALTGWLDHHGSDLLRAGSQELQSFLAERIEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR D+P+  L  PK    LPK L +  +  LL    ++      
Sbjct: 76  LLSAMRRLFQYLYREKLRDDDPTAALSSPKLPQRLPKDLSEAQVDALLNAPNVDI----- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 131 --PLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYMEHGRPWLINGQALDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|329724319|gb|EGG60831.1| tyrosine recombinase XerC [Staphylococcus epidermidis VCU144]
          Length = 296

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 149/294 (50%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S  TL +Y  DL +  NFL  + + L         +YL  L   +L  ++  
Sbjct: 11  MLKVERNFSEYTLKSYHDDLVQFNNFLEREHLQLETFEYKDARNYLAFLYSNQLKRTTVS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY F   +     NP   L  PKK   LP+  +++ +  L +  + +     
Sbjct: 71  RKISTLRTFYEFWMTQDNSIINPFVQLVHPKKEKYLPQFFYEEEMEALFQTVEHD----- 125

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  ++IELLYATG+RVSEL+ +    +++    + + GKGNKER +       
Sbjct: 126 --NKKGIRDKVIIELLYATGIRVSELINIKLKDIDMNLPGVKVLGKGNKERFIPFGEFCR 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y +     ++  +D +L  +        R V       +   AG+    I PH +
Sbjct: 184 QSIERYLEEFQPKQLANHD-YLIVNMKGDPITERGVRYVLNDVVKRTAGVND--IHPHKL 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+  + HP AKK
Sbjct: 241 RHTFATHLLNQGADLRTVQSLLGHANLSTTGRYTHVSNQQLRKVYLNAHPRAKK 294


>gi|315640591|ref|ZP_07895697.1| integrase/recombinase XerD [Enterococcus italicus DSM 15952]
 gi|315483619|gb|EFU74109.1| integrase/recombinase XerD [Enterococcus italicus DSM 15952]
          Length = 296

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 98/293 (33%), Positives = 153/293 (52%), Gaps = 8/293 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
            ++ ER  S+NT S+Y+RDLK+   F+  K+I S        ++++L  L +    T++ 
Sbjct: 11  FLTIERGLSLNTRSSYERDLKQYYTFVQTKQITSWQQIDRYTILAFLEQLKKENKSTATI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R IS +R+F+ FL  E     +P   ++ PKK   LP TL    +  L++         
Sbjct: 71  TRMISSLRRFHQFLRQERHTDHDPMQHIDTPKKVQKLPDTLSLKEVERLIDTP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +   +R   ++E++YATG+RVSEL+ L    ++L    +   GKG+KER+V L   A
Sbjct: 124 DTRKILGIRDRAILEVMYATGLRVSELIQLQLSDIHLNMALLQTIGKGDKERIVPLGDMA 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +H L++Y      + ++             G    +           RA    K ++PH 
Sbjct: 184 IHWLEVYLSDARPILVSKQPNETALFVNSHGKKLTRQGIWKNLKEIVRAAGIHKTVTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLRT+Q LLGH DISTTQIYTH+   ++  + + Y P A
Sbjct: 244 LRHSFATHLLENGADLRTVQELLGHADISTTQIYTHITKKRMTDVYKQYFPRA 296


>gi|227893483|ref|ZP_04011288.1| integrase-recombinase [Lactobacillus ultunensis DSM 16047]
 gi|227864708|gb|EEJ72129.1| integrase-recombinase [Lactobacillus ultunensis DSM 16047]
          Length = 303

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 106/291 (36%), Positives = 164/291 (56%), Gaps = 10/291 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT+SAY++DL+E  +F+  + +       + + ++L         TSS  R 
Sbjct: 20  QVERGLSSNTISAYRQDLEEYLSFIEKEGMPSWPTEASDVDAFLARQRDLNKATSSISRL 79

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           IS +R+FY +L  + ++K NP   ++LPKK   LP  L ++ +  LLEQ           
Sbjct: 80  ISSMRKFYQWLARQNIQKLNPMLEIDLPKKERRLPTALTQEEVNKLLEQP-------DVK 132

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
           +   +R   ++E LYATGMRVSEL+ L    L+     + + GKG+KERL+ +SP AL+ 
Sbjct: 133 RKLGLRDRAILETLYATGMRVSELINLELQDLHDDLGLVRVIGKGSKERLIPISPVALNW 192

Query: 183 LQMYKKTCSSMKM--TGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           ++ Y+K      +   G +      +++   L+RQ   + +K     AGI  K+++PH +
Sbjct: 193 IKKYEKEVRDPLILHVGQNDEHIFLNSRGKMLTRQAIWQMIKKYCQMAGI-VKDVTPHTL 251

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           RH FA+HLLE GADLR +Q +LGH+DISTTQIYT+L    + ++ Q  HP 
Sbjct: 252 RHTFATHLLENGADLRVVQEILGHSDISTTQIYTNLSQKHILQVYQKTHPR 302


>gi|218708546|ref|YP_002416167.1| site-specific tyrosine recombinase XerD [Vibrio splendidus LGP32]
 gi|218321565|emb|CAV17517.1| Tyrosine recombinase xerD [Vibrio splendidus LGP32]
          Length = 320

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 165/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL +Y+ DL ++  ++      L   S + L  Y   L+      +S+ R +S
Sbjct: 40  ERGLSENTLVSYRTDLSKLLTWMEKNNYRLDFISLSGLQDYQGWLADADFKQTSRARMLS 99

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK L ++ + +LLE          P   
Sbjct: 100 AIRRLFQYLHREKVRADDPSALLISPKLPKRLPKDLSEEQVDSLLEAP-------DPNDP 152

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 153 IELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVIGKGGKERLVPMGENAVDWIE 212

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +      +  N   +   S +   ++RQ F   +K  +  AGI  + +SPH++RHAF
Sbjct: 213 TFIEQGRPQLLGDNSSDVVFPSKRAKQMTRQTFWYRIKHYSVIAGIDTELLSPHVLRHAF 272

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+++   +HP A
Sbjct: 273 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQIHAQHHPRA 320


>gi|260433976|ref|ZP_05787947.1| tyrosine recombinase XerD [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417804|gb|EEX11063.1| tyrosine recombinase XerD [Silicibacter lacuscaerulensis ITI-1157]
          Length = 316

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 117/302 (38%), Positives = 174/302 (57%), Gaps = 13/302 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +   ++E  ++ NTL AY RDLK+   +L+      + A    + +YL     + L  +
Sbjct: 14  FLEAQAAELGAATNTLLAYGRDLKDFAGWLSRHGAGFAQADQARIEAYLIDCDAQGLSRA 73

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           ++ R++S I+Q Y F   EG R  NP+  ++ P +   LPKTL    +  LL+ A+    
Sbjct: 74  TRARRLSAIKQLYRFAFEEGWRDTNPAIQIKGPGRQKRLPKTLDVAEVDRLLQAARQTG- 132

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                Q  R+R   L+ELLYATGMRV+ELV+L         R +++ GKG KER+V LSP
Sbjct: 133 ---RTQADRLRNTCLMELLYATGMRVTELVSLPVSAARGDPRMLLVLGKGGKERMVPLSP 189

Query: 178 SALHALQMYKKTCSSMKMTG------NDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ 231
            A  AL  +     +++            +LFPS  K+GHL+R  F   +K LA   G+ 
Sbjct: 190 PARDALAAWLGARDAVEEASVAKGGQRSRFLFPSRGKSGHLTRHRFFLLVKELAVCGGVS 249

Query: 232 KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
            + ++PH +RHAFA+HLL  GADLR+IQ LLGH D++TT+IYTH+L ++L +LV  +HPL
Sbjct: 250 PEKVTPHTLRHAFATHLLANGADLRSIQTLLGHADVATTEIYTHVLDERLSELVLQHHPL 309

Query: 292 AK 293
           A+
Sbjct: 310 AR 311


>gi|117620205|ref|YP_857765.1| tyrosine recombinase XerD [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117561612|gb|ABK38560.1| tyrosine recombinase XerD [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 299

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 114/291 (39%), Positives = 173/291 (59%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT+S+Y+ DL++   +L+ +  SL  A  + +  YL     ++   SS  R
Sbjct: 17  LWLERGLSDNTVSSYRTDLEKFALWLDEQGGSLLLAGLDDIQHYLAWRVDQQFAASSTAR 76

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+FY +L  E LR D+P+  LE PK    LP  L +  +  LL+   ++      
Sbjct: 77  FLSALRRFYQYLNREKLRSDDPTVLLEGPKLPKKLPSDLSEAEVEALLQAPLVD------ 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +   +R   ++ELLYATG+RVSELV L+A  ++L +  + + GKGNKERLV +   A+H
Sbjct: 131 -EPLELRDKAMLELLYATGLRVSELVGLTAEHVSLRQGLVRVVGKGNKERLVPMGEEAVH 189

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +   ++ + G    +   S +   ++RQ F   +K  A RAGIQ + +SPH +R
Sbjct: 190 WLERYYREARTLLLGGTSSDVVFPSKQARMMTRQTFWHRIKLYAQRAGIQGE-LSPHTLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH D+STTQIYTH+  ++L+ L   +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHADLSTTQIYTHVANERLKALHGQHHPRA 299


>gi|304321470|ref|YP_003855113.1| putative integrase/recombinase DNA recombination protein
           [Parvularcula bermudensis HTCC2503]
 gi|303300372|gb|ADM09971.1| putative integrase/recombinase DNA recombination protein
           [Parvularcula bermudensis HTCC2503]
          Length = 323

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 131/299 (43%), Positives = 180/299 (60%), Gaps = 5/299 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MM+ ER +S  TL  Y RDL+ +  FL  +  SL  A+   L +Y++HL  +    ++  
Sbjct: 18  MMAVERGASPRTLRNYGRDLERVSVFLFQRGTSLLRATAADLSAYIDHLHGQGRSAATAA 77

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
             +S +RQFY F   EG+R+DNP++ ++ PK    LPK L  D  A+LL+ A+ EA    
Sbjct: 78  LCLSALRQFYLFAYTEGMREDNPAELVDRPKARRPLPKILSIDEAASLLDLARDEAACMK 137

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           PG    +R+  L+E+LYATG+RVSEL +L    +   E  M + GKG KERLV L+  A+
Sbjct: 138 PGP---LRLHALLEVLYATGLRVSELCSLPRGAVRAGEPWMTVLGKGQKERLVPLTDGAV 194

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  Y    +  +      +LFPS  KTGH++    A+ LK L+ARAGI    +SPH++
Sbjct: 195 MAVSHYVAVQTDAERA--SAFLFPSRGKTGHITTARVAQLLKELSARAGIDPTRVSPHVL 252

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           RHAFASHLLEGGADLR +Q LLGH DISTTQIYTH+    L K ++  HPL     +  
Sbjct: 253 RHAFASHLLEGGADLRIVQQLLGHADISTTQIYTHIGSGSLAKTLEHRHPLGNTGNRQQ 311


>gi|325839425|ref|ZP_08166864.1| tyrosine recombinase XerD [Turicibacter sp. HGF1]
 gi|325490545|gb|EGC92861.1| tyrosine recombinase XerD [Turicibacter sp. HGF1]
          Length = 305

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 110/295 (37%), Positives = 167/295 (56%), Gaps = 10/295 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  +R  S+NT  +Y+RDL E   +L N+ +  L      H+  YL  L +R L T S  
Sbjct: 16  LLIDRGLSLNTKISYERDLTEYLLYLQNQSVHQLDEIRREHVQQYLITLYERNLNTKSVA 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S IR F+ +L  E +   NP + +E PK    LP+ L  D + +LL           
Sbjct: 76  RHLSAIRSFHQYLMIEKISNTNPCELIESPKLKRHLPEILSIDEVEHLLSS-------FN 128

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++EL+YA+G+RVSEL+ L    ++L+   +   GKG+KER+V +   A 
Sbjct: 129 TKTVNDIRNKAMVELMYASGLRVSELLQLKLDDVHLSMMFVRCVGKGDKERIVPIGEVAT 188

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             LQ+Y  T     +  ++ WLF +      ++RQ F + LK  A  AGI+K+ ISPH +
Sbjct: 189 ELLQLYLDTARPNLLKKSNDWLFLNRF-GEVMTRQGFWKILKKQAKEAGIEKE-ISPHKL 246

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           RH+FA+HL+E G DLR +Q +LGH+DISTTQIYTH+  + L+ +   YHP ++K+
Sbjct: 247 RHSFATHLIENGVDLRLVQEMLGHSDISTTQIYTHISKEHLKDVYDLYHPRSQKD 301


>gi|227328397|ref|ZP_03832421.1| site-specific tyrosine recombinase XerD [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 299

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 172/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL+ +  ++ + E  L  A +  L ++L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLRTLAEWVAHHENGLLQAQSLDLQAFLADRVEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+ +L  E LR D+PS  L  PK    LPK L +  +  LL    IE      
Sbjct: 76  LLSAMRRFFQYLYREKLRSDDPSAVLSSPKLPQRLPKDLSEAQVDALLNAPSIE------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV+L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 130 -QPLELRDKAMLEVLYATGLRVSELVSLTMSDVSLRQGVVRVLGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S++   ++RQ F   +K  A  A I  + +SPH++R
Sbjct: 189 WIEYYLEHGRPWLLNGQTLDVLFPSSRARQMTRQTFWHRIKHYAVLASIDSEKLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|319900751|ref|YP_004160479.1| tyrosine recombinase XerD subunit [Bacteroides helcogenes P 36-108]
 gi|319415782|gb|ADV42893.1| tyrosine recombinase XerD subunit [Bacteroides helcogenes P 36-108]
          Length = 317

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 99/299 (33%), Positives = 162/299 (54%), Gaps = 9/299 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E++ S NTL AY+ DL+++  FL +++I + A + + L  +   L    +   SQ R
Sbjct: 24  LRLEKSLSPNTLDAYQTDLEKLLRFLEDEKIDILAVTLDDLQRFTAGLHDIGIHPRSQAR 83

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S I+ F++FL   G  +++PS+ LE PK    LP+ L  + I  ++            
Sbjct: 84  ILSGIKSFFHFLVLAGYLENDPSELLEGPKIGFKLPEVLTVEEIDRIIAAI-------DM 136

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
              +  R   ++E LY+ G+RVSEL  L    L   E  + ++GKG+K+RLV +S  A+ 
Sbjct: 137 NTNEGQRNRAILETLYSCGLRVSELCNLKISDLYFNEGFIKVEGKGSKQRLVPISHRAIT 196

Query: 182 ALQMYKKTCSS-MKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +  +        K+  +       +     +SR +    +K LA +AGI  K+ISPH  
Sbjct: 197 EITNWLDDRKERWKIKKDFEDYVFLARWGNGISRIMIFHFIKELAEKAGIT-KSISPHTF 255

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           RH+FA+HLLEGGA+LR IQ +LGH  I+TT+IYTH+  + L+  + ++HP   K ++  
Sbjct: 256 RHSFATHLLEGGANLRAIQCMLGHESIATTEIYTHIDRNMLRSEIIEHHPRNIKYREEQ 314


>gi|326773392|ref|ZP_08232675.1| tyrosine recombinase XerD [Actinomyces viscosus C505]
 gi|326636622|gb|EGE37525.1| tyrosine recombinase XerD [Actinomyces viscosus C505]
          Length = 311

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 109/304 (35%), Positives = 157/304 (51%), Gaps = 19/304 (6%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLS-----QRKLV 55
           +  ER  S +TLSAY+RDL     +L +  IS     S N +  +L  L       R L 
Sbjct: 12  LRVERGLSPHTLSAYERDLGRYLRYLRSAGISAPQDVSRNDVAGFLEVLRTGSDGARPLA 71

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
           +SS  R ++ +R ++ FL  EG   ++PS T+  P+    LPK L  D +  LLE A ++
Sbjct: 72  SSSASRTVTAVRGWHKFLLAEGTTSEDPSATVRPPQPGRRLPKALGVDEVCRLLEAAGVD 131

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
                      +R   L+E+LYATG R+SE V L    L+   R + + GKG KER+V +
Sbjct: 132 ------DSPVSLRDRALLEVLYATGARISEAVGLVVDDLDTDSRLLRLFGKGRKERVVPM 185

Query: 176 SPSALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGI---- 230
              A  AL  Y       +   G  +     +T    LSRQ     L+  A RAG+    
Sbjct: 186 GAYAWEALDAYLVRGRPVLAEKGRGVPQVFLNTLGRPLSRQSAWAVLQQAAERAGLIGTD 245

Query: 231 --QKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDY 288
              ++ ISPH +RH+FA+HLL GGAD+R +Q +LGH  ++TTQIYT +  D L+++    
Sbjct: 246 GADERRISPHTLRHSFATHLLAGGADVRVVQEMLGHASVTTTQIYTKVTVDHLREVYATS 305

Query: 289 HPLA 292
           HP A
Sbjct: 306 HPRA 309


>gi|238783654|ref|ZP_04627674.1| Tyrosine recombinase xerD [Yersinia bercovieri ATCC 43970]
 gi|238715367|gb|EEQ07359.1| Tyrosine recombinase xerD [Yersinia bercovieri ATCC 43970]
          Length = 299

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 168/291 (57%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL  +  +L++    L  A +  L S+L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLHALTGWLDHHGSDLLRAGSQELQSFLAERIEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR D+P+  L  PK    LPK L +  +  LL    ++      
Sbjct: 76  LLSAMRRLFQYLYREKLRDDDPTAILSSPKLPQRLPKDLSEAQVDTLLNSPNVDI----- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 131 --PLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y        + G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYMDHGRPWLINGQSLDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQQHHPRA 299


>gi|116513910|ref|YP_812816.1| integrase [Lactobacillus delbrueckii subsp. bulgaricus ATCC
           BAA-365]
 gi|116093225|gb|ABJ58378.1| tyrosine recombinase XerD subunit [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|325125576|gb|ADY84906.1| Integrase-recombinase [Lactobacillus delbrueckii subsp. bulgaricus
           2038]
          Length = 298

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 99/290 (34%), Positives = 154/290 (53%), Gaps = 9/290 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT++AY++DL E   F+  +++         + ++L          SS  R 
Sbjct: 16  QIERGLSPNTIAAYQQDLLEFLAFVKEEQMPAWPLEAVEIDAFLAKERDLGKANSSISRL 75

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           +S + +FY +L  + L   +P   ++ PK+   +P  L +  +  LLEQ           
Sbjct: 76  VSTLSRFYQWLVRQQLIALDPMSQIDAPKREKRMPLALTEAEVGKLLEQP-------DLT 128

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
               +R  +L+ELLYATGMRVSE V L    ++   + + + GKG+KERL+ +S  AL  
Sbjct: 129 TDLGIRDRVLLELLYATGMRVSEAVNLQLADVHANLQLIKVLGKGSKERLIPVSALALDW 188

Query: 183 LQMYKKTCSSMKMT-GNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           ++ Y        +  G        +++ G L+RQ   + +K    +AGI  K+++PH +R
Sbjct: 189 IKRYLPVRDQQLLKRGKSSDYLFLNSRGGQLTRQAVWQKIKKYCQQAGI-AKDVTPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           H+FA+HLLE GADLR +Q +LGHTDISTTQIYT+L    +  + Q  HP 
Sbjct: 248 HSFATHLLEHGADLRVVQEILGHTDISTTQIYTNLTQKHILDVYQKTHPR 297


>gi|320323174|gb|EFW79263.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329555|gb|EFW85544.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 298

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 99/291 (34%), Positives = 158/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLPSAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTHL   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHLARARLQELHAKHHPRG 298


>gi|154498071|ref|ZP_02036449.1| hypothetical protein BACCAP_02052 [Bacteroides capillosus ATCC
           29799]
 gi|150273061|gb|EDN00218.1| hypothetical protein BACCAP_02052 [Bacteroides capillosus ATCC
           29799]
          Length = 298

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 99/291 (34%), Positives = 157/291 (53%), Gaps = 9/291 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           + +E+ +S+NTLS+Y RD+ +   +L  + ++   A+   +  Y+ HLS +    ++  R
Sbjct: 17  LKTEKKASLNTLSSYLRDIHQYAGWLEGESLTAEQANQADVERYVKHLSGKGKSVATVTR 76

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            ++ ++ FYNFL   G+   NP   +   K    LP+ L    +   LEQ         P
Sbjct: 77  SLASMKSFYNFLIGAGVVTINPVRGITPAKVERKLPQILTSKEVDLFLEQP-------DP 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
              K  R   ++ELLYATG+RVSEL+ L+   +NL+   +   G+  +  + +  P+A+ 
Sbjct: 130 SDAKGCRDKAMLELLYATGIRVSELIGLNLEHVNLSAGFVRCVGRSKERIIPLY-PAAVR 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           AL  Y        +   D      +     +SRQ F + +K    +AGI +K+I+PH +R
Sbjct: 189 ALTAYMTQVRPQMIEHPDEKALFVNMNGERMSRQGFWKIIKHYQEKAGI-RKDITPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+FA+HLLE GADLR+IQ +LGH DIS+TQIY  L+  KL+ +    HP A
Sbjct: 248 HSFAAHLLENGADLRSIQEMLGHADISSTQIYAQLVNQKLKDVYNKAHPRA 298


>gi|254229667|ref|ZP_04923077.1| tyrosine recombinase XerD [Vibrio sp. Ex25]
 gi|262395210|ref|YP_003287064.1| site-specific recombinase XerD [Vibrio sp. Ex25]
 gi|151937788|gb|EDN56636.1| tyrosine recombinase XerD [Vibrio sp. Ex25]
 gi|262338804|gb|ACY52599.1| site-specific recombinase XerD [Vibrio sp. Ex25]
          Length = 305

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 102/288 (35%), Positives = 165/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL++Y+ DL ++  ++      L   S + L  Y ++L       +S+ R +S
Sbjct: 25  ERGLSENTLASYRNDLMKLLTWMEKHRYRLDFISLSGLQEYQSYLVDLDYKQTSRARMLS 84

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK + ++ +  LLE          P   
Sbjct: 85  AIRRLFQYLHREKVRADDPSALLVSPKLPQRLPKDISEEQVDALLEAP-------DPNDP 137

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 138 VELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVTGKGGKERLVPMGENAVDWIE 197

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +      +      +   S +   ++RQ F   +K  A  AGI  + +SPH++RHAF
Sbjct: 198 TFIQQGRPALLGDTSSDIVFPSKRARQMTRQTFWHRIKYYALIAGIDTEQLSPHVLRHAF 257

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+++   +HP A
Sbjct: 258 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQIHSQHHPRA 305


>gi|301063083|ref|ZP_07203644.1| tyrosine recombinase XerD [delta proteobacterium NaphS2]
 gi|300442803|gb|EFK07007.1| tyrosine recombinase XerD [delta proteobacterium NaphS2]
          Length = 293

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 110/290 (37%), Positives = 154/290 (53%), Gaps = 9/290 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NT+ AY RDL     +L N+ I+    S   +  YL  L+   L   S+ R
Sbjct: 12  LRVERGLAENTVHAYSRDLIRFVAYLENRNITPVDCSRTAIRDYLGTLTHE-LSKRSRAR 70

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S I+ FY FL  EG  ++NP+  +E P+    LP  L  D +  LL Q          
Sbjct: 71  NVSAIKTFYRFLVSEGKMEENPARLVETPRIQQKLPDILSVDEVERLLLQP-------DG 123

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                 R   ++ELLYATG+RVSELV L    +N+    +   GKG+KER+V     A  
Sbjct: 124 ATPIGQRDRAMLELLYATGLRVSELVRLRLLDVNMEAGFVKALGKGSKERMVPFGEKARQ 183

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           AL+ Y        +          + +   L+RQ F + +K     AGI KKNI PH +R
Sbjct: 184 ALKTYLSDGRPALLKEGHPPYLFLNFRGKPLTRQGFWKIIKNHGIMAGI-KKNIKPHGLR 242

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           H+FASHLLE GADLR++Q++LGH DI+TTQIYTH+  ++L++L    HP 
Sbjct: 243 HSFASHLLEAGADLRSVQLMLGHADITTTQIYTHVTRERLKELHGTCHPR 292


>gi|26988201|ref|NP_743626.1| site-specific tyrosine recombinase XerD [Pseudomonas putida KT2440]
 gi|148549459|ref|YP_001269561.1| site-specific tyrosine recombinase XerD [Pseudomonas putida F1]
 gi|34222835|sp|Q88MV0|XERD_PSEPK RecName: Full=Tyrosine recombinase xerD
 gi|24982938|gb|AAN67090.1|AE016337_13 integrase/recombinase XerD [Pseudomonas putida KT2440]
 gi|148513517|gb|ABQ80377.1| tyrosine recombinase XerD subunit [Pseudomonas putida F1]
          Length = 298

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 100/291 (34%), Positives = 161/291 (55%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L    +SL  A  + ++ +L     +     S  R
Sbjct: 16  LWLEKGLSDNTRVSYRSDLALFNGWLQEHSVSLPDAGRDLILDHLAWRLDQGYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R F+ +L  E L   +P+  +++P+    LPK+L +  +  LL+           
Sbjct: 76  FLSGLRGFFRYLLREKLVAIDPTLQVDMPQLGKPLPKSLSEADVEALLQAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
           G+    R   ++E+LYA G+RV+ELV+L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 GEAIGQRDRAMLEVLYACGLRVTELVSLTLDQVNLRQGVLRVMGKGSKERLVPMGEEAVV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y++   +  + G    +   S +   ++RQ F   +K  A  AGI K  +SPH +R
Sbjct: 189 WLERYQRDGRAELLNGRPSDVLFPSQRGEQMTRQTFWHRIKHHARVAGIDKP-LSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVAKARLQQLHAQHHPRG 298


>gi|114705350|ref|ZP_01438258.1| tyrosine recombinase [Fulvimarina pelagi HTCC2506]
 gi|114540135|gb|EAU43255.1| tyrosine recombinase [Fulvimarina pelagi HTCC2506]
          Length = 323

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 139/295 (47%), Positives = 192/295 (65%), Gaps = 4/295 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MM+ ER ++ NTL AY RDL   ++FL      L  A ++ + +YL  LS   L  S++ 
Sbjct: 25  MMAVERGAADNTLQAYARDLDAARSFLKPHG-GLMRADSDAIRAYLTSLSAEGLSESTRS 83

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLL---EQAKIEAE 117
           R++S +RQ Y FL  EG R D+P+  +E  +K   LPK + +D +  LL   E    +AE
Sbjct: 84  RRLSALRQLYRFLYTEGRRTDDPTSPIEGARKKRPLPKVMSEDEVDRLLDLAEAETNDAE 143

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                + + +R+ +L+ELLYATG+RVSELV+L    L    RT+ + GKGNKERLV +  
Sbjct: 144 LSPSSRVRAIRLRVLVELLYATGLRVSELVSLPKSMLVNRARTITVLGKGNKERLVPIGA 203

Query: 178 SALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           +A  +L  Y +   +  +     WLFP+ +++GHLSRQVFAR+LK LAAR GI    ISP
Sbjct: 204 AARESLDAYGQALKAAGLNNEGPWLFPADSESGHLSRQVFARELKGLAARTGISAAKISP 263

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H++RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L KLV ++HPL+
Sbjct: 264 HVLRHAFASHLLQNGADLRAVQELLGHADISTTQIYTHVLEERLHKLVTEHHPLS 318


>gi|227541999|ref|ZP_03972048.1| site-specific tyrosine recombinase XerD [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227182214|gb|EEI63186.1| site-specific tyrosine recombinase XerD [Corynebacterium
           glucuronolyticum ATCC 51866]
          Length = 360

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 161/294 (54%), Gaps = 13/294 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           ++ ER  + NT+++Y+RDL    +F+  +  SL + +   + ++L  L +  L  +S RR
Sbjct: 77  LTVERGKARNTIASYRRDLASYLDFVGER--SLDSIAATDIEAFLQSLGRHGLAVTSVRR 134

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR F+ F   EG+  D+ +  +  P     LP TL  D I  L+E         A 
Sbjct: 135 MLSTIRGFHAFARDEGIVADDVAHDITPPAMPQHLPDTLSVDEINTLIES-------QAG 187

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLN---LTERTMIIQGKGNKERLVILSPS 178
                +R   L+ELLY TG R+SE+++L+   +     T+  +++ GKG+K+R+V +   
Sbjct: 188 DSAVALRNKALLELLYGTGARISEVLSLAVDDITALEETDGILVLTGKGDKQRIVPVGSH 247

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A  A+  Y          G    LF +      +SRQ   + +K  A  AGI  K+ISPH
Sbjct: 248 ARQAVDAYLVRGRPQLNKGKSAALFLNVRGGKAMSRQSAWQVVKQAATEAGIT-KDISPH 306

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLEGGAD+R++Q LLGH  ++TTQIYTH+  D L+ + +  HP A
Sbjct: 307 TLRHSFATHLLEGGADVRSVQELLGHASVTTTQIYTHITADSLRAMWRTAHPRA 360


>gi|227489005|ref|ZP_03919321.1| site-specific tyrosine recombinase XerD [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227091081|gb|EEI26393.1| site-specific tyrosine recombinase XerD [Corynebacterium
           glucuronolyticum ATCC 51867]
          Length = 360

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 161/294 (54%), Gaps = 13/294 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           ++ ER  + NT+++Y+RDL    +F+  +  SL + +   + ++L  L +  L  +S RR
Sbjct: 77  LTVERGKARNTIASYRRDLASYLDFVGER--SLDSIAATDIEAFLQSLGRHGLAVTSVRR 134

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR F+ F   EG+  D+ +  +  P     LP TL  D I  L+E         A 
Sbjct: 135 MLSTIRGFHAFARDEGIVADDVAHDITPPAMPQHLPDTLSVDEINTLIES-------QAG 187

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLN---LTERTMIIQGKGNKERLVILSPS 178
                +R   L+ELLY TG R+SE+++L+   +     T+  +++ GKG+K+R+V +   
Sbjct: 188 DSAVALRNKALLELLYGTGARISEVLSLAVDDITALEETDGILVLTGKGDKQRIVPVGSH 247

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A  A+  Y          G    LF +      +SRQ   + +K  A  AGI  K+ISPH
Sbjct: 248 ARQAVDAYLVRGRPQLNKGKSAALFLNVRGGKAMSRQSAWQVVKQAATEAGIT-KDISPH 306

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLEGGAD+R++Q LLGH  ++TTQIYTH+  D L+ + +  HP A
Sbjct: 307 TLRHSFATHLLEGGADVRSVQELLGHASVTTTQIYTHITADSLRAMWRTAHPRA 360


>gi|87307014|ref|ZP_01089160.1| integrase/recombinase [Blastopirellula marina DSM 3645]
 gi|87290387|gb|EAQ82275.1| integrase/recombinase [Blastopirellula marina DSM 3645]
          Length = 300

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 89/297 (29%), Positives = 148/297 (49%), Gaps = 12/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNN---KEISLSAASTNHLISYLNHLSQRKLVTSS 58
           +  ER +S  T+ +Y  DL+ + ++L        S    ST  L  Y+  +S      ++
Sbjct: 12  LRVERNASDLTIKSYGEDLEALVDYLEELYAAPASTGEVSTLDLRGYVAAVSDAGYAETT 71

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R+++ +R F+ F   E L   +P+  L  P++   LP  L  D I+ LL         
Sbjct: 72  VSRRLASMRSFFRFAQREELIDRSPAKPLRNPRRKRKLPHFLTGDEISKLLSAP------ 125

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   + E  Y+ G+RVSELV L+   ++  +  + I+GKG +ERL  L   
Sbjct: 126 -PANTSAGLRDRAIFETTYSAGLRVSELVGLNDSDIDAEQGLIRIRGKGKRERLGPLGSY 184

Query: 179 ALHALQMYKKTCS-SMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           A+ AL  +    + S +          ++     L+ +   R L+   A AG+  +  SP
Sbjct: 185 AIKALHDWLSQRTLSARAAAAKEKPVFTNKFGNRLTTRSVGRMLEKYIAIAGLDTRT-SP 243

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           H +RH+FA+HLL+ GAD+R++Q LLGH  + TTQIYTH+   +L++  +  HP A++
Sbjct: 244 HTLRHSFATHLLDAGADIRSVQELLGHKSLVTTQIYTHVSTTRLKEAYEKAHPRAQR 300


>gi|313500307|gb|ADR61673.1| XerD [Pseudomonas putida BIRD-1]
          Length = 298

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 100/291 (34%), Positives = 160/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L    +SL  A  + ++ +L     +     S  R
Sbjct: 16  LWLEKGLSDNTRVSYRSDLALFNGWLQEHSVSLPDAGRDLILDHLAWRLDQGYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R F+ +L  E L   +P+  +++P+    LPK+L +  +  LL+           
Sbjct: 76  FLSGLRGFFRYLLREKLVAIDPTLQVDMPQLGKPLPKSLSEADVEALLQAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
           G+    R   ++E+LYA G+RV+ELV+L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 GEAIGQRDRAMLEVLYACGLRVTELVSLTLDQVNLRQGVLRVMGKGSKERLVPMGEEAVV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L  Y++   +  + G    +   S +   ++RQ F   +K  A  AGI K  +SPH +R
Sbjct: 189 WLDRYQRDGRAELLNGRPSDVLFPSQRGEQMTRQTFWHRIKHHARVAGIDKP-LSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVAKARLQQLHAQHHPRG 298


>gi|91202903|emb|CAJ72542.1| similar to site-specific tyrosine recombinase [Candidatus Kuenenia
           stuttgartiensis]
          Length = 298

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 94/288 (32%), Positives = 151/288 (52%), Gaps = 15/288 (5%)

Query: 6   RASSINTLSAYKRDLKEMQNFLNNKE-ISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           R  S  TL AY+ DL +  +FL  +    L+  +   L  YL  L ++    ++  RK++
Sbjct: 25  RNYSPQTLRAYRNDLGQYLSFLKGEGCTDLAGVTRLQLRKYLAFLKKKNPSKTTVARKLA 84

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR  Y FLC  G+ + NP + ++ PK +  LP  +  +    LL Q             
Sbjct: 85  SIRSLYKFLCQHGILEYNPVEQIKTPKTDKKLPGFMSVNDTEILLNQP-------DTCNL 137

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++E LY+TGMRVSELV ++   ++     + ++GKG+KER++ +   AL+A+Q
Sbjct: 138 SGLRDKAIMETLYSTGMRVSELVGINIADIDFHSGIVKVRGKGSKERILPVGNHALNAIQ 197

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
           +Y +         ++  LF +        R V     K +   A   +  +SPH  RH+F
Sbjct: 198 LYLEKR-----KADNEALFLNKFHGRLTERSVARMIEKYMKKAAMHLR--VSPHTFRHSF 250

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL+ GADLR +Q  LGH+ +STTQIYTH+  ++L+++    HP A
Sbjct: 251 ATHLLDNGADLRAVQEFLGHSSLSTTQIYTHVTTERLKQVYDKTHPRA 298


>gi|256391647|ref|YP_003113211.1| tyrosine recombinase XerD [Catenulispora acidiphila DSM 44928]
 gi|256357873|gb|ACU71370.1| tyrosine recombinase XerD [Catenulispora acidiphila DSM 44928]
          Length = 306

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 103/295 (34%), Positives = 154/295 (52%), Gaps = 14/295 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +S ER  S NTL+AY+RDL   + FL+ ++  + S      + ++L  L       SS  
Sbjct: 19  LSVERGLSANTLAAYRRDLSRYRVFLDTRDRANFSDIDRADVSAFLASLQDG--AASSAA 76

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R  + F   EG    + SD +  P+    LPK L  D I  LL           
Sbjct: 77  RTMSAVRGLHRFAVAEGWVGVDVSDDVAPPQVPMRLPKALPLDDIERLLAA-------TE 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   L+E LY+TG RVSE V L    ++  +RT+++ GKG K+RLV +   A 
Sbjct: 130 IDEPMALRDRALLEFLYSTGARVSEAVALDVDDIDREDRTVVLDGKGGKQRLVPVGSYAC 189

Query: 181 HALQMYKKTCSS---MKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
            A+  Y          K    +      + + G L+RQ     L A+A R G+  + +SP
Sbjct: 190 RAVDDYLVRLRPELTRKARSGNGGALFLNARGGRLTRQGAWTVLGAVAERVGLAGR-VSP 248

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLL+GGAD+RT+Q LLGH+  +TTQIYT +  D+L+++    HP A
Sbjct: 249 HTLRHSFATHLLDGGADIRTVQELLGHSSATTTQIYTRVTVDRLREVYATSHPRA 303


>gi|224476375|ref|YP_002633981.1| putative site-specific recombinase XerC [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|254799358|sp|B9DPG4|XERC_STACT RecName: Full=Tyrosine recombinase xerC
 gi|222420982|emb|CAL27796.1| putative site-specific recombinase XerC [Staphylococcus carnosus
           subsp. carnosus TM300]
          Length = 296

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 99/296 (33%), Positives = 153/296 (51%), Gaps = 10/296 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S +TL +Y  DL +   FL ++ + L +       +YL+ L  + L  ++  
Sbjct: 11  MLKVERFFSKHTLKSYHDDLVQFNAFLEHEHLKLKSFEYKDARNYLSFLYSKGLKRTTVS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY F   +     NP   L  PKK   LP   +++ ++ L E  + +     
Sbjct: 71  RKISTLRSFYEFWMTQDDTVVNPFVQLVHPKKEQYLPHFFYEEEMSALFETVEADGH--- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  +++ELLY TG+RVSELV +    L+L    + + GKGNKER +       
Sbjct: 128 ----KGLRDRVILELLYGTGIRVSELVNIKLEDLDLNSPGVKVLGKGNKERFIPFGNMCR 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y +    ++   +D +L  +        R V       +   AG+    I PH +
Sbjct: 184 ESIERYLELFPPIQNVKHD-YLLVNINGRPITERGVRYVLNDIVKRTAGVTD--IHPHKL 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           RH FA+H+L  GADLRT+Q LLGH ++STT  YTH+   +L+K+  + HP AKKEK
Sbjct: 241 RHTFATHMLNEGADLRTVQSLLGHVNLSTTGRYTHVSNQQLRKVYLNAHPRAKKEK 296


>gi|192288937|ref|YP_001989542.1| tyrosine recombinase XerD [Rhodopseudomonas palustris TIE-1]
 gi|192282686|gb|ACE99066.1| tyrosine recombinase XerD [Rhodopseudomonas palustris TIE-1]
          Length = 339

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 135/300 (45%), Positives = 193/300 (64%), Gaps = 5/300 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++E+ +S NTL AY+RDL ++ +FL+ + +S+ +A T  L SYL  L  R   TSS  
Sbjct: 40  MIAAEQGASANTLDAYRRDLADLSHFLSRRRLSIGSADTAALRSYLADLDNRGFATSSVA 99

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +R  + FL  E +R D+P+  L  PK+   LPK L    +  LL  A+ E +   
Sbjct: 100 RRLSALRHLFRFLLSERIRADDPAAILAGPKRGRSLPKVLSIADVDRLLACARQEIDAAE 159

Query: 121 PG-QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
            G + +  R+  L+E+LYATG+RVSELV+L         R ++++GKG+KERLV L+  A
Sbjct: 160 GGARLRAARLNCLLEVLYATGLRVSELVSLPLSAARRDARMIVVRGKGDKERLVPLNAGA 219

Query: 180 LHALQMYKKTC----SSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
             A+  Y +         K      WLFPS  ++G+L+RQ FARDLK LAARAG+  + +
Sbjct: 220 KQAMARYLEEVAVATKETKGAPASKWLFPSFGESGYLTRQHFARDLKDLAARAGLSPRLV 279

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           SPH++RHAFASHLL  GADLR +Q LLGH+DISTTQIYTH++ ++L+ LV+D HPL +  
Sbjct: 280 SPHVLRHAFASHLLHNGADLRIVQTLLGHSDISTTQIYTHVVEERLKSLVRDLHPLGEGR 339


>gi|163736279|ref|ZP_02143698.1| phage integrase [Phaeobacter gallaeciensis BS107]
 gi|161390149|gb|EDQ14499.1| phage integrase [Phaeobacter gallaeciensis BS107]
          Length = 337

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 123/295 (41%), Positives = 176/295 (59%), Gaps = 10/295 (3%)

Query: 7   ASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKISVI 66
            ++ NTL AY RDLK++ ++L +K  +  +A+ + + SYL       L  +++ R++S I
Sbjct: 31  GAARNTLLAYGRDLKDVASWLGHKNRAFGSATRDDIESYLIACDAEGLARATRARRLSAI 90

Query: 67  RQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQWKR 126
           +Q Y F   EG R DNP+  ++ P +   LPKTL    +  LL+ A+    N +     R
Sbjct: 91  KQIYRFAFDEGWRSDNPAIQIKGPGRQKALPKTLEVIEVDRLLDAARQSGRNLSD----R 146

Query: 127 VRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQMY 186
           +R   ++ELLYATGMRVSELV L         R +++ GKG KER+V LSP A  AL  +
Sbjct: 147 LRNTCMMELLYATGMRVSELVGLPVAAARGDPRMLLVLGKGGKERMVPLSPPARDALAAW 206

Query: 187 KKTCSSM------KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             T  +       K      +LFPS  K+GHL+R  F   +K  A   G+  + +SPH +
Sbjct: 207 LTTRDAAEEAAVAKGAAPSRFLFPSRGKSGHLTRHRFYLLIKEFAVAGGLPPEAVSPHTL 266

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           RHAFA+HLL  GADLR IQ LLGH DI+TT+IYTH+L  +L +LV ++HPLA+K+
Sbjct: 267 RHAFATHLLTNGADLRAIQALLGHADIATTEIYTHVLDARLSELVLEHHPLARKD 321


>gi|84686929|ref|ZP_01014813.1| tyrosine recombinase XerD [Maritimibacter alkaliphilus HTCC2654]
 gi|84665126|gb|EAQ11606.1| tyrosine recombinase XerD [Rhodobacterales bacterium HTCC2654]
          Length = 315

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 125/303 (41%), Positives = 173/303 (57%), Gaps = 13/303 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +   ++E  +S NTL AY RDLK+   +L+        A    + +YL     + L  S
Sbjct: 13  FLEAQAAELDASQNTLLAYGRDLKDFSGYLDRMGEDFGGADRATVEAYLIDCEAQGLAVS 72

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           ++ R++S I+Q Y F   EG R DNP+  +  P K   LPKTL +D +  LL  A+    
Sbjct: 73  TRARRLSAIKQIYRFAFEEGWRTDNPTLRITGPGKARRLPKTLSEDDVERLLNAARQHG- 131

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                   R+R   ++E+LYATGMRVSELVTL         R +++ GKG KER+V LSP
Sbjct: 132 ---RTDADRLRNACMMEVLYATGMRVSELVTLPVSAARGDPRMLLVMGKGGKERMVPLSP 188

Query: 178 SALHALQMYKKTCS------SMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ 231
            A  AL  +             K      +LFPS+ K GHL+R  F   +K +A  AG+ 
Sbjct: 189 PARAALAAWLDVRDAAEDAARSKGAKPSRFLFPSTGKDGHLTRHRFHGLIKDIAVAAGVS 248

Query: 232 KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
            + ++PH +RHAFA+HLL  GADLR IQ LLGH D+STT+IYTH+L ++L++LV  +HPL
Sbjct: 249 PETVTPHRLRHAFATHLLAHGADLRAIQTLLGHADVSTTEIYTHVLDERLKELVLSHHPL 308

Query: 292 AKK 294
           AKK
Sbjct: 309 AKK 311


>gi|104773902|ref|YP_618882.1| site-specific recombinase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|103422983|emb|CAI97665.1| Site-specific recombinase [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
          Length = 298

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 99/290 (34%), Positives = 153/290 (52%), Gaps = 9/290 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT++AY++DL E   F+  +++         + ++L          SS  R 
Sbjct: 16  QIERGLSPNTIAAYQQDLLEFLAFVKEEQMPAWPLEAVEIDAFLAKERDLGKANSSISRL 75

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           +S + +FY +L  + L   +P   ++ PK+   +P  L +  +  LLEQ           
Sbjct: 76  VSTLSRFYQWLVRQQLIALDPMSQIDAPKREKRMPLALTEAEVGKLLEQP-------DLT 128

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
               +R   L+ELLYATGMRVSE V L    ++   + + + GKG+KERL+ +S  AL  
Sbjct: 129 TDLGIRDRALLELLYATGMRVSEAVNLQLADVHANLQLIKVLGKGSKERLIPVSALALDW 188

Query: 183 LQMYKKTCSSMKMT-GNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           ++ Y        +  G        +++ G L+RQ   + +K    +AGI  K+++PH +R
Sbjct: 189 IKRYLPVRDQQLLKRGKSSDYLFLNSRGGQLTRQAVWQKIKKYCQQAGI-AKDVTPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           H+FA+HLLE GADLR +Q +LGHTDISTTQIYT+L    +  + Q  HP 
Sbjct: 248 HSFATHLLEHGADLRVVQEILGHTDISTTQIYTNLTQKHILDVYQKTHPR 297


>gi|330894535|gb|EGH27196.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           mori str. 301020]
          Length = 298

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 158/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRESYRSDLALFNGWLQERNVDLPSAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLITLDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEPTGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEMHAKHHPRG 298


>gi|262404730|ref|ZP_06081285.1| site-specific recombinase XerD [Vibrio sp. RC586]
 gi|262349762|gb|EEY98900.1| site-specific recombinase XerD [Vibrio sp. RC586]
          Length = 302

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 102/291 (35%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           M  ER  + NT+++Y+ DL ++  ++   +  L   S + L  Y   L+++    +S+ R
Sbjct: 19  MWFERGLAENTVASYRNDLSKLLGWMAQHQYRLDFISFSGLQEYQIWLTEQDYKPTSKAR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LL           P
Sbjct: 79  MLSAIRRLFQYLHREKVRADDPSALLISPKLPTRLPKDLTEAQVEALLSAP-------DP 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+ 
Sbjct: 132 QTPIELRDKAMLELLYATGLRVTELVSLTMENMSLRQGVVRVIGKGGKERLVPMGENAVE 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ + +   S+ +      +   S++   ++RQ F   +K  A  A I  + +SPH++R
Sbjct: 192 WIETFLQQGRSLLLGEQTSDIVFPSSRGQQMTRQTFWHRIKHYAVIAEIDVEQLSPHVLR 251

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 252 HAFATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHNEHHPRA 302


>gi|152989006|ref|YP_001346765.1| site-specific tyrosine recombinase XerD [Pseudomonas aeruginosa
           PA7]
 gi|150964164|gb|ABR86189.1| tyrosine recombinase XerD [Pseudomonas aeruginosa PA7]
          Length = 298

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 100/291 (34%), Positives = 162/291 (55%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NT  AY+ DL++   +L+   + L     + ++ +L    ++     S  R
Sbjct: 16  LWLEKGLADNTREAYRNDLEQFNAWLDGHGLRLEGVGRDAILDHLAWRLEQGYKARSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R FY +   +GL  ++P+  ++LP+    LPK+L +  +  LL   +++      
Sbjct: 76  FLSGLRGFYRYCLRDGLIAEDPTLQVDLPQLGKPLPKSLSEADVEALLAAPEVD------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYA G+RVSELV L+   +NL +  + + GKG+KERLV L   A+ 
Sbjct: 130 -DPLGLRDRTMLEVLYACGLRVSELVGLTLEQVNLRQGVVKVFGKGSKERLVPLGEEAIG 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +   +  + G    +   S +   ++RQ F   +K  A  A I  K+ISPH +R
Sbjct: 189 WLERYLREARADLLGGRPSDVLFPSLRGEQMTRQTFWHRIKRHAQVAAI-GKSISPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHIARARLQDLHARHHPRG 298


>gi|257487154|ref|ZP_05641195.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|331009225|gb|EGH89281.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 298

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 158/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLPSAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEAIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEMHAKHHPRG 298


>gi|332160506|ref|YP_004297083.1| site-specific tyrosine recombinase XerD [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|318607025|emb|CBY28523.1| tyrosine recombinase XerD [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664736|gb|ADZ41380.1| site-specific tyrosine recombinase XerD [Yersinia enterocolitica
           subsp. palearctica 105.5R(r)]
 gi|330863449|emb|CBX73568.1| tyrosine recombinase xerD [Yersinia enterocolitica W22703]
          Length = 299

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 170/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL  +  +L + +  L  A +  L S+L    +    ++S  R
Sbjct: 16  LWLERNLAENTLASYRLDLHALSGWLEHHDSDLLRAGSQDLQSFLAERIEGGYKSTSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+P+  L  PK    LPK L +  +  LL    ++      
Sbjct: 76  LLSAMRRLFQYLYREKLREDDPTALLSSPKLPQRLPKDLSEAQVDALLNSPNVDI----- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 131 --PLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYMEYGRPWLINGQSLDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKLLHQQHHPRA 299


>gi|288956928|ref|YP_003447269.1| integrase/recombinase [Azospirillum sp. B510]
 gi|288909236|dbj|BAI70725.1| integrase/recombinase [Azospirillum sp. B510]
          Length = 355

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 120/309 (38%), Positives = 183/309 (59%), Gaps = 21/309 (6%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER +++NT  AY+RDL ++  +L  + ++L  A T  L +YL    +      +  
Sbjct: 47  MLTAERGAAVNTRLAYERDLADLGRWLAQRGVALEGAGTEDLRAYLAVQGKDG-APRTVA 105

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQFY FL  EG R D+P+  L+ PK+   LPK L +  +  +L  A+      A
Sbjct: 106 RRLSAMRQFYRFLLSEGRRSDDPASPLDSPKQGRPLPKILSEAEVGAMLSTAE------A 159

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
            G  + +R+  L+E+LYATG+RVSELV L    +    R ++++GKG KER+V LS  AL
Sbjct: 160 RGGPEGLRLVALLEVLYATGLRVSELVGLPMTAIMRDGRGLLVRGKGGKERMVPLSDPAL 219

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSR--------------QVFARDLKALAA 226
            AL  Y    +     G       +  + GH                 Q FA+ LK LA 
Sbjct: 220 AALAAYIPVRAHFIPPGTGAGGGGAGGEGGHSPFLFPSRISAEGYLTRQRFAQLLKQLAI 279

Query: 227 RAGIQKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQ 286
            AGI  + +SPH++RHAFA+HLL+ GADLR++Q +LGH DI+TTQIYTH++ ++L+K++ 
Sbjct: 280 DAGIDPEKVSPHVLRHAFATHLLDHGADLRSVQKMLGHADIATTQIYTHVVTERLRKVMH 339

Query: 287 DYHPLAKKE 295
           D+HPLA++ 
Sbjct: 340 DHHPLARRR 348


>gi|56414990|ref|YP_152065.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197363919|ref|YP_002143556.1| site-specific tyrosine recombinase XerD [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56129247|gb|AAV78753.1| site-specific integrase/recombinase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197095396|emb|CAR60955.1| site-specific integrase/recombinase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 298

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 112/291 (38%), Positives = 173/291 (59%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTLSAY+RDL  +  +L+++  +L+ A  + L + L    +     +S  R
Sbjct: 15  LWLERDLAENTLSAYRRDLSMVVAWLHHRGKTLATAQADDLQTLLAERVEGGYKATSSAR 74

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+F+  L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+      
Sbjct: 75  LLSAMRRFFQHLYREKYREDDPSAQLASPKLPQRLPKDLSEVQVERLLQAPLID------ 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            Q   +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 129 -QPLELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVY 187

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 188 WLETYLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPRA 298


>gi|240139059|ref|YP_002963534.1| Tyrosine recombinase xerD [Methylobacterium extorquens AM1]
 gi|240009031|gb|ACS40257.1| Tyrosine recombinase xerD [Methylobacterium extorquens AM1]
          Length = 328

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 154/294 (52%), Gaps = 2/294 (0%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+++ER ++ NTL+AY+RDL +   +L    I    A    + +Y+  L  R L  SS  
Sbjct: 22  MLAAERGAAANTLAAYRRDLDDYLGYLAEGGIDPEEAQAEQVRAYIASLEPRGLKASSAA 81

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S IR F+ FL  EG  + +P+  +  P++   LPK L    +  LL  A+   E   
Sbjct: 82  RRLSCIRGFHRFLYAEGYSETDPTAPVAAPRRAKGLPKVLSVAEVDRLLATARERVEAAG 141

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             + +      ++ LL         +  L A   +             K     L P   
Sbjct: 142 DDRAEARAAARMLCLLELLYATGLRVSELVALPRSAAATRERYLVVKGKGGRERLVPLTD 201

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A +  +   + +   G+ L+   S   +GHL+RQ FARDLK  AA A ++   +SPH++
Sbjct: 202 LAREAMRTHVAHLTAEGSWLFPAESE--SGHLTRQAFARDLKTAAAAADLRTDRVSPHVL 259

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RHAFASHLL+ GADLR +Q LLGH DISTTQIYTH+L ++L+ +V+D HPL  +
Sbjct: 260 RHAFASHLLQNGADLRIVQELLGHADISTTQIYTHVLDERLKGMVRDLHPLNDR 313


>gi|259046879|ref|ZP_05737280.1| integrase/recombinase XerD [Granulicatella adiacens ATCC 49175]
 gi|259036502|gb|EEW37757.1| integrase/recombinase XerD [Granulicatella adiacens ATCC 49175]
          Length = 294

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 94/287 (32%), Positives = 149/287 (51%), Gaps = 8/287 (2%)

Query: 7   ASSINTLSAYKRDLKEMQNFLNNKE-ISLSAASTNHLISYLNHLSQRKLVTSSQRRKISV 65
             S NT+S+Y+RDL++   FL  ++ I L       ++ +L  L + +   SS  R IS 
Sbjct: 15  GLSDNTVSSYRRDLEKFSQFLEEQKVIRLQNVDHTTMVLFLQKLKKDEYAVSSTSRMISC 74

Query: 66  IRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQWK 125
           +++F+ FL  E +   +P+  +  PK    LPK L  D +  LLE               
Sbjct: 75  LKKFFQFLIQERIIDKDPTQQIHPPKPKKQLPKALSIDEVNRLLEVP-------DTTTVL 127

Query: 126 RVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQM 185
            +R   ++ELLYATGMRVSEL+++    L+L    +   GKGNK+R++ +   A + +Q 
Sbjct: 128 GLRDKAMLELLYATGMRVSELISIELGDLHLELGFLQTIGKGNKQRIIPIGQEATNWIQN 187

Query: 186 YKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAFA 245
           Y +           L         G    +           +  +  K +SPH +RH+FA
Sbjct: 188 YLEYARPALEDEKKLSNVLFLNHRGGPFTRQGFWKNLKKIVQTAMITKEVSPHTLRHSFA 247

Query: 246 SHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +H+LE GADLR +Q LLGH+DISTTQIYTH+  ++++++ +  HP +
Sbjct: 248 THILEAGADLRIVQELLGHSDISTTQIYTHITNERMKEIYKQAHPRS 294


>gi|169350427|ref|ZP_02867365.1| hypothetical protein CLOSPI_01195 [Clostridium spiroforme DSM 1552]
 gi|169292747|gb|EDS74880.1| hypothetical protein CLOSPI_01195 [Clostridium spiroforme DSM 1552]
          Length = 298

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 87/292 (29%), Positives = 142/292 (48%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT+++Y+R++   + +L  + I   +      L  YL  L  + L  SS  
Sbjct: 14  LKYERNYSNNTIASYRREIMHFKVYLVQEGISDYNDVDYLMLRGYLTKLYDKNLAKSSIN 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
            ++S +R F+++L  E   KDNP   +E  K     P  L ++ + +LL+          
Sbjct: 74  HRLSALRSFFDYLLKEEFIKDNPFKLIESQKVGQRNPDFLFQEEMIDLLDSI-------E 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++EL+YA+G+R SE+  L    ++  +  +++ GKG K+R V     A 
Sbjct: 127 TKDDLGIRNKAMLELMYASGLRCSEVANLQISDIDFNQMVVLVHGKGGKDRYVPFHEYAR 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L  Y     +  M  N    F    K G+        ++           K I PH I
Sbjct: 187 DWLVKYIDEARNNLMIKNAGHNFIFVNKLGNPLTNRGIENIVDRVTFKYDATKKIHPHTI 246

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLL  GAD+RT+Q LLGH +++TTQ+YTH+  + L+K+    HP +
Sbjct: 247 RHSFATHLLNAGADIRTVQELLGHKNLATTQVYTHISKNHLKKVYMKTHPRS 298


>gi|269103442|ref|ZP_06156139.1| site-specific recombinase XerD [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163340|gb|EEZ41836.1| site-specific recombinase XerD [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 298

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 167/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL++Y+ DL ++  ++   ++ L + S + L  Y   L  +    +S+ R +S
Sbjct: 18  ERGLSENTLASYRNDLTKLMMWMKEHKLVLESISADDLQRYQQWLFDQDYKQTSRARMVS 77

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK + +  +  LL+   ++         
Sbjct: 78  AIRRVFQYLHREKIRVDDPSAMLISPKLPKRLPKDISEAQVDALLDAPNVD-------DP 130

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG+KERLV +  +A+  ++
Sbjct: 131 IELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVVGKGDKERLVPMGENAVDWIE 190

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            +      M +      +   S +   ++RQ F   +K  A  AGI    +SPH++RHAF
Sbjct: 191 QFLAQGRPMLLGEKSSDVVFPSKRAQQMTRQTFWHRIKHYAVLAGIDADTLSPHVMRHAF 250

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L + +HP  
Sbjct: 251 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHEQHHPRG 298


>gi|303326955|ref|ZP_07357397.1| tyrosine recombinase XerD [Desulfovibrio sp. 3_1_syn3]
 gi|302862943|gb|EFL85875.1| tyrosine recombinase XerD [Desulfovibrio sp. 3_1_syn3]
          Length = 331

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 93/297 (31%), Positives = 151/297 (50%), Gaps = 6/297 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLS---AASTNHLISYLNHLSQRKLVTSS 58
           ++ ++ +S  T  AY  DL ++  FL  +   L+     S  H+ ++L  L +R    SS
Sbjct: 38  LAVQKGASDATQKAYGADLTQLAVFLREQGADLARPGEVSRKHIQAFLAWLFRRGEAKSS 97

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             RK++ +R F+ FL   G   +N +  +  P++    P+ L+ D    LL+  K    +
Sbjct: 98  MARKLAAVRSFFRFLLRSGRVSENVAAQVRNPRQEKHHPRALNVDETFALLDTPKAAPPS 157

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
            A       R   L ELLY +G+R+SE ++L      L  R + + GKG++ERL  LS +
Sbjct: 158 EAHAARLLCRDLALAELLYGSGLRISEALSLDLDDAQLRSRVLRVMGKGSRERLSPLSDT 217

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           +  AL  +    S + +            +   L+R+  AR +  L  RAG+    +SPH
Sbjct: 218 SCEALAAWLAERSYLALPEEQA--LFVGARGARLNRREAARIIAGLCRRAGL-AFTVSPH 274

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
            +RH+FA+HLL  GADLR++Q LLGH  ++TTQ YT +  + L +     HP + K+
Sbjct: 275 SLRHSFATHLLAAGADLRSVQELLGHRRLTTTQRYTQVSLEHLIRAYDQAHPRSGKK 331


>gi|330895934|gb|EGH28218.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           japonica str. M301072PT]
          Length = 298

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 159/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLISAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGVRGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   ++ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEESIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQELHARHHPRG 298


>gi|169827277|ref|YP_001697435.1| tyrosine recombinase xerD [Lysinibacillus sphaericus C3-41]
 gi|168991765|gb|ACA39305.1| Tyrosine recombinase xerD [Lysinibacillus sphaericus C3-41]
          Length = 300

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 105/295 (35%), Positives = 162/295 (54%), Gaps = 11/295 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLVTSS 58
            +  ER  S+NTL++Y+RDL+   NFL N E   + +      ++ +L  L  +   + +
Sbjct: 14  FIQVERQLSVNTLASYRRDLESYVNFLQNAEGMANFNHIERTTILRHLEQLRVQGKTSRT 73

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R IS IR F+ FL  E   + +P+  LE+P     LP  L  + I  LL         
Sbjct: 74  IARHISSIRSFHQFLLREKRAESDPTVHLEMPTIEQKLPNILSIEEIEALLTAPN----- 128

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
               + + +R   ++ELLY +GMR+SEL+ L    L+LT   + + GKG KER++ L  S
Sbjct: 129 --RSKPQGIRDLAMLELLYGSGMRISELIALDLADLHLTMGFVRVFGKGGKERIIPLGKS 186

Query: 179 ALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           AL A+  Y       ++        F  + +   L+RQ   + +K  A +AGIQ + ++P
Sbjct: 187 ALSAISTYLNNARGQLQGKYPKTDAFFINQRGKRLTRQGCWKLMKEHALKAGIQHE-LTP 245

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HL+E GADLR +Q +LGH DISTTQIYTH+   +L ++ + +HP A
Sbjct: 246 HTLRHSFATHLVENGADLRAVQEMLGHADISTTQIYTHISKTRLSEVYKQFHPRA 300


>gi|312900737|ref|ZP_07760034.1| tyrosine recombinase XerD [Enterococcus faecalis TX0470]
 gi|295112966|emb|CBL31603.1| tyrosine recombinase XerD subunit [Enterococcus sp. 7L76]
 gi|311292218|gb|EFQ70774.1| tyrosine recombinase XerD [Enterococcus faecalis TX0470]
 gi|315169704|gb|EFU13721.1| tyrosine recombinase XerD [Enterococcus faecalis TX1342]
          Length = 296

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 96/292 (32%), Positives = 149/292 (51%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT  +Y+RDLK+   FL  + + S        +  +L  L + +  ++S  
Sbjct: 12  LQIERGLSNNTRRSYERDLKKYVAFLQEQGLHSWDEVDRYMITEFLQSLHEEQQASASVI 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R F+ FL  E L + NP   ++ PKK   LP TL  D +  L+E          
Sbjct: 72  RMISSLRGFHQFLRQERLSEHNPMQHIDSPKKVQKLPSTLSVDEVTRLIEAP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATG+RVSEL+ +    L+L+   +   GKG+KER++ L   A+
Sbjct: 125 TSKPLGMRNRAILEVMYATGLRVSELIEIKLGDLHLSIGLLQTIGKGDKERIIPLGDYAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             ++ Y        +  +           G    +           R    +KNI+PH +
Sbjct: 185 QWIERYMNEARPQLIKNHPNETHLFVNHHGEPLSRQGIWKNLKQIVREAQIEKNITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   ++  + +++ P A
Sbjct: 245 RHSFATHLLENGADLRIVQELLGHADISTTQIYTHITKQRMADVYKEHFPRA 296


>gi|294828085|ref|NP_712528.2| integrase/recombinase XerD [Leptospira interrogans serovar Lai str.
           56601]
 gi|302393797|sp|Q7ZAM8|XERC_LEPIN RecName: Full=Tyrosine recombinase xerC
 gi|302393800|sp|Q72RY9|XERC_LEPIC RecName: Full=Tyrosine recombinase xerC
 gi|293385933|gb|AAN49546.2| integrase/recombinase XerD [Leptospira interrogans serovar Lai str.
           56601]
          Length = 311

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 91/294 (30%), Positives = 150/294 (51%), Gaps = 10/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRK-LVTSSQR 60
           +  E+  S NT++AY  DLK    F   +++ +       + SY  +L+++  +   SQ 
Sbjct: 27  LKIEKNYSQNTINAYSIDLKFFFEFCEKEQLDIFQIEPVDIRSYFAYLAKKHEIDRRSQS 86

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R FY  L  E L K NP+  L  PK    +PK    +    +LE     A    
Sbjct: 87  RKLSSLRTFYKVLLREDLVKSNPATQLSFPKVRKEVPKNFRINETEEILEFESENA---- 142

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   +IE+LY++G+RV ELV    ++L+     + + GKG KER V     A+
Sbjct: 143 -SEVSEIRDRAMIEVLYSSGLRVFELVNAKLNSLSKDLTVLKVLGKGRKERFVYFGKEAV 201

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +LQ Y +  +       +++L         L+ +     L     + G + K I+PH  
Sbjct: 202 SSLQKYLEYRNVSFPDAEEIFLNQR---GKKLTTRGVRYILNERRKKMGWE-KTITPHKF 257

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH FA+ LL+ GA++R +Q LLGH+ +STTQIY  +  +K++++ +  HP A+K
Sbjct: 258 RHTFATDLLDAGAEIRAVQELLGHSSLSTTQIYLSVSKEKIKEVYRKAHPHARK 311


>gi|242373543|ref|ZP_04819117.1| tyrosine recombinase XerC [Staphylococcus epidermidis M23864:W1]
 gi|242348906|gb|EES40508.1| tyrosine recombinase XerC [Staphylococcus epidermidis M23864:W1]
          Length = 286

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 149/294 (50%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S  TL +Y  DL +   FLN++ + L+        +YL++L    L  ++  
Sbjct: 1   MLKVERNFSEYTLKSYHDDLVQFNEFLNSEHLELTTFEYKDARNYLSYLYSNNLKRTTVS 60

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY +   +     NP   L  PKK   LP+  +++ +  L    + +     
Sbjct: 61  RKISTLRTFYEYWMTQDESVVNPFVQLVHPKKEQYLPQFFYEEEMEALFRTVEQDRT--- 117

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  ++IELLYATG+RVSELV +    +++    + + GKGNKER +       
Sbjct: 118 ----KGMRDRVIIELLYATGIRVSELVNIKIKDIDMNLPGVKVLGKGNKERFIPFGEFCK 173

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y       K   ++ +L  +        R V       +   AG+    I PH +
Sbjct: 174 QSIERYLDEFQPRKAVDHE-YLIVNMKGEPITERGVRYVLNDVVKRTAGVTD--IHPHKL 230

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+  + HP AKK
Sbjct: 231 RHTFATHLLNQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLRKVYLNAHPRAKK 284


>gi|225351391|ref|ZP_03742414.1| hypothetical protein BIFPSEUDO_02985 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157735|gb|EEG71018.1| hypothetical protein BIFPSEUDO_02985 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 317

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 87/307 (28%), Positives = 152/307 (49%), Gaps = 14/307 (4%)

Query: 1   MMS---SERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVT 56
            ++    ER  S  T+SAY  DLK+ + +L ++ +  ++A +T  +  Y+  L +    +
Sbjct: 11  FLAHIDVERGLSKATVSAYGADLKKYRQWLADQGVGGIAAVTTQDVERYIVFLDESGESS 70

Query: 57  SSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEA 116
            S+ R+++ I   + F   E +  D+ S  ++ PK    LP  L  D +A LL+   +  
Sbjct: 71  RSKARRLASIHALHRFAVNEHIVVDDVSAQVKAPKGVSTLPDVLTVDEVARLLDSIPVSQ 130

Query: 117 ENPA-------PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNK 169
                      P     +R   L+E +YA G RVSE    +   +++  R   + GKG+K
Sbjct: 131 NREHDGVVSEFPDDPVMLRDKALLEFMYAIGARVSEACGANLDDVDVDGRIARLMGKGSK 190

Query: 170 ERLVILSPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAG 229
           +RLV +   A  A+  Y         + +   +   +       +++  + +  +   AG
Sbjct: 191 QRLVPVGSYACEAIIRYLHAGRPKLESKSKGPVERRALFLNKRGKRLSRQSVWEIIRGAG 250

Query: 230 IQ---KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQ 286
            +    K + PH +RH+FA+HL++GGAD+RT+Q LLGH  ++TTQIYTH+ P+ L +   
Sbjct: 251 ERAHIDKPLHPHTLRHSFATHLIQGGADVRTVQELLGHASVTTTQIYTHISPENLIETYL 310

Query: 287 DYHPLAK 293
             HP A+
Sbjct: 311 MSHPRAR 317


>gi|229545847|ref|ZP_04434572.1| site-specific DNA tyrosine recombinase, XerD [Enterococcus faecalis
           TX1322]
 gi|256853102|ref|ZP_05558472.1| phage integrase [Enterococcus faecalis T8]
 gi|307292019|ref|ZP_07571888.1| tyrosine recombinase XerD [Enterococcus faecalis TX0411]
 gi|229309046|gb|EEN75033.1| site-specific DNA tyrosine recombinase, XerD [Enterococcus faecalis
           TX1322]
 gi|256711561|gb|EEU26599.1| phage integrase [Enterococcus faecalis T8]
 gi|306497017|gb|EFM66565.1| tyrosine recombinase XerD [Enterococcus faecalis TX0411]
 gi|315029408|gb|EFT41340.1| tyrosine recombinase XerD [Enterococcus faecalis TX4000]
          Length = 296

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 97/292 (33%), Positives = 149/292 (51%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT  +Y+RDLK+   FL  + + S        +  +L  L + +  ++S  
Sbjct: 12  LQIERGLSNNTRRSYERDLKKYVAFLQEQGLHSWDEVDRYMITEFLQSLHEEQQASASVI 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R F+ FL  E L + NP   ++ PKK   LP TL  D +  L+E          
Sbjct: 72  RMISSLRGFHQFLRQERLSEHNPMQHIDSPKKIQKLPSTLSVDEVTRLIETP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATG+RVSEL+ +    L+L+   +   GKG+KER++ L   A+
Sbjct: 125 TSKPLGMRNRAILEVMYATGLRVSELIEIKLGDLHLSIGLLQTIGKGDKERIIPLGDYAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             ++ Y        +  +           G    +           R    +KNI+PH +
Sbjct: 185 QWIERYMNEARPQLIKNHPNETHLFVNHHGEPLSRQGIWKNLKQIVREAQIEKNITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   ++  + ++Y P A
Sbjct: 245 RHSFATHLLENGADLRIVQELLGHADISTTQIYTHITKQRMADVYKEYFPRA 296


>gi|326803729|ref|YP_004321547.1| tyrosine recombinase XerD [Aerococcus urinae ACS-120-V-Col10a]
 gi|326651687|gb|AEA01870.1| tyrosine recombinase XerD [Aerococcus urinae ACS-120-V-Col10a]
          Length = 299

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 105/294 (35%), Positives = 154/294 (52%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+  S NT+  Y   L + Q  L+   I  + A     +I  L +L+Q+    S+  
Sbjct: 14  LRVEQGLSENTIKTYHNVLNQFQMILSEAGIEDIQAVKRQDIIQQLENLNQKGRAVSTMS 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           + +S +R F+ +L  + + ++NP + + LPKK   LP+ L  + +  LLE        P 
Sbjct: 74  QYLSTLRHFFKYLILDSVIEENPVENISLPKKKQQLPQVLSVEEVDRLLE-------MPD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   L+ELLYA+G+RVSELV L     +     +   GKGNKER++ L   A 
Sbjct: 127 VNSTLGLRDRSLLELLYASGLRVSELVHLKISDFHEDLGFLQTIGKGNKERIIPLGEVAK 186

Query: 181 HALQMYKKTCSSMKMTGNDLW--LFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
             LQ Y K      +  ND    +   +     LSRQ   + LK     AGI K+ +SPH
Sbjct: 187 DWLQTYLKESRLKLLGENDQSQGMIYLNHHGRPLSRQGVWKKLKQYIQAAGITKE-VSPH 245

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
            +RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+    ++++ +   P A
Sbjct: 246 TLRHSFATHLLENGADLRVVQELLGHADISTTQIYTHIHSQHMREIYKKTFPRA 299


>gi|71736133|ref|YP_273616.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71556686|gb|AAZ35897.1| tyrosine recombinase XerD [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 298

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 98/291 (33%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  +   L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNADLPSAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQELHAKHHPRG 298


>gi|123443576|ref|YP_001007549.1| site-specific tyrosine recombinase XerD [Yersinia enterocolitica
           subsp. enterocolitica 8081]
 gi|122090537|emb|CAL13406.1| integrase/recombinase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 299

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL  +  +L + +  L  A +  L S+L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLHALSGWLEHHDSDLLRAGSQDLQSFLAERIEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+P+  L  PK    LPK L +  +  LL    ++      
Sbjct: 76  LLSAMRRLFQYLYREKLREDDPTALLSSPKLPQRLPKDLSEAQVEALLNSPNVDI----- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 131 --PLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYMEHGRPWLINGQSLDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKLLHQQHHPRA 299


>gi|90580583|ref|ZP_01236388.1| tyrosine recombinase [Vibrio angustum S14]
 gi|90438241|gb|EAS63427.1| tyrosine recombinase [Photobacterium angustum S14]
          Length = 298

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 108/288 (37%), Positives = 167/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTLS+Y+ DL ++  +L  +  ++ + S + L  Y   L  +    +S+ R +S
Sbjct: 18  ERGLSENTLSSYRNDLTKLLRWLKQESRNVISVSVDDLQRYQQWLFDKDYKQTSRARMVS 77

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LLE              
Sbjct: 78  AIRRLFQYLHREKMRDDDPSAMLVTPKLPKRLPKDLSEAQVDALLEAP-------DVNDP 130

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELVTL+   ++L +  + I GKG+KERLV +  +A+  ++
Sbjct: 131 IELRDKAMLELLYATGLRVTELVTLTMENISLRQGVVRITGKGDKERLVPMGENAVDWIE 190

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +T     +      +   S +   ++RQ F   +K  A  AGI    +SPH++RHAF
Sbjct: 191 QFIETGRPQLLGEKSSDVLFPSRRARQMTRQTFWHRIKHYAVLAGIDADTLSPHVMRHAF 250

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 251 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQTHHPRA 298


>gi|330872807|gb|EGH06956.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 298

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L           S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLPSAGREVILDHLAWRVDNAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLIAVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYMRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEMHAKHHPRG 298


>gi|189465186|ref|ZP_03013971.1| hypothetical protein BACINT_01531 [Bacteroides intestinalis DSM
           17393]
 gi|189437460|gb|EDV06445.1| hypothetical protein BACINT_01531 [Bacteroides intestinalis DSM
           17393]
          Length = 316

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 104/297 (35%), Positives = 161/297 (54%), Gaps = 8/297 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+A S NTL AY  DL ++  FL  + I + A + + L  +   L    +   SQ R
Sbjct: 24  LKLEKALSANTLDAYLTDLNKLLCFLKTENIDMLAVTLDDLQRFAAGLHDIGIHPRSQAR 83

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S I+ F++FL     R+D+PS+ LE PK    LP+ L  + I  ++            
Sbjct: 84  ILSGIKSFFHFLVMADYREDDPSELLEGPKIGFKLPEVLTVEEIDTIISTV-------DM 136

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            + +  R   ++E LY+ G+RVSEL  L    L   E  + ++GKG+K+RLV +SP A+ 
Sbjct: 137 SKKEGQRNRAILETLYSCGLRVSELCNLKLSELYFDEGFIKVEGKGSKQRLVPISPRAIK 196

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ +    +  K+          +     +SR +    +K LA +AGI  KNISPH  R
Sbjct: 197 EIKYWLLDRNLGKIKKGFEDYVFLARWGNSISRIMVFHLIKELAEKAGIT-KNISPHTFR 255

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKH 298
           H+FA+HLLEGGA+LR IQ +LGH  I+TT+IYTH+  + L+  + ++HP   K +K 
Sbjct: 256 HSFATHLLEGGANLRAIQCMLGHESIATTEIYTHIDRNMLRSEIIEHHPRNIKYRKD 312


>gi|238763216|ref|ZP_04624181.1| Tyrosine recombinase xerD [Yersinia kristensenii ATCC 33638]
 gi|238698489|gb|EEP91241.1| Tyrosine recombinase xerD [Yersinia kristensenii ATCC 33638]
          Length = 299

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 107/291 (36%), Positives = 169/291 (58%), Gaps = 7/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  + NTL++Y+ DL  +  +L + +  L  A +  L S+L    +     +S  R
Sbjct: 16  LWLERNLAENTLASYRLDLHALSGWLEHHDSDLLRAGSQDLQSFLAERIEGGYKATSSAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R+ + +L  E LR+D+P+  L  PK    LPK L +  +  LL    ++      
Sbjct: 76  LLSAMRRLFQYLYREKLREDDPTALLSSPKLPQRLPKDLSEAQVDALLNSPNVDI----- 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++
Sbjct: 131 --PLELRDKAMLEVLYATGLRVSELVGLTISDVSLRQGVVRVIGKGNKERLVPLGEEAVY 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G  L +   S ++  ++RQ F   +K  A  AGI  + +SPH++R
Sbjct: 189 WIENYMEHGRPWLINGQSLDVLFPSNRSQQMTRQTFWHRIKHYAILAGIDSERLSPHVLR 248

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ L Q +HP A
Sbjct: 249 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLKLLHQQHHPRA 299


>gi|223044229|ref|ZP_03614266.1| tyrosine recombinase XerC [Staphylococcus capitis SK14]
 gi|222442379|gb|EEE48487.1| tyrosine recombinase XerC [Staphylococcus capitis SK14]
          Length = 296

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 98/294 (33%), Positives = 151/294 (51%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S  TL +Y  DL +  +FL ++ + L+        +YL+ L    L  ++  
Sbjct: 11  MLKVERNFSEYTLKSYHDDLIQFNDFLVSEHLDLATFEYKDARNYLSFLYSHNLKRTTVS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY +   +     NP   L  PKK   LP+  +++ +  L +  K +++   
Sbjct: 71  RKISTLRTFYEYWMTQDESIVNPFVQLVHPKKEQYLPQFFYEEEMEALFQTVKQDSK--- 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  ++IELLYATG+RVSELV +    +++    + + GKGNKER +       
Sbjct: 128 ----KGIRDRVIIELLYATGIRVSELVNIKIKDIDMNLPGVKVLGKGNKERFIPFGEFCK 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y       K T +  +L  +        R V       +   AG+    I PH +
Sbjct: 184 QSIERYLDEFQPRK-TNDHEYLIVNMNGAPITERGVRYVLNDVVKRTAGVTD--IHPHKL 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+  + HP AKK
Sbjct: 241 RHTFATHLLNQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLRKVYLNAHPRAKK 294


>gi|332704250|ref|ZP_08424338.1| Tyrosine recombinase xerC [Desulfovibrio africanus str. Walvis Bay]
 gi|332554399|gb|EGJ51443.1| Tyrosine recombinase xerC [Desulfovibrio africanus str. Walvis Bay]
          Length = 313

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 91/297 (30%), Positives = 151/297 (50%), Gaps = 12/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSA---ASTNHLISYLNHLSQRKLVTSS 58
           +  E+  S  T+ AY RD+++ + FL+ ++ SL+       + + S+L  L +  +  SS
Sbjct: 24  LDVEKGYSPATVQAYGRDVEQFERFLSRRDRSLAEPEGVDRDDVRSFLAELHRMGVRKSS 83

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             RK+S +R  + +L   GL   NP   +  PK++   PK+L+ D    ++E        
Sbjct: 84  MSRKLSSLRTLFRYLRKSGLATGNPMAGVGNPKQDKRHPKSLNVDQALAVMEA------- 136

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                 + +R   L ELLY +G+R+SE + L+   ++     + + GKG KER+V LS +
Sbjct: 137 QVSAGPEGLRDLALAELLYGSGLRISEALDLNVDDIDPGSGILRVMGKGRKERIVPLSDA 196

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           ++  L+ Y     +  +   +  LF  S       RQ                 ++ISPH
Sbjct: 197 SVRRLKSYLVQRHAFPVEPQERALFLGSRGGRLNRRQAARIVEHMAGLAG--LPQSISPH 254

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
            +RH+FASHLL+ GA LR++Q LLGH  ++TTQ YTHL   ++ +     HP +KK+
Sbjct: 255 TLRHSFASHLLQSGAGLRSVQELLGHKRLTTTQRYTHLNLAQITRAYDAAHPRSKKK 311


>gi|237785449|ref|YP_002906154.1| integrase/recombinase [Corynebacterium kroppenstedtii DSM 44385]
 gi|237758361|gb|ACR17611.1| integrase/recombinase [Corynebacterium kroppenstedtii DSM 44385]
          Length = 326

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 90/298 (30%), Positives = 151/298 (50%), Gaps = 13/298 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQ-------RKL 54
           ++ E+ +S NTLS Y+RDL +   +L+  ++++ +     +  ++  L +         L
Sbjct: 35  LAVEKNASPNTLSNYQRDLNKYVAWLDQHDLNIDSVDEPDIEQFIADLRRGDSTLGWSPL 94

Query: 55  VTSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKI 114
             SS  R    +R  + F   EG    + +  + + +    LP  L  + +  L+E   +
Sbjct: 95  AASSAARATVAVRSLHRFSHEEGQLARDVAAGVTVLRSGQSLPHALTVEQVNRLIEACPV 154

Query: 115 EAENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVI 174
                       +R   +IELLY TGMR+SE + L   +++     + + GKG KERLV 
Sbjct: 155 NE----SSNPIALRDRAVIELLYGTGMRISEALNLDIDSIDRNHAYVRVVGKGRKERLVP 210

Query: 175 LSPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKN 234
           +   ALHA+  +        +  +D  LF ++     L RQ   + L A A R G+   +
Sbjct: 211 IGAPALHAIDAWLVRGRPSMVKRSDKALFLNAR-GNRLGRQSVWKFLHAAAERCGLGD-S 268

Query: 235 ISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           + PH +RH++A+HLL+GGAD+R +Q LLGH  ++TTQIYT +  D L+++    HP A
Sbjct: 269 VGPHTLRHSYATHLLQGGADIRAVQELLGHASVTTTQIYTAVSIDNLREVYATSHPRA 326


>gi|194367246|ref|YP_002029856.1| site-specific tyrosine recombinase XerC [Stenotrophomonas
           maltophilia R551-3]
 gi|194350050|gb|ACF53173.1| tyrosine recombinase XerC [Stenotrophomonas maltophilia R551-3]
          Length = 296

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 98/298 (32%), Positives = 153/298 (51%), Gaps = 15/298 (5%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S +TL AY+RDL  +  +   + +++ A     L  ++    +R L   S +R
Sbjct: 11  LQVERRMSAHTLDAYRRDLDALSVWAEPRGMAVEALDAETLRQFVADEHRRGLSAKSLQR 70

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           ++S  R FY +L   G  + NP+ TL+ P+    LP+ L  D    L+E          P
Sbjct: 71  RLSACRSFYAWLLKHGRIEVNPAATLKAPRAPRRLPQVLDADEAVQLVE--------LEP 122

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                 R   L+EL Y++G+R+SE+  L+   L+     + + GKGN++R V     A  
Sbjct: 123 EGELGRRDRALLELFYSSGLRLSEVCALTWRDLDFASGLVNVMGKGNRQRRVPFGRPARE 182

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           ALQ ++        +G    +     + G +S++     ++ LA R G+  K++ PH++R
Sbjct: 183 ALQAWRAE------SGGGPAMPVFPGRNGPISQRAVQIRIRQLAQRQGL-FKHVHPHMLR 235

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           H+FASH+LE   DLR +Q LLGH DI+TTQIYTHL    L K+    HP AK+  K  
Sbjct: 236 HSFASHILESSGDLRGVQELLGHADIATTQIYTHLDFQHLAKVYDAAHPRAKRRSKDD 293


>gi|330964079|gb|EGH64339.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 298

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L           S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLPSAGREVILDHLAWRVDNAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLIAVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYMRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGIS-KSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEMHAKHHPRG 298


>gi|213969060|ref|ZP_03397199.1| integrase/recombinase XerD [Pseudomonas syringae pv. tomato T1]
 gi|301384045|ref|ZP_07232463.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           tomato Max13]
 gi|302058751|ref|ZP_07250292.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           tomato K40]
 gi|302131712|ref|ZP_07257702.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|213926058|gb|EEB59614.1| integrase/recombinase XerD [Pseudomonas syringae pv. tomato T1]
          Length = 298

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L  A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLPGAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYMRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEMHAKHHPRG 298


>gi|254284183|ref|ZP_04959151.1| tyrosine recombinase XerD [gamma proteobacterium NOR51-B]
 gi|219680386|gb|EED36735.1| tyrosine recombinase XerD [gamma proteobacterium NOR51-B]
          Length = 299

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 102/292 (34%), Positives = 161/292 (55%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NTL+AY+RDL++  +FL+ + I SL AA    L  +L    +      S  
Sbjct: 16  LWIERGLSANTLAAYRRDLRQFADFLDERGIASLKAADAGALQGFLASRLKSGHSNRSAA 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R FY +   E     +P+  ++ P+    LPK++ +  +  LL    +E     
Sbjct: 76  RFLSTLRGFYRYHLRENRIDRDPTQFIDSPRLGRSLPKSISEADVERLLAAPNVE----- 130

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   ++ELLYA G+RV+EL  L    L+L +  + + GKG+KERL+ +   AL
Sbjct: 131 --DPIDFRDRTMLELLYACGLRVTELTGLQVSQLSLNQGVVRVVGKGDKERLIPIGEEAL 188

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +Q +      + +      +   S + G ++RQ F   +K  A RAGI+  ++SPH +
Sbjct: 189 SWVQQFLAGPRQVLLKERMSEVLFPSNRGGQMTRQTFWYRIKLHAKRAGIE-AHLSPHTL 247

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RHAFA+HL+  GADLR +Q+LLGH+D++TTQIYTH+   ++Q+L   +HP  
Sbjct: 248 RHAFATHLINHGADLRVVQMLLGHSDLTTTQIYTHVARHRMQQLHAQHHPRG 299


>gi|149177593|ref|ZP_01856195.1| integrase/recombinase [Planctomyces maris DSM 8797]
 gi|148843573|gb|EDL57934.1| integrase/recombinase [Planctomyces maris DSM 8797]
          Length = 313

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 95/299 (31%), Positives = 150/299 (50%), Gaps = 11/299 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKE---ISLSAASTNHLISYLNHLSQRKLVTSS 58
           +  ER SS  TL +Y  DL+ +  +L   E   +       + L  Y+ +L + +   ++
Sbjct: 23  LQIERNSSDLTLKSYAEDLESLVEYLTEYEGALLPPDQIGISELRRYVAYLHECQYEKTT 82

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             R+++ +R F+ + C EG  K NP+  L  P+    LP  L  D I  LLE      + 
Sbjct: 83  IARRLACLRSFFRYCCREGYSKTNPAKPLRTPRTGRKLPHFLTTDQIGTLLEAPPANQKM 142

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E LY+ G+RVSELV L+    +     + + GKG KER+  +   
Sbjct: 143 -------GLRDRAILETLYSAGLRVSELVALNVSDWDQDANIIRVLGKGRKERIAPIGSF 195

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           A  AL  + +   +      D      +     L+ +   R L+    + G+ KK  SPH
Sbjct: 196 AAKALTHWLEEREAKPGAHPDSDALFLNRLKTRLTSRSVGRMLEKYLLQTGLDKKT-SPH 254

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
            +RH FA+HLL+GGADLR++Q LLGH  ++TTQIYTH+   +L +  +  HP A++ KK
Sbjct: 255 TLRHTFATHLLDGGADLRSVQELLGHKSLTTTQIYTHVSTKRLLETYEKAHPHAQRSKK 313


>gi|146308415|ref|YP_001188880.1| site-specific tyrosine recombinase XerD [Pseudomonas mendocina ymp]
 gi|145576616|gb|ABP86148.1| tyrosine recombinase XerD subunit [Pseudomonas mendocina ymp]
          Length = 298

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 103/291 (35%), Positives = 166/291 (57%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S +T +AY+ DL+   ++L+ + + L     + ++ +L    ++     S  R
Sbjct: 16  LWLEKGLSAHTRAAYRSDLEHFNHWLDGRGLQLQCIGRDAILDHLAWRLEQGYQARSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R FY FL  EG+ +++PS  +ELP+    LPK+L +  +  LL+           
Sbjct: 76  FLSGVRGFYRFLLREGVVEEDPSLQVELPQIGRPLPKSLSEADVEALLQAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYA G+RVSELV L+   +NL +  + + GKG+KERLV L   A+ 
Sbjct: 129 DDPIGLRDRAMLEVLYACGLRVSELVGLTLEQVNLRQGVLRVFGKGSKERLVPLGEEAIA 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +    + + G    +   S +   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WIERYSREARPLLLGGKPSDVLFPSLRGEQMTRQTFWHRIKHQAKVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHIARARLQELHAKHHPRG 298


>gi|289675164|ref|ZP_06496054.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           syringae FF5]
          Length = 298

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 158/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLISAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   ++ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEESIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQELHARHHPRG 298


>gi|325289988|ref|YP_004266169.1| tyrosine recombinase XerD subunit [Syntrophobotulus glycolicus DSM
           8271]
 gi|324965389|gb|ADY56168.1| tyrosine recombinase XerD subunit [Syntrophobotulus glycolicus DSM
           8271]
          Length = 315

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 98/304 (32%), Positives = 167/304 (54%), Gaps = 7/304 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT  +Y+RDLK++  +L   + +L       L S+L  ++++ +   S  R
Sbjct: 13  LKIERGLSGNTCQSYRRDLKKLLIYLEENQNNLFQCQPVDLFSFLYSVNEQGISARSIAR 72

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
             + ++ F+++L  EG R D+P++ + +PK    LP  L +  + +L+     + +    
Sbjct: 73  YTAALKGFFSYLSDEGKRTDDPTELIVVPKLEQPLPHVLSESAVNSLIN--HRDDKESQA 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
           G    +R   ++E+LY +G+RVSEL+TLS + ++L    +  +GKGNKER+V LS   L 
Sbjct: 131 GMLLEIRDTAILEVLYGSGLRVSELITLSLNQISLEVGYVRCRGKGNKERIVPLSEPCLL 190

Query: 182 ALQMYKKTCSSMKMTGNDLWLF--PSSTKTGHLSRQVFARDLKALAARAGIQKK---NIS 236
           ALQ Y     +  +  N        +S        ++  + +  +     ++ K    I 
Sbjct: 191 ALQKYLLEARNHLLRKNRKPTTAESNSLFLNARGGRLTRQGIWTILKNRAVKNKAGAKIY 250

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH++RH FA+HLL+ GADLR++Q +LGH DISTTQIYTHL  ++L+ + +  HP AK+  
Sbjct: 251 PHLMRHCFATHLLDHGADLRSVQEMLGHADISTTQIYTHLTKNRLRDVFEKAHPRAKRGG 310

Query: 297 KHYN 300
           +  +
Sbjct: 311 QKND 314


>gi|104783227|ref|YP_609725.1| site-specific tyrosine recombinase XerD [Pseudomonas entomophila
           L48]
 gi|95112214|emb|CAK16941.1| site-specific tyrosine recombinase, integrase family [Pseudomonas
           entomophila L48]
          Length = 298

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 99/291 (34%), Positives = 161/291 (55%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT ++Y+ DL     +L  + ++L  A    ++ +L     +     S  R
Sbjct: 16  LWLEKGLSDNTRTSYRSDLALFNGWLQEQGVALPDAGRELILDHLAWRFDQAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R FY +L  E +   +P+  +++P+    LPK+L +  +  LL+           
Sbjct: 76  FLSGVRGFYRYLLRERMIAVDPTLQVDMPQLGRPLPKSLSEADVEALLKAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
           G+    R   ++E+LYA G+RV+ELV+L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 GEAIGQRDRAMLEVLYACGLRVTELVSLTLDQVNLRQGVLRVMGKGSKERLVPMGEEAVL 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +   +  + G    +   S +   ++RQ F   +K  A  AGI K  +SPH +R
Sbjct: 189 WLERYLRDGRAELLNGRPSDVLFPSLRGEQMTRQTFWHRIKHHARVAGIDKP-LSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVAKARLQQLHAQHHPRG 298


>gi|323495869|ref|ZP_08100937.1| site-specific tyrosine recombinase XerD [Vibrio sinaloensis DSM
           21326]
 gi|323319085|gb|EGA72028.1| site-specific tyrosine recombinase XerD [Vibrio sinaloensis DSM
           21326]
          Length = 302

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 105/288 (36%), Positives = 165/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL++Y+ DL ++  ++++    L   S + L  Y   L       +S+ R +S
Sbjct: 22  ERGLSENTLASYRNDLMKLLQWMSSHNYRLDFISLSGLQEYQTWLVDEGYKQTSRARMLS 81

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E  R D+PS  L  PK    LPK L +  +  LL+          P   
Sbjct: 82  AIRRLFQYLHREKRRADDPSALLVSPKLPKRLPKDLSEQQVDALLDAP-------DPNDP 134

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 135 MELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVTGKGGKERLVPMGENAVDWIE 194

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +   S  +  N   +   S +   ++RQ F   +K  A  AGI    +SPH++RHAF
Sbjct: 195 TFLQQGRSELLGENTSDVVFPSKRARQMTRQTFWHRIKHYAVIAGIDADKLSPHVLRHAF 254

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 255 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHSEHHPRA 302


>gi|189485661|ref|YP_001956602.1| tyrosine recombinase XerD [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287620|dbj|BAG14141.1| tyrosine recombinase XerD [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 294

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 111/289 (38%), Positives = 152/289 (52%), Gaps = 11/289 (3%)

Query: 4   SERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKI 63
            E+  S NT+ AYK D+ +  NF   K ISL     N +  +L  +    L   S  R I
Sbjct: 17  VEKGLSENTVLAYKADVLKFINFAKKKRISLENFEHNDITDFLWEMKTEGLKPRSIFRVI 76

Query: 64  SVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQ 123
             +RQFY FL  E L K+NP+  L  P     LP  L  D +  LL     + E      
Sbjct: 77  ESLRQFYKFLNSEDLAKNNPTLYLATPNLPENLPDILTFDEVDLLLNSINDDDEMH---- 132

Query: 124 WKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHAL 183
              +R   ++ELLYA G+RVSEL+ L    +NL +  + I GKG+KERLV     A   +
Sbjct: 133 ---IRNKAMLELLYAAGLRVSELINLKFSDINLEDCFLRIIGKGSKERLVPFGNKAKFFI 189

Query: 184 QMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHA 243
            +Y K         + +++         LSR  F R LK +A   GI  KNI+PH +RH+
Sbjct: 190 SIYLKKRRPCLNVNDHIFISRL---GKKLSRIEFWRQLKNIAKNVGIN-KNITPHTLRHS 245

Query: 244 FASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           FASHLL+GGAD+R +Q +LGH  I+TTQIYTHL  D++ +  + +HP  
Sbjct: 246 FASHLLKGGADIRFVQEMLGHASITTTQIYTHLDEDRIVQQHKKFHPRG 294


>gi|89072532|ref|ZP_01159104.1| tyrosine recombinase [Photobacterium sp. SKA34]
 gi|89051636|gb|EAR57089.1| tyrosine recombinase [Photobacterium sp. SKA34]
          Length = 298

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 108/288 (37%), Positives = 167/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTLS+Y+ DL ++  +L  +  ++ + S + L  Y   L  +    +S+ R +S
Sbjct: 18  ERGLSENTLSSYRNDLTKLLRWLKQESRNVISVSVDDLQRYQQWLFDKDYKQTSRARMVS 77

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LLE              
Sbjct: 78  AIRRLFQYLHREKMRDDDPSVMLVTPKLPKRLPKDLSEAQVDALLEAP-------DVNDP 130

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELVTL+   ++L +  + I GKG+KERLV +  +A+  ++
Sbjct: 131 IELRDKAMLELLYATGLRVTELVTLTMENISLRQGVVRITGKGDKERLVPMGENAVDWIE 190

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +T     +      +   S +   ++RQ F   +K  A  AGI    +SPH++RHAF
Sbjct: 191 QFIETGRPQLLGEKSSDVLFPSRRARQMTRQTFWHRIKHYAVLAGIDADTLSPHVMRHAF 250

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 251 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQTHHPRA 298


>gi|269959610|ref|ZP_06173991.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269835668|gb|EEZ89746.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 305

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 165/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL++Y+ DL ++  ++      L   S + L  Y ++L       +S+ R +S
Sbjct: 25  ERGLSENTLASYRNDLMKLLAWMEQHSYRLDFISLSGLQEYQSYLVDLDYKQTSRARMLS 84

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + ++  E +R D+PS  L  PK    LPK + ++ +  LL+          P   
Sbjct: 85  AIRRLFQYIHREKVRADDPSALLVSPKLPQRLPKDISEEQVDALLDAP-------DPNDP 137

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 138 VELRDKAMLELLYATGLRVTELVSLTMENVSLRQGVVRVTGKGGKERLVPMGENAVDWIE 197

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +   S  +      +   S +   ++RQ F   +K  A  AGI    +SPH++RHAF
Sbjct: 198 TFIQQGRSALLGETTSDVVFPSKRARQMTRQTFWHRIKYYAVIAGIDTDQLSPHVLRHAF 257

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+++   +HP A
Sbjct: 258 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQIHSQHHPRA 305


>gi|224537518|ref|ZP_03678057.1| hypothetical protein BACCELL_02397 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520831|gb|EEF89936.1| hypothetical protein BACCELL_02397 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 316

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 103/296 (34%), Positives = 161/296 (54%), Gaps = 8/296 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+A S NTL AY  DL ++  FL  + I + + + + L  +   L    +   SQ R
Sbjct: 24  LKLEKALSANTLDAYLTDLDKLLRFLKAENIDMLSVTLDDLQRFAAGLHDIGIHPRSQAR 83

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S I+ F++FL     R+D+PS+ LE PK    LP+ L  + I  ++            
Sbjct: 84  IMSGIKSFFHFLIMADYREDDPSELLEGPKIGFKLPEVLTVEEIDTIIATV-------DM 136

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            + +  R   ++E LY+ G+RVSEL  L    L   E  + ++GKG+K+RLV +SP A+ 
Sbjct: 137 SKKEGQRNRAILETLYSCGLRVSELCNLKLSELYFDEGFIKVEGKGSKQRLVPISPRAIK 196

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ +    +  K+          +     +SR +    +K LA +AGI  KNISPH  R
Sbjct: 197 EIKYWLLDRNLGKIKKGFEDYVFLARWGNSISRIMVFHLIKELAEKAGIT-KNISPHTFR 255

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           H+FA+HLLEGGA+LR IQ +LGH  I+TT+IYTH+  + L+  + ++HP   K +K
Sbjct: 256 HSFATHLLEGGANLRAIQCMLGHESIATTEIYTHIDRNMLRSEIIEHHPRNIKYRK 311


>gi|229592394|ref|YP_002874513.1| site-specific tyrosine recombinase XerD [Pseudomonas fluorescens
           SBW25]
 gi|229364260|emb|CAY51975.1| integrase/recombinase [Pseudomonas fluorescens SBW25]
          Length = 298

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 99/291 (34%), Positives = 156/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  AY+ DL     +L  K + L  A    ++ +L    ++     S  R
Sbjct: 16  LWLEKGLSDNTRQAYRSDLALFNGWLQEKNLELINAGRELILDHLAWRLEQNYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R FY +L  E L   +P+  +E+P+    LPK+L +  +  LL            
Sbjct: 76  FLSGVRGFYRYLLREKLIALDPTLQVEMPQLGRPLPKSLSEADVDALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEAIGQRDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   S +   ++RQ F   +K  A  AGI  K +SPH +R
Sbjct: 189 WVERYMRDARGELLGGRPSDVLFPSLRGEQMTRQTFWHRIKHQAKVAGI-GKALSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ +   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQDMHAKHHPRG 298


>gi|86158112|ref|YP_464897.1| tyrosine recombinase XerD subunit [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774623|gb|ABC81460.1| tyrosine recombinase XerD subunit [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 314

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 105/296 (35%), Positives = 159/296 (53%), Gaps = 12/296 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVT 56
            +     E+  + N++ AY RDL+     L+   +        + + ++L  L +R L  
Sbjct: 27  FLAHVRVEKGLAENSVEAYGRDLRRYLEHLDELGVDAWERVGRSEIQAHLAELVRRGLSP 86

Query: 57  SSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEA 116
            SQ R +S IR  +  L  E +   +PSD +E P+    LP  L  D +  LL       
Sbjct: 87  RSQARALSAIRSLHRLLAAERVTSADPSDEIESPRPGRRLPGLLSHDEVDRLLAAP---- 142

Query: 117 ENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILS 176
                     +R   ++ELLYATG+RVSELV+L  + +NL  R ++ +GKG+KER+V + 
Sbjct: 143 ---DVRSAAGIRDRAMLELLYATGLRVSELVSLQLNDVNLETRVLVARGKGDKERIVPVG 199

Query: 177 PSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
             A  A++ Y        + G        + + G ++RQ FA+ L   A RAG  ++ IS
Sbjct: 200 APAADAVKAYLAVARERLLHGRRSKDLFVTPRGGRMTRQGFAKILDRCARRAG-IRRRIS 258

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           PH +RH+FA+HLLEGGADLR +Q +LGH D+STTQIYTH+    +++L   +HP A
Sbjct: 259 PHKLRHSFATHLLEGGADLRAVQEMLGHADVSTTQIYTHVDRTHVKRLYDRFHPRA 314


>gi|78043995|ref|YP_360612.1| tyrosine recombinase XerC [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77996110|gb|ABB15009.1| tyrosine recombinase XerC [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 297

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 94/297 (31%), Positives = 163/297 (54%), Gaps = 12/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NT++AY+RD+ + Q FL  +  S  + +   L  +L  + ++     +  R
Sbjct: 12  LLLERNYSPNTIAAYERDILDFQEFL--QGKSFLSVNEVDLKQFLVDILRKNRSRRTAAR 69

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           K+  +R FY FL   G  K+NP+ +LE+PK    LP+ L  D +  ++E           
Sbjct: 70  KMVALRSFYRFLKRCGFIKENPALSLEIPKIPKTLPEVLTVDEVFKVIE-------GQEN 122

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   L+EL Y  G+R+ E+  L+ + L+LT+  + + GKG ++R+V L   AL 
Sbjct: 123 STPTGLRNRALLELFYGAGLRIGEIAGLTLNDLDLTQGYVRVTGKGRRQRIVPLGKYALD 182

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           +L++Y +         ++      + +   L+ +     +  +  +AG+ +K I+PH  R
Sbjct: 183 SLKLYLEAGRPAFKPKSEK--LFLNQQGAGLTVRGIRYLISQIVKKAGLNRK-ITPHTFR 239

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKH 298
           H++A+HLLEGGAD+R +Q LLGH  +STT+IYTHL  ++L+++    HP +++EK  
Sbjct: 240 HSYATHLLEGGADIRAVQELLGHKRLSTTEIYTHLSKERLREVYLRTHPRSREEKND 296


>gi|218131523|ref|ZP_03460327.1| hypothetical protein BACEGG_03142 [Bacteroides eggerthii DSM 20697]
 gi|217986455|gb|EEC52792.1| hypothetical protein BACEGG_03142 [Bacteroides eggerthii DSM 20697]
          Length = 316

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 96/296 (32%), Positives = 161/296 (54%), Gaps = 8/296 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E++ + NT  AY  DL+++ +FL  + I +   + + L  +   L    +   SQ R
Sbjct: 24  LKLEKSLASNTFDAYMTDLQKLLHFLEGENIEVGNVTPDDLQRFAAGLHDIGIHPRSQAR 83

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S I+ F++FL      + +PS+ LE PK    +P+ L  + I  ++    ++      
Sbjct: 84  ILSGIKSFFHFLTVADYLETDPSELLEGPKIGFKIPEVLTVEEIDRIISAVDMD------ 137

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            + +  R   ++E LY+ G+RVSEL  L    L   E  + ++GKG+K+RLV +SP A+ 
Sbjct: 138 -KKEGQRNRAILETLYSCGLRVSELCNLKLSDLYFEEGFIKVEGKGSKQRLVPISPRAIK 196

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ +    +  K+          +    ++SR +    +K LA + GI  KNISPH  R
Sbjct: 197 EIKYWLTDRNLGKIKKGYEDYVFLARWGNNISRIMVFHMIKELAEKTGIT-KNISPHTFR 255

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           H+FA+HLLEGGA+LR IQ +LGH  I+TT+IYTH+  + L+  + ++HP   K +K
Sbjct: 256 HSFATHLLEGGANLRAIQCMLGHESIATTEIYTHIDRNMLRSEIIEHHPRNIKYRK 311


>gi|77359472|ref|YP_339047.1| site-specific tyrosine recombinase XerD [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76874383|emb|CAI85604.1| site-specific tyrosine recombinase XerD [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 308

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 111/291 (38%), Positives = 164/291 (56%), Gaps = 11/291 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NTLSAY+ DL +   FL  K  +L   +   + SYL H     L   S  R
Sbjct: 29  LYLEQGVSENTLSAYRSDLDKFCQFL--KGKNLMTVTGLDVESYLAHRVDLGLKPRSTAR 86

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            IS +++FY +   E L  D+P   +  PK    LPKTL +  +  LL     +      
Sbjct: 87  SISALKRFYQYFVREKLISDSPMLNIAQPKAGQSLPKTLSEAEVEALLSAPNTD------ 140

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +   +R   ++ELLYATG+RVSELV L    +NL +  + ++GKGNKERLV L   A++
Sbjct: 141 -EPMGLRDKAMLELLYATGLRVSELVGLRIEQINLRQAVVFVKGKGNKERLVPLGEEAMY 199

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ + K   +  +     ++FPS      ++RQ F   +K  A  A I+  ++SPH +R
Sbjct: 200 WLEQFLKVGRAQMIKHATDFVFPSKR-GVGMTRQTFWHRVKHYAILASIES-SLSPHTLR 257

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q++LGH+D+STTQIYTH+  ++L+ +   +HP A
Sbjct: 258 HAFATHLLNHGADLRVVQMMLGHSDLSTTQIYTHVANERLKSVHAQHHPRA 308


>gi|302335678|ref|YP_003800885.1| integrase family protein [Olsenella uli DSM 7084]
 gi|301319518|gb|ADK68005.1| integrase family protein [Olsenella uli DSM 7084]
          Length = 308

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 91/294 (30%), Positives = 141/294 (47%), Gaps = 10/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +S  R  S NT+ AY  DL     +   + +     + + L +YL  L + +  + +  R
Sbjct: 23  LSVTRNLSENTIRAYGTDLAAYARWTRRQGVDPLDVTHSQLRAYLGELVRARYSSRTLNR 82

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           ++S IR  Y +L  EG    + +  +  PK    LPKT+    +  LL     +      
Sbjct: 83  RLSAIRTLYRWLVREGYTNKDAAAAIASPKVARTLPKTMTDPDVCQLLGACDEDGV---- 138

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   LIELLYA+G R+SE+  L    ++   R + + GKG KER+V L    + 
Sbjct: 139 ---IGLRDRALIELLYASGARISEISRLDVGDIDRERRQVTLLGKGGKERIVPLYDMCID 195

Query: 182 ALQMYKKTCSSMKMTGNDLWLF--PSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
            L  Y  T     +   +        ST+   +S        +     AG+   +I+PH 
Sbjct: 196 ELDAYLLTARPALVVRGEGASEALFVSTRGRRMSAAALREAFERRVRLAGLD-ADITPHA 254

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           +RH +A+ LL GGADLR++Q LLGH+ +STTQIYTHL  D+L+   +  HP  +
Sbjct: 255 MRHTYATELLSGGADLRSVQELLGHSSLSTTQIYTHLSVDRLKAAARQAHPRGE 308


>gi|329956554|ref|ZP_08297151.1| tyrosine recombinase XerD [Bacteroides clarus YIT 12056]
 gi|328524451|gb|EGF51521.1| tyrosine recombinase XerD [Bacteroides clarus YIT 12056]
          Length = 316

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 100/298 (33%), Positives = 163/298 (54%), Gaps = 8/298 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+A S NT  AY  DL+++ +FL+ + I +   + + L  +   L    +   SQ R
Sbjct: 24  IRLEKALSSNTFDAYMTDLQKLLHFLDGENIDIPDVTPDDLQRFAAGLHDIGIHPRSQAR 83

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S I+ F++FL      + +PS+ LE PK    +P+ L  + I  ++    +E      
Sbjct: 84  ILSGIKSFFHFLVIADYLEADPSELLEGPKIGFKIPEVLTIEEIDRIISTVDME------ 137

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            + +  R   ++E LY+ G+RVSEL  L    L   E  + ++GKG+K+RLV +SP A+ 
Sbjct: 138 -KKEGQRNRAILETLYSCGLRVSELCNLKISDLYFEEGFIKVEGKGSKQRLVPISPRAIK 196

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ +    +  K+          +     +SR +    +K LA +AGI  KNISPH  R
Sbjct: 197 EIKYWFADRNLGKIKKGYEDYVFLARWGNRISRIMVFHMIKELAEKAGIT-KNISPHTFR 255

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           H+FA+HLLEGGA+LR IQ +LGH  I+TT+IYTH+  + L+  + ++HP   K +K +
Sbjct: 256 HSFATHLLEGGANLRAIQCMLGHESIATTEIYTHIDRNMLRSEIIEHHPRNIKYRKEH 313


>gi|297584490|ref|YP_003700270.1| tyrosine recombinase XerD [Bacillus selenitireducens MLS10]
 gi|297142947|gb|ADH99704.1| tyrosine recombinase XerD [Bacillus selenitireducens MLS10]
          Length = 296

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 108/293 (36%), Positives = 162/293 (55%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           +S E+  S  T+ AY  DL     FL +     S    +  H++ YL  ++Q    +SS 
Sbjct: 12  LSVEKGLSTKTIEAYAGDLSGYLTFLQDTYGIFSWKDVNKKHVLHYLQWMNQSGKASSSI 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R +S I+  + FL  E    +NP+  +E P+K  ILPKTL    +  L   A       
Sbjct: 72  SRTLSAIKSLHVFLMLEKEMDENPAVHIERPRKPAILPKTLAISEVEALFSAA------- 124

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
              +   +R   ++E+LY+TGMRVSEL  L    LNL    +   GKGN ER++ L   A
Sbjct: 125 EGNRPIDIRTVAMLEVLYSTGMRVSELCALELKDLNLEMGFVKCTGKGNTERIIPLGEFA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             A+++Y      + M   +      +     +SRQ F + +++LA +AGIQK+ ISPH 
Sbjct: 185 TEAIRIYLDHARPVMMKDKEHHDLFVNHHGHRISRQGFWKLIRSLATKAGIQKE-ISPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR++Q +LGH+DISTTQIYTH+   +++ + + +HP A
Sbjct: 244 LRHSFATHLLENGADLRSVQEMLGHSDISTTQIYTHISQTRMRDVYRKHHPRA 296


>gi|304394166|ref|ZP_07376089.1| tyrosine recombinase XerD [Ahrensia sp. R2A130]
 gi|303293606|gb|EFL87983.1| tyrosine recombinase XerD [Ahrensia sp. R2A130]
          Length = 308

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 132/294 (44%), Positives = 185/294 (62%), Gaps = 3/294 (1%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTLS Y RDL +      N   ++  A   H+  ++  L+      S+Q 
Sbjct: 13  MMSAERGAAANTLSGYGRDLADYSAHCRNTRTTVMDAGAEHVRGWMARLADSGCAASTQA 72

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +RQ Y FL  +GLR+D+P+ T++ PK    LPK + +  +  LL  A+  A    
Sbjct: 73  RKLSAVRQLYRFLFSDGLREDDPTATVDRPKTGRPLPKVISEIDVDRLLGAAQDAARKGE 132

Query: 121 PG--QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
               + +  R   L+ELLYA+G+RVSELV L + T+    R + + GKG KERLV +S +
Sbjct: 133 TSAARLRAARTLALLELLYASGLRVSELVALRSATITPQTRFVNVTGKGAKERLVPISAA 192

Query: 179 ALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPH 238
           AL A++ Y++     K      WLFPS +  GH++RQ FARDLKALA  AG+    +SPH
Sbjct: 193 ALEAVEAYRQAARDHKQA-PSAWLFPSRSAAGHITRQHFARDLKALATSAGLPASKLSPH 251

Query: 239 IIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           ++RHAFASHLL+ GADLR +Q LLGH DI+TTQIYTH+L ++L+ LV+  HPLA
Sbjct: 252 VLRHAFASHLLQNGADLRAVQQLLGHADIATTQIYTHVLEERLRDLVETAHPLA 305


>gi|282879077|ref|ZP_06287837.1| putative tyrosine recombinase XerD [Prevotella buccalis ATCC 35310]
 gi|281298811|gb|EFA91220.1| putative tyrosine recombinase XerD [Prevotella buccalis ATCC 35310]
          Length = 321

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 106/295 (35%), Positives = 161/295 (54%), Gaps = 8/295 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S NTL AY+ DL  + +F   +EIS        L  +   L +  +  +SQ R
Sbjct: 19  LKLERNYSPNTLIAYQNDLGWLLSFCEQQEISPLDVRLEDLQHFAGQLHEHDIGPTSQAR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R FY FL  +G  + +P++ LE P+    LP+ L  + +  +             
Sbjct: 79  ILSGVRSFYRFLVLDGYIEQDPTELLESPRLGEHLPEVLSTEEVDMIENSI-------DL 131

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            + +  R   +IE+L++ G+RVSELV L    L L E  + + GKGNKERLV +SP A+ 
Sbjct: 132 SKPEGQRNKAIIEVLFSCGLRVSELVNLQLSNLYLDEGFIRVTGKGNKERLVPISPKAIK 191

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L ++    + MK+   +      + +  HL+R +    LK  A  AGIQ K ISPH +R
Sbjct: 192 ELNLWFLDRNLMKIKPGEQDYVFLNRRGAHLTRTMILIMLKRQAQEAGIQ-KTISPHTLR 250

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           H+FA+ LL+GGADLR IQ++LGH  I TT+IYTH+    L++ +  +HP   K++
Sbjct: 251 HSFATELLKGGADLRAIQVMLGHESIGTTEIYTHIDTTTLREEILLHHPRNAKDR 305


>gi|66044534|ref|YP_234375.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           syringae B728a]
 gi|63255241|gb|AAY36337.1| Phage integrase:Phage integrase, N-terminal SAM-like [Pseudomonas
           syringae pv. syringae B728a]
          Length = 298

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  AY+ DL     +L  + + L +A    ++ +L           S  R
Sbjct: 16  LWLEKGLSDNTRDAYRSDLALFNGWLQERNVDLISAGREVILDHLAWRVDNAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLIAVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   ++ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEESIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEMHARHHPRG 298


>gi|70728483|ref|YP_258232.1| site-specific tyrosine recombinase XerD [Pseudomonas fluorescens
           Pf-5]
 gi|68342782|gb|AAY90388.1| tyrosine recombinase XerD [Pseudomonas fluorescens Pf-5]
          Length = 298

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 98/291 (33%), Positives = 158/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  AY+ DL     +L  + + L  A    ++ +L    ++     S  R
Sbjct: 16  LWLEKGLSDNTRDAYRSDLALFNGWLQEQGLELPRAGRELILDHLAWRVEQAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R FY +L  E L + +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGVRGFYRYLLREKLIEIDPTLQIDMPQLGRPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEAIGQRDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +   +  + G    +   S +   ++RQ F   +K  A  AGI  K +SPH +R
Sbjct: 189 WVERYMRDARAELLGGRPSDVLFPSLRGEQMTRQTFWHRIKHQAKVAGI-GKALSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQDLHAKHHPRG 298


>gi|170723312|ref|YP_001751000.1| site-specific tyrosine recombinase XerD [Pseudomonas putida W619]
 gi|169761315|gb|ACA74631.1| tyrosine recombinase XerD [Pseudomonas putida W619]
          Length = 298

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 101/291 (34%), Positives = 160/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L +  ++L AA    ++ +L     +     S  R
Sbjct: 16  LWLEKGLSDNTRVSYRSDLALFNGWLQDHGLALPAAGRELILDHLAWRLDQGYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R F+ +L  E L   +P+  +E+P+    LPK+L +  +  LL+           
Sbjct: 76  FLSGLRGFFRYLLREKLIAVDPTLQIEMPQLGKPLPKSLSEADVDALLQAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
           G+    R   ++E+LYA G+RV+ELV+L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 GEAIGQRDRAMLEVLYACGLRVTELVSLALDQVNLRQGVLRVMGKGSKERLVPMGEEAVL 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G    +   S +   ++RQ F   +K  A  AGI K  +SPH +R
Sbjct: 189 WLERYLRDGRVELLNGRPSDVLFPSLRGEQMTRQTFWHRIKHHARIAGIDKP-LSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVAKARLQQLHAQHHPRG 298


>gi|28868685|ref|NP_791304.1| integrase/recombinase XerD [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28851924|gb|AAO54999.1| integrase/recombinase XerD [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|331016306|gb|EGH96362.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 298

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L  A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLPGAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYMRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEMHAKHHPRG 298


>gi|330969023|gb|EGH69089.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 298

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 96/291 (32%), Positives = 158/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLISAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLIAVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   ++ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEESIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEMHARHHPRG 298


>gi|242242534|ref|ZP_04796979.1| tyrosine recombinase XerC [Staphylococcus epidermidis W23144]
 gi|242233961|gb|EES36273.1| tyrosine recombinase XerC [Staphylococcus epidermidis W23144]
          Length = 286

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 149/294 (50%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S  TL +Y  DL +  NFL  + + L         +YL  L   +L  ++  
Sbjct: 1   MLKVERNFSEYTLKSYHDDLVQFNNFLEREHLQLETFEYKDARNYLAFLYSNQLKRTTVS 60

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY F   +     NP   L  PKK   LP+  +++ +  L +  + +     
Sbjct: 61  RKISTLRTFYEFWMTQNNSIINPFVQLVHPKKEKYLPQFFYEEEMEALFQTVEHD----- 115

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  ++IELLYATG+RVSEL+ +    +++    + + GKGNKER +       
Sbjct: 116 --NKKGIRDKVIIELLYATGIRVSELINIKLKDIDMNLPGVKVLGKGNKERFIPFGEFCR 173

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y +     ++  +D +L  +        R V       +   AG+    I PH +
Sbjct: 174 QSIERYLEEFQPKQLANHD-YLIVNMKGDPITERGVRYVLNDVVKRTAGVND--IHPHKL 230

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+  + HP AKK
Sbjct: 231 RHTFATHLLNQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLRKVYLNAHPRAKK 284


>gi|332140209|ref|YP_004425947.1| tyrosine recombinase [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550231|gb|AEA96949.1| tyrosine recombinase [Alteromonas macleodii str. 'Deep ecotype']
          Length = 308

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 110/293 (37%), Positives = 170/293 (58%), Gaps = 10/293 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQ 59
           M+  E+  S +T  +Y+ DL ++  F NN+ I  ++  ST  L  YL +   + L T S 
Sbjct: 25  MLWLEKGLSEHTQQSYRTDLSKLAVFSNNQGIKDIAVLSTEQLQDYLAYRHDKGLSTRST 84

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
           +R +S IR F+ +L  + +R D+P   L  PK    LP +L +  + +LL   + +    
Sbjct: 85  QRALSAIRAFFVYLISKQIRVDSPVSALSNPKTPKALPASLSEQQVEDLLNAPQTD---- 140

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                   R   ++E+LYATG+RVSEL+ L+   ++L +  + + GKGNKERLV L   A
Sbjct: 141 ---DPIECRDRSMLEVLYATGLRVSELIGLTMDQISLQQGVVRVVGKGNKERLVPLGEEA 197

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           +  L  Y KT   +  T    +++ S      ++RQ F   +K  A +AGI+ +++SPH 
Sbjct: 198 IEWLLTYIKTARPILATKTSDFVYLSKR-GQKMTRQTFWHRIKYYAVKAGIE-QHLSPHT 255

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RHAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++LQ L+  +HP  
Sbjct: 256 LRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLQTLIHSHHPRG 308


>gi|251810683|ref|ZP_04825156.1| tyrosine recombinase XerC [Staphylococcus epidermidis BCM-HMP0060]
 gi|293366784|ref|ZP_06613460.1| tyrosine recombinase XerC [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|251805843|gb|EES58500.1| tyrosine recombinase XerC [Staphylococcus epidermidis BCM-HMP0060]
 gi|291319085|gb|EFE59455.1| tyrosine recombinase XerC [Staphylococcus epidermidis
           M23864:W2(grey)]
          Length = 286

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 149/294 (50%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S  TL +Y  DL +  NFL  + + L         +YL  L   +L  ++  
Sbjct: 1   MLKVERNFSEYTLKSYHDDLVQFNNFLEREHLQLETFEYKDARNYLAFLYSNQLKRTTVS 60

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY F   +     NP   L  PKK   LP+  +++ +  L +  + +     
Sbjct: 61  RKISTLRTFYEFWMTQDNSIINPFVQLVHPKKEKYLPQFFYEEEMEALFQTVEHD----- 115

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  ++IELLYATG+RVSEL+ +    +++    + + GKGNKER +       
Sbjct: 116 --NKKGIRDKVIIELLYATGIRVSELINIKLKDIDMNLPGVKVLGKGNKERFIPFGEFCR 173

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y +     ++  +D +L  +        R V       +   AG+    I PH +
Sbjct: 174 QSIERYLEEFQPKQLANHD-YLIVNMKGDPITERGVRYVLNDVVKRTAGVND--IHPHKL 230

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+  + HP AKK
Sbjct: 231 RHTFATHLLNQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLRKVYLNAHPRAKK 284


>gi|302879928|ref|YP_003848492.1| tyrosine recombinase XerD [Gallionella capsiferriformans ES-2]
 gi|302582717|gb|ADL56728.1| tyrosine recombinase XerD [Gallionella capsiferriformans ES-2]
          Length = 305

 Score =  183 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 105/293 (35%), Positives = 160/293 (54%), Gaps = 10/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFL-NNKEISLSAASTNHLISYLNHL-SQRKLVTSSQ 59
           +  E   S NTL +Y+RDL +  ++L N +   L   +   L  Y+  L   +K   SS 
Sbjct: 14  LWLEDGLSRNTLDSYRRDLNKFSDWLRNQRGQDLLQTTHADLQGYIADLFIVQKAKPSSA 73

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R +S +++ + +L  +G    +P+  ++ PK    LP++L +  +  LL    IE    
Sbjct: 74  GRNLSSLKRLFRYLLRQGKIAIDPTLKIDTPKLPRNLPQSLTEQDVEQLLAAPDIE---- 129

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   + E+LYATG+RVSELV+L    L++    + + GKGNKERLV L   A
Sbjct: 130 ---TSLGLRDRTMFEVLYATGLRVSELVSLGIGQLDMDMGVVRVAGKGNKERLVPLGEVA 186

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
           L  LQ Y      + + G        + +   ++RQ+F   +K  A + G+ K  +SPH 
Sbjct: 187 LDWLQSYLDDSRGVLLAGRISDDLFVTARGSGMTRQMFWYLIKKHAKQGGLDKP-LSPHT 245

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RHAFA+HLL  GADLR +Q+LLGH DISTTQIYTH+  ++L++L   +HP  
Sbjct: 246 LRHAFATHLLNHGADLRVVQMLLGHADISTTQIYTHVARERLKQLHAKHHPRG 298


>gi|325068736|ref|ZP_08127409.1| tyrosine recombinase XerD [Actinomyces oris K20]
          Length = 307

 Score =  183 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 108/304 (35%), Positives = 157/304 (51%), Gaps = 19/304 (6%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLS-----QRKLV 55
           +  ER  S +TLSAY+RDL     +L +  IS     S N +  +L  L       R L 
Sbjct: 8   LRVERGLSPHTLSAYERDLGRYLRYLRSAGISAPQEVSRNDVAGFLEVLRTGSDGARPLA 67

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
           +SS  R ++ +R ++ FL  EG   ++PS T+  P+    LPK L  D +  LLE A ++
Sbjct: 68  SSSASRTVTAVRGWHKFLLAEGTTSEDPSATVRPPQPGRRLPKALGVDEVRRLLEAAGVD 127

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
                      +R   L+E+LYATG R+SE V L    L+   + + + GKG KER+V +
Sbjct: 128 ------DSPVSLRDRALLEVLYATGARISEAVGLVVDDLDTDSKLLRLFGKGRKERVVPM 181

Query: 176 SPSALHALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGI---- 230
              A  AL  Y       +   G  +     +T    LSRQ     L+  A RAG+    
Sbjct: 182 GAYAWEALDAYLVRGRPVLAEKGRGVPQVFLNTLGRPLSRQSAWAVLQQAAERAGLIGTD 241

Query: 231 --QKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDY 288
              ++ ISPH +RH+FA+HLL GGAD+R +Q +LGH  ++TTQIYT +  D L+++    
Sbjct: 242 GADERRISPHTLRHSFATHLLAGGADVRVVQEMLGHASVTTTQIYTKVTVDHLREVYATS 301

Query: 289 HPLA 292
           HP A
Sbjct: 302 HPRA 305


>gi|300812172|ref|ZP_07092616.1| tyrosine recombinase XerD [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
 gi|300496857|gb|EFK31935.1| tyrosine recombinase XerD [Lactobacillus delbrueckii subsp.
           bulgaricus PB2003/044-T3-4]
          Length = 301

 Score =  183 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 100/290 (34%), Positives = 153/290 (52%), Gaps = 9/290 (3%)

Query: 3   SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRK 62
             ER  S NT++AYK+DL E   F+  +++         + ++L          SS  R 
Sbjct: 19  QIERGLSPNTIAAYKQDLLEFLAFVKEEQMPAWPLEAVEIDAFLAKERDLGKANSSISRL 78

Query: 63  ISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPG 122
           +S + +FY +L  + L   +P   ++ PK+   +P  L +  +  LLEQ           
Sbjct: 79  VSTLSRFYQWLVRQQLIALDPMSQIDAPKREKRMPLALTEAEVGKLLEQP-------DLT 131

Query: 123 QWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHA 182
               +R   L+ELLYATGMRVSE V L    ++   + + + GKG+KERL+ +S  AL  
Sbjct: 132 TDLGIRDRALVELLYATGMRVSEAVNLQLADVHADLQLIKVLGKGSKERLIPVSALALDW 191

Query: 183 LQMYKKTCSSMKMT-GNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           ++ Y        +  G        +++ G L+RQ   + +K    +AGI  K+++PH +R
Sbjct: 192 IKRYLPVRDQQLLKRGKSSDYLFLNSRGGQLTRQAVWQKIKKYCQQAGI-AKDVTPHTLR 250

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           H+FA+HLLE GADLR +Q +LGHTDISTTQIYT+L    +  + Q  HP 
Sbjct: 251 HSFATHLLEHGADLRVVQEILGHTDISTTQIYTNLTQKHILDVYQKTHPR 300


>gi|260426671|ref|ZP_05780650.1| tyrosine recombinase XerD [Citreicella sp. SE45]
 gi|260421163|gb|EEX14414.1| tyrosine recombinase XerD [Citreicella sp. SE45]
          Length = 308

 Score =  183 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 121/302 (40%), Positives = 172/302 (56%), Gaps = 13/302 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +   ++ER ++ NT +AY RDL +   +L  +   L  A    +  YL       L  S
Sbjct: 10  FLEAQAAERGAADNTTAAYARDLADFTRWLTARGAGLDTAQRADVEDYLVTCEAEGLAIS 69

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           ++ R++S I+Q Y F   EGLR DNP+  +  P K   LPKTL  + +  L+E A  +  
Sbjct: 70  TRARRLSSIKQLYRFAFEEGLRSDNPAVQISGPGKPKRLPKTLSIEEVDRLIEAAASQGR 129

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                   R+R   L++LLYATGMRV+ELVTL         R ++I+GKG KER+V LSP
Sbjct: 130 TEDD----RLRNACLMQLLYATGMRVTELVTLPVSAARGDPRMLLIRGKGGKERMVPLSP 185

Query: 178 SALHALQMYKKTCSSMKM------TGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ 231
            A  AL  +       +           + LFPS  K GHL+R  F   +K +A  AG+ 
Sbjct: 186 PARVALATWLSRRDEQEAVAHAAGKPASVHLFPSRGKAGHLTRHAFYLLIKEIAVSAGVS 245

Query: 232 KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
              ++PH +RHAFA+HLL+ GADLR IQ  LGH D++TT+IYTH+L ++L++LV D+HPL
Sbjct: 246 PGKVTPHTLRHAFATHLLQNGADLRAIQTFLGHADVATTEIYTHVLEERLKELVLDHHPL 305

Query: 292 AK 293
           A+
Sbjct: 306 AR 307


>gi|192360546|ref|YP_001981926.1| tyrosine recombinase XerD [Cellvibrio japonicus Ueda107]
 gi|190686711|gb|ACE84389.1| tyrosine recombinase XerD [Cellvibrio japonicus Ueda107]
          Length = 299

 Score =  183 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 105/292 (35%), Positives = 161/292 (55%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLN-NKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+  S NT  +Y+RDL++   +L   +   L A +   + +YL    Q+ L + S  
Sbjct: 16  LWMEKGLSENTQESYRRDLEQFAGWLAAGQGPDLLAVTATEVQAYLAWRHQQHLSSRSTA 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R FY     EG   DNP   +E PK +  LPK+L +  + NLL    ++     
Sbjct: 76  RFLSCLRGFYRLQIREGHLHDNPLALVENPKLSRSLPKSLSESDVENLLSAPDVD----- 130

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++E+LYA G+RVSELV L+   +NL +  + + GKG+KERLV +   A 
Sbjct: 131 --DPVGLRDKTMLEVLYACGLRVSELVGLTMSQVNLRQNVVRVMGKGSKERLVPMGEEAA 188

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             LQ Y +    + +      +   S++   ++RQ F   +K  A  AGI K  +SPH +
Sbjct: 189 AWLQRYLREARPVLLNNFPDEVVFPSSRGQPMTRQTFWYRIKHWAQVAGINKP-LSPHTL 247

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RHAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +++    ++HP  
Sbjct: 248 RHAFATHLLNHGADLRVVQLLLGHSDLSTTQIYTHVARLRMKHQHAEHHPRG 299


>gi|156973275|ref|YP_001444182.1| site-specific tyrosine recombinase XerD [Vibrio harveyi ATCC
           BAA-1116]
 gi|156524869|gb|ABU69955.1| hypothetical protein VIBHAR_00956 [Vibrio harveyi ATCC BAA-1116]
          Length = 305

 Score =  183 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 101/288 (35%), Positives = 165/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL++Y+ DL ++  ++      L   S + L  Y ++L       +S+ R +S
Sbjct: 25  ERGLSENTLASYRNDLMKLLAWMEQHSYRLDFISLSGLQEYQSYLVDLDYKQTSRARMLS 84

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + ++  E +R D+PS  L  PK    LPK + ++ +  LL+          P   
Sbjct: 85  AIRRLFQYIHREKVRADDPSALLVSPKLPQRLPKDISEEQVDALLDAP-------DPNDP 137

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 138 VELRDKAMLELLYATGLRVTELVSLTMENVSLRQGLVRVTGKGGKERLVPMGENAVDWIE 197

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +   S  +      +   S +   ++RQ F   +K  A  AGI    +SPH++RHAF
Sbjct: 198 TFIQQGRSALLGETTSDVVFPSKRARQMTRQTFWHRIKYYAVIAGIDTDQLSPHVLRHAF 257

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+++   +HP A
Sbjct: 258 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQIHSQHHPRA 305


>gi|288803482|ref|ZP_06408914.1| integrase/recombinase XerD [Prevotella melaninogenica D18]
 gi|288334092|gb|EFC72535.1| integrase/recombinase XerD [Prevotella melaninogenica D18]
          Length = 314

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 103/298 (34%), Positives = 162/298 (54%), Gaps = 8/298 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NTL AY RD+ ++  +L  +++ +       L  +   +S   +   S  R
Sbjct: 18  LKLEKGYSANTLDAYMRDVDKLFRYLAVEQVDVLDVKLEDLEYFAAFISDLGIGPRSLAR 77

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +RQFY FL  +G  + +P++ LE PK+   LP+ L    +  L +           
Sbjct: 78  ILSGVRQFYRFLVIDGYLEVDPTELLESPKQPDHLPEVLSTAEVDLLEQAI-------DL 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +W+  R   +IE+L++ G+RVSEL  L    L + E+ + + GKG+KERLV +SP AL 
Sbjct: 131 SKWEGHRNRAIIEVLFSCGLRVSELTNLKLSNLYIEEQYIRVMGKGSKERLVPISPRALD 190

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L  +    + MK+   +      + +  HL+R +    +K  A  AGI KK ISPH +R
Sbjct: 191 ELNYWFADRNVMKIKPGEEDYVFLNRRGQHLTRTMILIMIKRYAVEAGI-KKTISPHTLR 249

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           H+FA+ LLEGGADLR IQ +LGH  I TT+IYTH+    L++ + ++HP   +  +H 
Sbjct: 250 HSFATSLLEGGADLRAIQAMLGHESIGTTEIYTHIDTSTLRQEILEHHPRNIQYNEHQ 307


>gi|91226786|ref|ZP_01261439.1| tyrosine recombinase [Vibrio alginolyticus 12G01]
 gi|269964519|ref|ZP_06178759.1| tyrosine recombinase [Vibrio alginolyticus 40B]
 gi|91188917|gb|EAS75201.1| tyrosine recombinase [Vibrio alginolyticus 12G01]
 gi|269830756|gb|EEZ84975.1| tyrosine recombinase [Vibrio alginolyticus 40B]
          Length = 305

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 103/288 (35%), Positives = 164/288 (56%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL++Y+ DL ++  ++      L   S + L  Y +HL       +S+ R +S
Sbjct: 25  ERGLSENTLASYRNDLMKLLVWMEKHRYRLDFISLSGLQEYQSHLVDLDYKQTSRARMLS 84

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK + ++ +  LLE          P   
Sbjct: 85  AIRRLFQYLHREKVRADDPSALLVSPKLPQRLPKDISEEQVDALLEAP-------DPNDP 137

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 138 IELRDKAMLELLYATGLRVTELVSLTMENVSLRQGVVRVTGKGGKERLVPMGENAVDWIE 197

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +      +      +   S +   ++RQ F   +K  A  AGI    +SPH++RHAF
Sbjct: 198 TFIQQGRPALLGDTSSDIVFPSKRARQMTRQTFWHRIKYYALIAGIDTDQLSPHVLRHAF 257

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+++   +HP A
Sbjct: 258 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQIHSQHHPRA 305


>gi|49085926|gb|AAT51315.1| PA3738 [synthetic construct]
          Length = 299

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 99/291 (34%), Positives = 161/291 (55%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NT  AY+ DL++   +L+ + + L     + ++ +L    ++     S  R
Sbjct: 16  LWLEKGLADNTREAYRNDLQQFNAWLDGRGLRLEGIGRDAILDHLAWRLEQGYKARSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R FY +   +GL  ++P+  ++LP+    LPK+L +  +  LL   +++      
Sbjct: 76  FLSGLRGFYRYCLRDGLIAEDPTLQVDLPQLGKPLPKSLSEADVEALLAAPEVD------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYA G+RVSELV L+   +NL +  + + GKG+KERLV L   A+ 
Sbjct: 130 -DPLGLRDRTMLEVLYACGLRVSELVGLTLEQVNLRQGVVKVFGKGSKERLVPLGEEAIG 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G    +   S +   ++RQ F   +K  A  A I   +ISPH +R
Sbjct: 189 WLERYLREARGDLLGGRPSDVLFPSLRGEQMTRQTFWHRIKHHAQVAAI-GTSISPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHIARARLQDLHARHHPRG 298


>gi|323702534|ref|ZP_08114197.1| tyrosine recombinase XerD [Desulfotomaculum nigrificans DSM 574]
 gi|323532508|gb|EGB22384.1| tyrosine recombinase XerD [Desulfotomaculum nigrificans DSM 574]
          Length = 296

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 96/292 (32%), Positives = 157/292 (53%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ ER  + NTL++Y+ DL +  + L  + ++ +  A+ NH++++L  L +     ++  
Sbjct: 12  LAVERGLAQNTLASYRIDLSQYLSHLKKQGVTAIDQANRNHVLTHLYKLQKSGKAPATIS 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ ++ FY FL  +G+  ++P+  LE PK    LP+ L    +  LL Q ++      
Sbjct: 72  RHLAALKHFYRFLLADGVVTEDPTVNLESPKLGQRLPQVLTTAEVEALLSQPQL------ 125

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   ++EL+YATG+RVSE+VTL    + L    +   GKG+KER++ L   A 
Sbjct: 126 -ADPAGLRDKAMLELIYATGIRVSEMVTLDIEHVELDMGYIRCFGKGSKERIIPLGAVAA 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           H ++ Y          G            G    +     +    AR     K+I+PH +
Sbjct: 185 HYVREYLARSRVKLTKGKTEHRALFVNAQGKRLTRQGFWKILKKYAREANINKHITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++Q +LGH DISTTQIYTHL   +L+++  + HP A
Sbjct: 245 RHSFATHLLENGADLRSVQEMLGHADISTTQIYTHLTKIRLREVYTNAHPRA 296


>gi|25028109|ref|NP_738163.1| site-specific tyrosine recombinase XerD [Corynebacterium efficiens
           YS-314]
 gi|259507166|ref|ZP_05750066.1| tyrosine recombinase XerD [Corynebacterium efficiens YS-314]
 gi|34222804|sp|Q7ZAN4|XERD_COREF RecName: Full=Tyrosine recombinase xerD
 gi|23493393|dbj|BAC18363.1| putative integrase/recombinase [Corynebacterium efficiens YS-314]
 gi|259165247|gb|EEW49801.1| tyrosine recombinase XerD [Corynebacterium efficiens YS-314]
          Length = 304

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 95/297 (31%), Positives = 146/297 (49%), Gaps = 12/297 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQ-----RKLV 55
           ++ ER  S NTLS+Y+RD++   ++L    I  +S  +T  + +Y+  L +       L 
Sbjct: 14  LAVERGLSSNTLSSYRRDIERYCDWLEAARIGDISEIATATVEAYVMDLRRGVDGRAPLS 73

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
            SS  R + V+R  + F   EGL   + +  +  P     LP TL    +  L++     
Sbjct: 74  ASSAGRALIVVRGLHKFALAEGLVGVDVAADVSPPSTGRHLPDTLSVPEVETLIDAIPTS 133

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
                      +R   L+E+LY TG R+SE V L    +  T   + I GKG+K+R+V  
Sbjct: 134 ----DIATPVDIRDRALLEVLYGTGARISEAVGLMVDDVTHTPEVLRITGKGSKQRMVPY 189

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
              A  A+  Y          G    LF +        +  +A   KA         K+I
Sbjct: 190 GSMARAAVDDYLVRARPALSKGRTPVLFLNQRGGPLSRQSAWAALKKAAGRAGI--AKDI 247

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH +RH+FA+HLLEGGAD+R +Q LLGH+ ++TTQIYTH+  + L+++ +  HP A
Sbjct: 248 SPHTLRHSFATHLLEGGADVRVVQELLGHSSVTTTQIYTHVTAENLRQVWRSAHPRA 304


>gi|329571728|gb|EGG53409.1| tyrosine recombinase XerD [Enterococcus faecalis TX1467]
          Length = 305

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 96/292 (32%), Positives = 149/292 (51%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT  +Y+RDLK+   FL  + + S        +  +L  L + +  ++S  
Sbjct: 12  LQIERGLSNNTRRSYERDLKKYVAFLQEQGLHSWDEVDRYMITEFLQSLHEEQQASASVI 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R F+ FL  E L + NP   ++ PKK   LP TL  D +  L+E          
Sbjct: 72  RMISSLRGFHQFLRQERLSEHNPMQHIDSPKKVQKLPSTLSVDEVTRLIETP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATG+RVSEL+ +    L+L+   +   GKG+KER++ L   A+
Sbjct: 125 TSKPLGMRNRAILEVMYATGLRVSELIEIKLGDLHLSIGLLQTIGKGDKERIIPLGDYAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             ++ Y        +  +           G    +           R    +KNI+PH +
Sbjct: 185 QWIERYMNEARPQLIKNHPNETHLFVNHHGEPLSRQGIWKNLKQIVREAQIEKNITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   ++  + +++ P A
Sbjct: 245 RHSFATHLLENGADLRIVQELLGHADISTTQIYTHITKQRMADVYKEHFPRA 296


>gi|317485554|ref|ZP_07944431.1| tyrosine recombinase XerD [Bilophila wadsworthia 3_1_6]
 gi|316923234|gb|EFV44443.1| tyrosine recombinase XerD [Bilophila wadsworthia 3_1_6]
          Length = 336

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 109/292 (37%), Positives = 162/292 (55%), Gaps = 10/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           + +ER  S NT++AY++DL  +Q+FL+  E  LS     ++  ++  L +R   T +  R
Sbjct: 38  LIAERGLSRNTVAAYRQDLDALQDFLDELETPLSGLDDENITLFIAWLRKRGDATRTLAR 97

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           +IS +R F  +    G    NP+  ++ PK   +LP  L +D I  LL            
Sbjct: 98  RISSLRSFLAWCVERGELASNPAALIDTPKLPSLLPDVLTQDEIVRLLNAP-------DA 150

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++ELLYA GMRVSEL+ L    L+L    + I GKG+KERLV L  +A+ 
Sbjct: 151 TSKLGLRDRAMLELLYAAGMRVSELIELQPIDLDLQRGVVRIFGKGSKERLVPLHDAAVM 210

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            +  Y K    +     D      +     LSRQ   + +K  A  AGI+K  ISPH  R
Sbjct: 211 RMAEYLKIVRPLFTPVED--RVFLNRSGNGLSRQGVWKLVKRYALEAGIRKP-ISPHTFR 267

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           H+FA+HLLEGGADLR++QILLGH D+S T++YTH+  ++L ++ + YHP ++
Sbjct: 268 HSFATHLLEGGADLRSVQILLGHADMSATELYTHVQSERLLQIHRKYHPRSQ 319


>gi|330447418|ref|ZP_08311067.1| tyrosine recombinase XerD [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491609|dbj|GAA05564.1| tyrosine recombinase XerD [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 298

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 107/288 (37%), Positives = 168/288 (58%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL++Y+ DL ++ N+L  +  ++   S + L  Y   L  +    +S+ R +S
Sbjct: 18  ERGLSENTLASYRNDLMKLLNWLKQESRNVINVSVDDLQRYQQWLFDKDYKQTSRARMVS 77

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK L +  +  LL+              
Sbjct: 78  AIRRLFQYLHREKMRDDDPSAMLVTPKLPKRLPKDLSEAQVDALLDAP-------DVNDP 130

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELVTL+   ++L +  + I GKG+KERLV +  +A+  ++
Sbjct: 131 IELRDKAMLELLYATGLRVTELVTLTMENISLRQGVVRITGKGDKERLVPMGENAIDWIE 190

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +T     +      +   S +   ++RQ F   +K  A  AGI  + +SPH++RHAF
Sbjct: 191 QFIETGRPQLLGEKSSDVLFPSRRARQMTRQTFWHRIKHYAVLAGIDAETLSPHVMRHAF 250

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP A
Sbjct: 251 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHQTHHPRA 298


>gi|138895887|ref|YP_001126340.1| site-specific tyrosine recombinase XerD [Geobacillus
           thermodenitrificans NG80-2]
 gi|196248777|ref|ZP_03147477.1| tyrosine recombinase XerD [Geobacillus sp. G11MC16]
 gi|134267400|gb|ABO67595.1| DNA integration/recombination/invertion protein [Geobacillus
           thermodenitrificans NG80-2]
 gi|196211653|gb|EDY06412.1| tyrosine recombinase XerD [Geobacillus sp. G11MC16]
          Length = 298

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 105/295 (35%), Positives = 162/295 (54%), Gaps = 12/295 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI--SLSAASTNHLISYLNHLSQRKLVTSSQ 59
           ++ ER  + NT+ +Y+RDLK+  ++L   E   +       H++ +L  LS++     + 
Sbjct: 12  LTVERNLAHNTIISYERDLKKYVHYLREVEQLEAWGEVERLHILHFLKFLSEQGQSARTI 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R ++ IR F+ FL  E +   +P+  +E P+    LPK L  + +  LL   +      
Sbjct: 72  ARHLASIRSFHQFLLREKMAAQDPTVHIETPQFERTLPKVLSVEEVEALLAAPQ------ 125

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
                  +R   ++E+LYATGMRVSELV L+   ++LT   +   GKG KER+V +   A
Sbjct: 126 -TNTPFGLRDKAMLEVLYATGMRVSELVQLNLGDVHLTMGFVRCYGKGRKERIVPIGRMA 184

Query: 180 LHALQMYKKTCSSMKMTGNDLWLF--PSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
           L AL  Y +      +            +     L+RQ F + LK L+  AGI+K+ ++P
Sbjct: 185 LEALARYLEYGRPQLVNPRKRATEALFLNHYGQRLTRQGFWKILKRLSKEAGIEKE-LTP 243

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLLE GADLR +Q LLGH DISTTQ+YTH+   +L+ + + YHP A
Sbjct: 244 HTLRHSFATHLLENGADLRAVQELLGHADISTTQMYTHVTKTRLKDVYKQYHPRA 298


>gi|27467846|ref|NP_764483.1| xerC protein [Staphylococcus epidermidis ATCC 12228]
 gi|57866718|ref|YP_188400.1| tyrosine recombinase XerC [Staphylococcus epidermidis RP62A]
 gi|282876316|ref|ZP_06285183.1| tyrosine recombinase XerC [Staphylococcus epidermidis SK135]
 gi|34222792|sp|Q7ZAJ4|XERC_STAES RecName: Full=Tyrosine recombinase xerC
 gi|81674902|sp|Q5HPU0|XERC_STAEQ RecName: Full=Tyrosine recombinase xerC
 gi|27315391|gb|AAO04525.1|AE016747_22 xerC protein [Staphylococcus epidermidis ATCC 12228]
 gi|57637376|gb|AAW54164.1| tyrosine recombinase XerC [Staphylococcus epidermidis RP62A]
 gi|281295341|gb|EFA87868.1| tyrosine recombinase XerC [Staphylococcus epidermidis SK135]
 gi|329736214|gb|EGG72486.1| tyrosine recombinase XerC [Staphylococcus epidermidis VCU028]
 gi|329736604|gb|EGG72870.1| tyrosine recombinase XerC [Staphylococcus epidermidis VCU045]
          Length = 296

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 97/294 (32%), Positives = 149/294 (50%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S  TL +Y  DL +  NFL  + + L         +YL  L   +L  ++  
Sbjct: 11  MLKVERNFSEYTLKSYHDDLVQFNNFLEREHLQLETFEYKDARNYLAFLYSNQLKRTTVS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY F   +     NP   L  PKK   LP+  +++ +  L +  + +     
Sbjct: 71  RKISTLRTFYEFWMTQDNSIINPFVQLVHPKKEKYLPQFFYEEEMEALFQTVEHD----- 125

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  ++IELLYATG+RVSEL+ +    +++    + + GKGNKER +       
Sbjct: 126 --NKKGIRDKVIIELLYATGIRVSELINIKLKDIDMNLPGVKVLGKGNKERFIPFGEFCR 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y +     ++  +D +L  +        R V       +   AG+    I PH +
Sbjct: 184 QSIERYLEEFQPKQLANHD-YLIVNMKGDPITERGVRYVLNDVVKRTAGVND--IHPHKL 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+  + HP AKK
Sbjct: 241 RHTFATHLLNQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLRKVYLNAHPRAKK 294


>gi|15598933|ref|NP_252427.1| site-specific tyrosine recombinase XerD [Pseudomonas aeruginosa
           PAO1]
 gi|107103253|ref|ZP_01367171.1| hypothetical protein PaerPA_01004322 [Pseudomonas aeruginosa PACS2]
 gi|116051736|ref|YP_789425.1| site-specific tyrosine recombinase XerD [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218889984|ref|YP_002438848.1| site-specific tyrosine recombinase XerD [Pseudomonas aeruginosa
           LESB58]
 gi|254236648|ref|ZP_04929971.1| integrase/recombinase XerD [Pseudomonas aeruginosa C3719]
 gi|254242429|ref|ZP_04935751.1| integrase/recombinase XerD [Pseudomonas aeruginosa 2192]
 gi|296387753|ref|ZP_06877228.1| site-specific tyrosine recombinase XerD [Pseudomonas aeruginosa
           PAb1]
 gi|313109145|ref|ZP_07795116.1| integrase/recombinase XerD [Pseudomonas aeruginosa 39016]
 gi|34223067|sp|Q9HXQ6|XERD_PSEAE RecName: Full=Tyrosine recombinase xerD
 gi|9949906|gb|AAG07125.1|AE004793_2 integrase/recombinase XerD [Pseudomonas aeruginosa PAO1]
 gi|115586957|gb|ABJ12972.1| integrase/recombinase XerD [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126168579|gb|EAZ54090.1| integrase/recombinase XerD [Pseudomonas aeruginosa C3719]
 gi|126195807|gb|EAZ59870.1| integrase/recombinase XerD [Pseudomonas aeruginosa 2192]
 gi|218770207|emb|CAW25969.1| integrase/recombinase XerD [Pseudomonas aeruginosa LESB58]
 gi|310881618|gb|EFQ40212.1| integrase/recombinase XerD [Pseudomonas aeruginosa 39016]
          Length = 298

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 99/291 (34%), Positives = 161/291 (55%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  + NT  AY+ DL++   +L+ + + L     + ++ +L    ++     S  R
Sbjct: 16  LWLEKGLADNTREAYRNDLQQFNAWLDGRGLRLEGIGRDAILDHLAWRLEQGYKARSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S +R FY +   +GL  ++P+  ++LP+    LPK+L +  +  LL   +++      
Sbjct: 76  FLSGLRGFYRYCLRDGLIAEDPTLQVDLPQLGKPLPKSLSEADVEALLAAPEVD------ 129

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                +R   ++E+LYA G+RVSELV L+   +NL +  + + GKG+KERLV L   A+ 
Sbjct: 130 -DPLGLRDRTMLEVLYACGLRVSELVGLTLEQVNLRQGVVKVFGKGSKERLVPLGEEAIG 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y +      + G    +   S +   ++RQ F   +K  A  A I   +ISPH +R
Sbjct: 189 WLERYLREARGDLLGGRPSDVLFPSLRGEQMTRQTFWHRIKHHAQVAAI-GTSISPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHIARARLQDLHARHHPRG 298


>gi|119775871|ref|YP_928611.1| integrase/recombinase XerD [Shewanella amazonensis SB2B]
 gi|119768371|gb|ABM00942.1| integrase/recombinase XerD [Shewanella amazonensis SB2B]
          Length = 321

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 107/286 (37%), Positives = 153/286 (53%), Gaps = 8/286 (2%)

Query: 7   ASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKISVI 66
             S NTLSAY+ DL +   FL  K I L A  +  L  YL +  ++ +  +S  R +S +
Sbjct: 44  GLSDNTLSAYRTDLCQFDAFLTAKGIGLLALDSLTLRDYLAYRFEQGMAKTSTARMLSSL 103

Query: 67  RQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQWKR 126
           R+FY      G   ++P+  +E PK    LP +L +  +  LL +        +      
Sbjct: 104 RRFYRHQLVSGTLSEDPTALIESPKLPKSLPGSLSEAQVEQLLAEP-------SSDDPVE 156

Query: 127 VRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQMY 186
            R   ++ELLYATG+RVSELV L    L L +  + I GKG KERLV +   A  AL+ +
Sbjct: 157 CRDKAMLELLYATGLRVSELVGLGMSELGLRQGLVRIIGKGGKERLVPMGEVAQDALEQF 216

Query: 187 KKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAFAS 246
                 M +      +   S +   ++RQ F   +K  A RAGI  + +SPH +RHAFA+
Sbjct: 217 LAGPRQMLLKQGATEVVFPSNRGQQMTRQTFWHRIKLYALRAGISTE-LSPHTLRHAFAT 275

Query: 247 HLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HLL  GADLR +Q+LLGH+ +STTQIYTH+   +L  L + +HP  
Sbjct: 276 HLLNHGADLRVVQLLLGHSSLSTTQIYTHVARTRLADLHEKHHPRG 321


>gi|157827055|ref|YP_001496119.1| site-specific tyrosine recombinase XerD [Rickettsia bellii OSU
           85-389]
 gi|157802359|gb|ABV79082.1| site-specific tyrosine recombinase XerD [Rickettsia bellii OSU
           85-389]
          Length = 305

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 115/302 (38%), Positives = 177/302 (58%), Gaps = 16/302 (5%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+ +ERA S N++ +YKRDL +  N+L  +++S    +T+++ +++ +L++  L   S  
Sbjct: 10  MLLAERALSKNSILSYKRDLLDFHNYLAKQKLSELNITTDNIRNWVEYLAENGLQARSIN 69

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS I+ +Y FL  E     NP   ++LPK  + LP+ L  D I +LLE    +     
Sbjct: 70  RKISTIKSYYEFLISENHTNLNPLLNIDLPKYQNKLPEILSIDDIKSLLEYCSQDI---- 125

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHT-------LNLTERTMIIQGKGNKERLV 173
               +  R+  +I LLYA+G+RVSELV+L             + +   ++     +  +V
Sbjct: 126 --SPEGARLNAMIHLLYASGLRVSELVSLKLSDILSNKVSREVKKIFSVLGKGNKERIIV 183

Query: 174 ILSPSALHALQM--YKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ 231
           I  P+    ++    +    +     N ++LFPSS   G+++RQ FA  LK+ A  AG+ 
Sbjct: 184 INEPAINSLVKYLVVRDNFVNKTKPKNLIYLFPSSAAAGYMTRQNFAILLKSAALYAGLN 243

Query: 232 KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
            ++ISPH++RH+FASHLLEGGADLR IQ LLGH DISTTQIYTHL  + L+K +  +HPL
Sbjct: 244 PEHISPHVLRHSFASHLLEGGADLRVIQELLGHADISTTQIYTHLQTNHLKKALL-HHPL 302

Query: 292 AK 293
           +K
Sbjct: 303 SK 304


>gi|21232926|ref|NP_638843.1| site-specific tyrosine recombinase XerC [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66767001|ref|YP_241763.1| site-specific tyrosine recombinase XerC [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188990094|ref|YP_001902104.1| site-specific tyrosine recombinase XerC [Xanthomonas campestris pv.
           campestris str. B100]
 gi|34222915|sp|Q8P550|XERC_XANCP RecName: Full=Tyrosine recombinase xerC
 gi|81307012|sp|Q4UYY0|XERC_XANC8 RecName: Full=Tyrosine recombinase xerC
 gi|254799362|sp|B0RNK3|XERC_XANCB RecName: Full=Tyrosine recombinase xerC
 gi|21114762|gb|AAM42767.1| site-specific recombinase [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66572333|gb|AAY47743.1| site-specific recombinase [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167731854|emb|CAP50038.1| site-specific tyrosine recombinase [Xanthomonas campestris pv.
           campestris]
          Length = 322

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 93/296 (31%), Positives = 145/296 (48%), Gaps = 15/296 (5%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S +TL AY+RDL  +  + + +    ++   +  L  ++    +R L   S +
Sbjct: 38  LQIERQVSAHTLDAYRRDLAALIGWASAQGSEDVAQLDSAQLRKFVTAEHRRGLSPKSLQ 97

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S  R +Y +L   G    +P+  L  PK    LP+ L  D    L+E          
Sbjct: 98  RRLSACRSYYAWLLKHGRIATSPAAALRAPKAPRKLPQVLDADEAVRLVEVP-------- 149

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   L+EL Y++G+R+SEL  L    L+L    + + GKG K+RLV +   A+
Sbjct: 150 TDAPLGLRDRALLELFYSSGLRLSELCALRWRDLDLDSGLVTVLGKGGKQRLVPVGSHAV 209

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            AL+ +       + +G          + G    Q   +      A      K++ PH++
Sbjct: 210 AALRAW------QRDSGGSAQTHVFPGRAGGAISQRAVQIRIKQLAVRQGMFKHVHPHML 263

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           RH+FASH+LE   DLR +Q LLGH+DI+TTQIYTHL    L K+    HP AK++K
Sbjct: 264 RHSFASHILESSGDLRGVQELLGHSDIATTQIYTHLDFQHLAKVYDAAHPRAKRKK 319


>gi|157803898|ref|YP_001492447.1| site-specific tyrosine recombinase XerD [Rickettsia canadensis str.
           McKiel]
 gi|157785161|gb|ABV73662.1| tyrosine recombinase [Rickettsia canadensis str. McKiel]
          Length = 308

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 124/302 (41%), Positives = 182/302 (60%), Gaps = 16/302 (5%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+ +ERA S N++ +YKRDL + QN+L  +++S    +T ++ +++ +L+   L   S  
Sbjct: 10  MLLAERALSKNSIFSYKRDLFDFQNYLAKQKLSELNITTENIRNWIEYLADNDLQARSIN 69

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS I+ +Y FL  E     NP   ++LPK    LP+ L  D I +LLE    +A    
Sbjct: 70  RKISTIKSYYEFLISENHTAFNPVLNVDLPKYQSKLPEILSIDQIKSLLEYCSQDA---- 125

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKG------NKERLVI 174
               + +R+  +I LLYA+G+RVSELV+L    +   + +  ++         NKER++I
Sbjct: 126 --TPEGIRLNAMIHLLYASGLRVSELVSLKLADILTNKMSGEVKKVFSVLGKGNKERVII 183

Query: 175 LSPSALHALQMYKKTCS---SMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ 231
           ++  A+ ++  Y        +     N ++LFPSS   G+++RQ FA  LK+ A  AG+ 
Sbjct: 184 INEQAVISIVKYLAIRDVFLNKAKPKNLIYLFPSSAIAGYMTRQNFAMLLKSAALYAGLN 243

Query: 232 KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
            K+ISPHI+RH+FASHLLEGGADLR IQ LLGH DISTTQIYTHL  + LQK +  +HPL
Sbjct: 244 PKHISPHILRHSFASHLLEGGADLRVIQELLGHADISTTQIYTHLQTNHLQKALL-HHPL 302

Query: 292 AK 293
            K
Sbjct: 303 NK 304


>gi|29376101|ref|NP_815255.1| integrase/recombinase XerD, putative [Enterococcus faecalis V583]
 gi|227518728|ref|ZP_03948777.1| site-specific DNA tyrosine recombinase, XerD [Enterococcus faecalis
           TX0104]
 gi|227553337|ref|ZP_03983386.1| site-specific DNA tyrosine recombinase, XerD [Enterococcus faecalis
           HH22]
 gi|255975876|ref|ZP_05426462.1| phage integrase [Enterococcus faecalis T2]
 gi|256619040|ref|ZP_05475886.1| integrase [Enterococcus faecalis ATCC 4200]
 gi|256762466|ref|ZP_05503046.1| phage integrase [Enterococcus faecalis T3]
 gi|256958957|ref|ZP_05563128.1| integrase [Enterococcus faecalis DS5]
 gi|256961950|ref|ZP_05566121.1| phage integrase [Enterococcus faecalis Merz96]
 gi|256965148|ref|ZP_05569319.1| phage integrase [Enterococcus faecalis HIP11704]
 gi|257078988|ref|ZP_05573349.1| phage integrase [Enterococcus faecalis JH1]
 gi|257082573|ref|ZP_05576934.1| phage integrase [Enterococcus faecalis E1Sol]
 gi|257085206|ref|ZP_05579567.1| phage integrase [Enterococcus faecalis Fly1]
 gi|257086767|ref|ZP_05581128.1| phage integrase [Enterococcus faecalis D6]
 gi|257416070|ref|ZP_05593064.1| integrase [Enterococcus faecalis AR01/DG]
 gi|257419273|ref|ZP_05596267.1| phage integrase [Enterococcus faecalis T11]
 gi|293383018|ref|ZP_06628936.1| tyrosine recombinase XerD [Enterococcus faecalis R712]
 gi|293389493|ref|ZP_06633950.1| tyrosine recombinase XerD [Enterococcus faecalis S613]
 gi|294781340|ref|ZP_06746683.1| tyrosine recombinase XerD [Enterococcus faecalis PC1.1]
 gi|300860304|ref|ZP_07106391.1| tyrosine recombinase XerD [Enterococcus faecalis TUSoD Ef11]
 gi|307271041|ref|ZP_07552324.1| tyrosine recombinase XerD [Enterococcus faecalis TX4248]
 gi|307273248|ref|ZP_07554494.1| tyrosine recombinase XerD [Enterococcus faecalis TX0855]
 gi|307274985|ref|ZP_07556148.1| tyrosine recombinase XerD [Enterococcus faecalis TX2134]
 gi|307278097|ref|ZP_07559181.1| tyrosine recombinase XerD [Enterococcus faecalis TX0860]
 gi|312907511|ref|ZP_07766502.1| tyrosine recombinase XerD [Enterococcus faecalis DAPTO 512]
 gi|312910129|ref|ZP_07768976.1| tyrosine recombinase XerD [Enterococcus faecalis DAPTO 516]
 gi|29343563|gb|AAO81325.1| integrase/recombinase XerD, putative [Enterococcus faecalis V583]
 gi|227073809|gb|EEI11772.1| site-specific DNA tyrosine recombinase, XerD [Enterococcus faecalis
           TX0104]
 gi|227177524|gb|EEI58496.1| site-specific DNA tyrosine recombinase, XerD [Enterococcus faecalis
           HH22]
 gi|255968748|gb|EET99370.1| phage integrase [Enterococcus faecalis T2]
 gi|256598567|gb|EEU17743.1| integrase [Enterococcus faecalis ATCC 4200]
 gi|256683717|gb|EEU23412.1| phage integrase [Enterococcus faecalis T3]
 gi|256949453|gb|EEU66085.1| integrase [Enterococcus faecalis DS5]
 gi|256952446|gb|EEU69078.1| phage integrase [Enterococcus faecalis Merz96]
 gi|256955644|gb|EEU72276.1| phage integrase [Enterococcus faecalis HIP11704]
 gi|256987018|gb|EEU74320.1| phage integrase [Enterococcus faecalis JH1]
 gi|256990603|gb|EEU77905.1| phage integrase [Enterococcus faecalis E1Sol]
 gi|256993236|gb|EEU80538.1| phage integrase [Enterococcus faecalis Fly1]
 gi|256994797|gb|EEU82099.1| phage integrase [Enterococcus faecalis D6]
 gi|257157898|gb|EEU87858.1| integrase [Enterococcus faecalis ARO1/DG]
 gi|257161101|gb|EEU91061.1| phage integrase [Enterococcus faecalis T11]
 gi|291079683|gb|EFE17047.1| tyrosine recombinase XerD [Enterococcus faecalis R712]
 gi|291081110|gb|EFE18073.1| tyrosine recombinase XerD [Enterococcus faecalis S613]
 gi|294451570|gb|EFG20029.1| tyrosine recombinase XerD [Enterococcus faecalis PC1.1]
 gi|300849343|gb|EFK77093.1| tyrosine recombinase XerD [Enterococcus faecalis TUSoD Ef11]
 gi|306505494|gb|EFM74680.1| tyrosine recombinase XerD [Enterococcus faecalis TX0860]
 gi|306508433|gb|EFM77540.1| tyrosine recombinase XerD [Enterococcus faecalis TX2134]
 gi|306510233|gb|EFM79257.1| tyrosine recombinase XerD [Enterococcus faecalis TX0855]
 gi|306512539|gb|EFM81188.1| tyrosine recombinase XerD [Enterococcus faecalis TX4248]
 gi|310626539|gb|EFQ09822.1| tyrosine recombinase XerD [Enterococcus faecalis DAPTO 512]
 gi|311289402|gb|EFQ67958.1| tyrosine recombinase XerD [Enterococcus faecalis DAPTO 516]
 gi|315027289|gb|EFT39221.1| tyrosine recombinase XerD [Enterococcus faecalis TX2137]
 gi|315033946|gb|EFT45878.1| tyrosine recombinase XerD [Enterococcus faecalis TX0017]
 gi|315036955|gb|EFT48887.1| tyrosine recombinase XerD [Enterococcus faecalis TX0027]
 gi|315144440|gb|EFT88456.1| tyrosine recombinase XerD [Enterococcus faecalis TX2141]
 gi|315147241|gb|EFT91257.1| tyrosine recombinase XerD [Enterococcus faecalis TX4244]
 gi|315150560|gb|EFT94576.1| tyrosine recombinase XerD [Enterococcus faecalis TX0012]
 gi|315160468|gb|EFU04485.1| tyrosine recombinase XerD [Enterococcus faecalis TX0645]
 gi|315169058|gb|EFU13075.1| tyrosine recombinase XerD [Enterococcus faecalis TX1341]
 gi|315172335|gb|EFU16352.1| tyrosine recombinase XerD [Enterococcus faecalis TX1346]
 gi|315575890|gb|EFU88081.1| tyrosine recombinase XerD [Enterococcus faecalis TX0309B]
 gi|315580542|gb|EFU92733.1| tyrosine recombinase XerD [Enterococcus faecalis TX0309A]
 gi|323480700|gb|ADX80139.1| tyrosine recombinase XerD [Enterococcus faecalis 62]
          Length = 296

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 96/292 (32%), Positives = 149/292 (51%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT  +Y+RDLK+   FL  + + S        +  +L  L + +  ++S  
Sbjct: 12  LQIERGLSNNTRRSYERDLKKYVAFLQEQGLHSWDEVDRYMITEFLQSLHEEQQASASVI 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R F+ FL  E L + NP   ++ PKK   LP TL  D +  L+E          
Sbjct: 72  RMISSLRGFHQFLRQERLSEHNPMQHIDSPKKVQKLPSTLSVDEVTRLIETP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATG+RVSEL+ +    L+L+   +   GKG+KER++ L   A+
Sbjct: 125 TSKPLGMRNRAILEVMYATGLRVSELIEIKLGDLHLSIGLLQTIGKGDKERIIPLGDYAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             ++ Y        +  +           G    +           R    +KNI+PH +
Sbjct: 185 QWIERYMNEARPQLIKNHPNETHLFVNHHGEPLSRQGIWKNLKQIVREAQIEKNITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   ++  + +++ P A
Sbjct: 245 RHSFATHLLENGADLRIVQELLGHADISTTQIYTHITKQRMADVYKEHFPRA 296


>gi|295396859|ref|ZP_06806987.1| tyrosine recombinase XerC [Aerococcus viridans ATCC 11563]
 gi|294974885|gb|EFG50584.1| tyrosine recombinase XerC [Aerococcus viridans ATCC 11563]
          Length = 311

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 94/302 (31%), Positives = 147/302 (48%), Gaps = 12/302 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           ++ E+  S  T+ AY  DL   Q F+ +  I+ L   +   +  YL +L +  L   S  
Sbjct: 14  LTHEKQYSPETIKAYMADLDNFQAFMKDAGIAQLDQVAYRDIRIYLGNLQRGGLSRKSIS 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R  YN L    L  +NP + ++  K    LP   ++  I +L +  +       
Sbjct: 74  RHLSSLRSAYNLLLDRELVSENPFNYVKTAKTGLKLPDFFYESEIQSLFDSVQG------ 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   L+E LY TG RVSE+  L+ + ++LT   ++++GKGNK+R V +     
Sbjct: 128 -SDPIALRNRALLEFLYGTGARVSEVRDLAINQVDLTADMVLLRGKGNKDRYVPIGSFCH 186

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKK----NIS 236
            AL  Y +   S  M               +   +       A      ++      +I 
Sbjct: 187 DALVDYLENGRSQLMAKGHYEDNEHVFLFVNYKGEQLTSQGIAYILDQIVKNSATTLSIH 246

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEK 296
           PH +RH+FA+HLL  GAD+RT+Q LLGH  +STTQIYTHL  +KL+     +HP AK++K
Sbjct: 247 PHKLRHSFATHLLNNGADIRTVQELLGHASLSTTQIYTHLSKEKLRDNYLQFHPHAKQKK 306

Query: 297 KH 298
           +H
Sbjct: 307 EH 308


>gi|163759949|ref|ZP_02167033.1| tyrosine recombinase [Hoeflea phototrophica DFL-43]
 gi|162282907|gb|EDQ33194.1| tyrosine recombinase [Hoeflea phototrophica DFL-43]
          Length = 313

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 117/299 (39%), Positives = 174/299 (58%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER +++NTL AY+RDL +  + +     +L  A+ + + + ++ L+ R    +SQ 
Sbjct: 15  MMSAERGAALNTLEAYRRDLDDASSVVKALGSTLDRANADTIRTVISDLAARGFSPASQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQFY FL  EGLR D+P+  +E P+K   LPK L  D ++ LL QA+ +     
Sbjct: 75  RRLSALRQFYKFLHAEGLRDDDPTGVVESPRKRRSLPKILSVDDVSRLLAQAEADISKAR 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  RI     L       +     +      L E    +  +G   +  ++  S  
Sbjct: 135 DESETTQRIRFRALLELLYATGMRVSELVGLPYRVLAEDGRFLIIRGKGAKERMVPMSRP 194

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             L +        ++     +LFP+++  GHLSRQVFAR+LK +AARAG+    +SPH++
Sbjct: 195 ARLALEAWMAEIGEVAEETGFLFPANSSDGHLSRQVFARELKDVAARAGLPSAKVSPHVL 254

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           RHAFASHLL GGADLR +Q LLGHTDISTTQIYTH+L ++L++LV ++HPLAK+ K   
Sbjct: 255 RHAFASHLLAGGADLRAVQKLLGHTDISTTQIYTHVLDERLKQLVSEHHPLAKQPKNRD 313


>gi|149192204|ref|ZP_01870421.1| site-specific tyrosine recombinase XerD [Vibrio shilonii AK1]
 gi|148833962|gb|EDL50982.1| site-specific tyrosine recombinase XerD [Vibrio shilonii AK1]
          Length = 304

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 107/288 (37%), Positives = 163/288 (56%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTLS+Y+ DL ++  ++N     L   S + L  Y   L  +    SS+ R +S
Sbjct: 24  ERGLSENTLSSYRNDLFKLLKWMNEHNYRLDFISLSGLQEYQTWLMDQNYQQSSRARMLS 83

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E LR D+P+  L  PK    LPK L +D +  LLE          P   
Sbjct: 84  AIRRLFQYLHREKLRSDDPTALLVSPKLPKRLPKDLTEDQVTALLEAP-------DPNDP 136

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKGNKERLV +  +A+  + 
Sbjct: 137 IELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVIGKGNKERLVPMGENAIDWIS 196

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +      +      +   S +   ++RQ F   +K  A  A I  + +SPH++RHAF
Sbjct: 197 EFIEKGRPALLGDKTSDVVFPSKRARQMTRQTFWHRIKFYAVLADIDTELLSPHVLRHAF 256

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L+ +   +HP A
Sbjct: 257 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKNIHSQHHPRA 304


>gi|150003451|ref|YP_001298195.1| integrase [Bacteroides vulgatus ATCC 8482]
 gi|254881251|ref|ZP_05253961.1| integrase [Bacteroides sp. 4_3_47FAA]
 gi|294777667|ref|ZP_06743118.1| tyrosine recombinase XerD [Bacteroides vulgatus PC510]
 gi|319640253|ref|ZP_07994978.1| integrase [Bacteroides sp. 3_1_40A]
 gi|149931875|gb|ABR38573.1| integrase [Bacteroides vulgatus ATCC 8482]
 gi|254834044|gb|EET14353.1| integrase [Bacteroides sp. 4_3_47FAA]
 gi|294448735|gb|EFG17284.1| tyrosine recombinase XerD [Bacteroides vulgatus PC510]
 gi|317388028|gb|EFV68882.1| integrase [Bacteroides sp. 3_1_40A]
          Length = 313

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 103/299 (34%), Positives = 161/299 (53%), Gaps = 8/299 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E++ S NT+ AY  DL ++  +L  + I++      +L  +   L    +   SQ R
Sbjct: 18  LKLEKSLSDNTVDAYLTDLDKLLAYLTLENINILDVRLENLEDFSAGLHDIGIHPRSQAR 77

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S IR FY FL  E   K +P++ LE P+    LP+ +  + I  L+            
Sbjct: 78  ILSGIRSFYRFLIMEDYLKADPTELLESPQTGFKLPEVMTVEEIDLLIGSI-------DR 130

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
              +  R   ++E LY+ G+RVSEL  L    L   E  + ++GKG+K+RLV +SP A+ 
Sbjct: 131 STKEGQRNRAILETLYSCGLRVSELCNLKLSELYFEEGFIKVEGKGSKQRLVPISPRAIK 190

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            +++Y    + MK+          S    ++SR +    +K LAAR G++KK ISPH  R
Sbjct: 191 EIRLYFTDRNLMKIKPGFEDFVFISNFGKNISRIMVFHIIKELAARIGLKKK-ISPHTFR 249

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHYN 300
           H+FA+HLLEGGA+LR IQ +LGH  I TT+IYTH+  + L+  + ++HP   K ++  N
Sbjct: 250 HSFATHLLEGGANLRAIQCMLGHESIGTTEIYTHIDRNMLRSEIIEHHPRNIKFREKDN 308


>gi|15892414|ref|NP_360128.1| site-specific tyrosine recombinase XerD [Rickettsia conorii str.
           Malish 7]
 gi|34222952|sp|Q92IC9|XERD_RICCN RecName: Full=Tyrosine recombinase xerD
 gi|15619566|gb|AAL03029.1| integrase/recombinase [Rickettsia conorii str. Malish 7]
          Length = 306

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 114/303 (37%), Positives = 165/303 (54%), Gaps = 17/303 (5%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+ +ERA S N++ +YKRDL + QN+L   ++S    +T ++  ++ +L+   L   S  
Sbjct: 10  MLLAERALSKNSILSYKRDLFDFQNYLAKHKLSELNITTENIRDWIEYLASNDLQARSIN 69

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS I+ +Y FL  E     NP   ++LPK  + LP+ L    I +LLE    +     
Sbjct: 70  RKISTIKSYYEFLISENHTAFNPVLNVDLPKYQNKLPEILSIAQIKSLLEHCSQD----- 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               + +R+  +I LLYA+G+RVSELV+L    +   + +     K             +
Sbjct: 125 -NSPEGIRLNAMIHLLYASGLRVSELVSLKLADILTNKTSKGEVRKIFSVLGKGNKERVI 183

Query: 181 HALQM----------YKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGI 230
              +            +    +     N ++LFPSS   G+++RQ FA  LK+ A  AG+
Sbjct: 184 VINEQAVISIAKYLTIRGVFVNKAKPRNLIYLFPSSALAGYMTRQNFAILLKSAALYAGL 243

Query: 231 QKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHP 290
             + ISPHI+RH+FASHLLEGGADLR IQ LLGH DISTTQIYTHL  + L+K +   HP
Sbjct: 244 NPEYISPHILRHSFASHLLEGGADLRVIQELLGHADISTTQIYTHLQTNHLKKALLR-HP 302

Query: 291 LAK 293
           L K
Sbjct: 303 LNK 305


>gi|227813261|ref|YP_002813270.1| tyrosine recombinase XerC [Bacillus anthracis str. CDC 684]
 gi|227007518|gb|ACP17261.1| tyrosine recombinase XerC [Bacillus anthracis str. CDC 684]
          Length = 299

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 98/293 (33%), Positives = 142/293 (48%), Gaps = 9/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S  T+++Y+ DL+    F+  + IS     +   +  YL  L   KL   S  
Sbjct: 14  LQIERNYSKYTIASYQNDLEHFVQFMEREGISSFLDITYADVRLYLTTLHDEKLARKSVA 73

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R  Y FL  EG RKDNP     LPKK   +PK L+ + +           E   
Sbjct: 74  RKVSSLRSLYRFLMREGYRKDNPFALASLPKKELSIPKFLYAEELE-------ELFEASD 126

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   L+EL+YATG+RVSE V L    ++    T+++ GKG K+R +     A 
Sbjct: 127 TETPLGQRNQALLELMYATGIRVSECVNLQLTDIDFAVGTILVMGKGKKQRYIPFGSYAQ 186

Query: 181 HALQMYKKT-CSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
            AL  Y +     +     +          G        R +     +       ISPHI
Sbjct: 187 DALITYIENGRKQLAEKTEEQSHMVFLNAKGTPLTSRGVRYVLNELIKKASLTMRISPHI 246

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH FA+H+L+ GADLRT+Q LLGH ++STTQIYTH+  ++L+ +   +HP A
Sbjct: 247 LRHTFATHMLDEGADLRTVQELLGHENLSTTQIYTHVSKERLRSVYMKHHPRA 299


>gi|53715763|ref|YP_101755.1| tyrosine type site-specific recombinase [Bacteroides fragilis
           YCH46]
 gi|60683694|ref|YP_213838.1| putative tyrosine recombinase [Bacteroides fragilis NCTC 9343]
 gi|265767295|ref|ZP_06094961.1| tyrosine recombinase XerD [Bacteroides sp. 2_1_16]
 gi|52218628|dbj|BAD51221.1| tyrosine type site-specific recombinase [Bacteroides fragilis
           YCH46]
 gi|60495128|emb|CAH09949.1| putative tyrosine recombinase [Bacteroides fragilis NCTC 9343]
 gi|263252600|gb|EEZ24112.1| tyrosine recombinase XerD [Bacteroides sp. 2_1_16]
          Length = 317

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 106/299 (35%), Positives = 165/299 (55%), Gaps = 11/299 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E++ S NTL AY  DL+++ +FL+ + + +   S   L  +   L    +   SQ R
Sbjct: 24  LKLEKSLSKNTLEAYLTDLEKLLSFLSAEGVEILEVSLTDLQRFAAGLHDIGIHARSQAR 83

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            IS I+ F++FL      + +PS+ LE PK    LP+ L  + I  ++            
Sbjct: 84  IISGIKSFFHFLIIADYIEADPSELLEGPKIGFKLPEVLTVEEIDRIISTI-------DL 136

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            + +  R   ++E LY+ G+RVSEL  L    L   E  + ++GKG+K+RLV +SP A+ 
Sbjct: 137 SKNEGQRNRAILETLYSCGLRVSELTGLKLSDLYFDEGFIKVEGKGSKQRLVPISPKAIQ 196

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            +++Y    + + +  +       S +  HLSR +    +K LA  AGI  KNISPH  R
Sbjct: 197 EIKLYFLDRNRINIKKDHEDYLFLSRRGTHLSRIMIFHLIKELADMAGIT-KNISPHTFR 255

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA---KKEKK 297
           H+FA+HLLEGGA+LR IQ +LGH  ISTT+IYTH+  + L+  + ++HP     ++EKK
Sbjct: 256 HSFATHLLEGGANLRAIQCMLGHESISTTEIYTHIDRNMLRSEIIEHHPRNIKYRQEKK 314


>gi|298571314|gb|ADI87658.1| tyrosine recombinase XerC [uncultured Nitrospirae bacterium MY2-1F]
 gi|298571415|gb|ADI87756.1| tyrosine recombinase XerC [uncultured Nitrospirae bacterium
           MY3-11A]
          Length = 288

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 95/298 (31%), Positives = 152/298 (51%), Gaps = 17/298 (5%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           M  E+ +S +TL AYK+DL+E   F+       ++     +  ++   S++ L  SS  R
Sbjct: 1   MEVEKNASPHTLRAYKKDLEEFAAFVKK---DPASVDLYDIRGFVAAQSKQGLAKSSVMR 57

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           ++S ++ F+N+L   G    NP+  +  PK    LP  L KD    ++E+A+        
Sbjct: 58  RLSTVKAFFNYLASIGAVTANPTRLVPSPKVPKHLPNFLSKDDTFTMMEKAEGIG----- 112

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
             +   R   ++EL Y++G+RVSEL      ++NL +  + ++GKG KER+V +   AL 
Sbjct: 113 --FTAARNKAILELFYSSGLRVSELAGADMESINLKQAMVKVRGKGKKERIVPIGSYALG 170

Query: 182 ALQMYKKTC------SSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
           AL+ Y          ++      D      ++    L+ +   R +   A   G++   +
Sbjct: 171 ALKTYLVERLLIKEDTTRPRISTDPAALFINSSGERLTDRHIRRIVVKFARLTGVEGA-V 229

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
            PH +RH FA+HLL+ GADLR IQ LLGH  +STTQ YTHL    L  + +  HPLA+
Sbjct: 230 GPHTLRHTFATHLLQSGADLRVIQELLGHASLSTTQKYTHLDIQHLMDVYEKCHPLAE 287


>gi|256847147|ref|ZP_05552593.1| tyrosine recombinase XerD [Lactobacillus coleohominis 101-4-CHN]
 gi|256715811|gb|EEU30786.1| tyrosine recombinase XerD [Lactobacillus coleohominis 101-4-CHN]
          Length = 296

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 91/293 (31%), Positives = 152/293 (51%), Gaps = 8/293 (2%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQ 59
            +  ER  S NT+ +Y+ DLK+   +  ++ +S         +++ L HL+      ++ 
Sbjct: 11  FLLVERGLSNNTIQSYQNDLKKAAEYFTSQNLSSWGDIDRYAVLNLLAHLTNLGQSRTTI 70

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R++S +RQFY +L  +    ++P   + +PK    LP  L +D +  +L          
Sbjct: 71  GRQVSSLRQFYQYLLRQHRVMNDPMALVTIPKGQRHLPTVLTQDEVRRMLAVP------- 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
             G+   +R   ++E++YATGMRVSEL  L  + L+L    +  +GKG+KER++ +   A
Sbjct: 124 DTGKKMGIRDRAILEVMYATGMRVSELTNLRLNDLHLDVHLVQPRGKGDKERIIPIGEVA 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
              L  Y  +  + ++       F           +     L    A+A    K+++PH 
Sbjct: 184 ESWLNRYLHSVRAPQLANKPASDFVFLNARAKQLTRQAIWQLIKKTAQAAKIDKDVTPHT 243

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q LLGH+DI+TTQIYTH+   +L  + ++ HP A
Sbjct: 244 MRHSFATHLLENGADLRVVQELLGHSDITTTQIYTHVSQKRLLTVYKNTHPRA 296


>gi|83595067|ref|YP_428819.1| tyrosine recombinase XerD subunit [Rhodospirillum rubrum ATCC
           11170]
 gi|83577981|gb|ABC24532.1| tyrosine recombinase XerD subunit [Rhodospirillum rubrum ATCC
           11170]
          Length = 328

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 129/306 (42%), Positives = 180/306 (58%), Gaps = 12/306 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MM +ER ++  T+ AY RDL++   FL  K +     S   L +YL  ++   L   SQ 
Sbjct: 28  MMLAERGAARRTVEAYGRDLRDYAAFLREKGLDGLTVSRPTLRAYLATMAAAGLAPRSQA 87

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +RQF+ FL  EG R D+P+  L+ P+    LP+ L +  +  LL  A+      A
Sbjct: 88  RKLSCLRQFHGFLVSEGRRPDDPTIGLDSPRLGRPLPRVLSEAEVDALLVAAE------A 141

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               + +R  +L+ELLY+TG+RVSELV+L     N    T++++GKG+KERLV L   A 
Sbjct: 142 GEGARGLRARVLLELLYSTGLRVSELVSLPLSVANRDPETILVRGKGDKERLVPLGLPAR 201

Query: 181 HALQMYKKTCSSMKMTGN------DLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKN 234
            AL+ +     +            D +LFPSS   GHL+R  FA+ L  LA RAGI    
Sbjct: 202 AALRDWLIARPTTLPASGAARRRADRFLFPSSAAEGHLTRDGFAKMLGELALRAGIDPAR 261

Query: 235 ISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           +SPH++RH FASH+L  GADLR +Q LLGH DI+TTQIYTH+L D+L  LV+  HPLA+ 
Sbjct: 262 VSPHVLRHCFASHMLAHGADLRGVQTLLGHADIATTQIYTHVLDDRLTTLVRTAHPLARL 321

Query: 295 EKKHYN 300
           + +  N
Sbjct: 322 KGEGNN 327


>gi|15615028|ref|NP_243331.1| integrase/recombinase [Bacillus halodurans C-125]
 gi|34223073|sp|Q9KA25|XERC_BACHD RecName: Full=Tyrosine recombinase xerC
 gi|10175085|dbj|BAB06184.1| integrase/recombinase [Bacillus halodurans C-125]
          Length = 303

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 94/295 (31%), Positives = 151/295 (51%), Gaps = 11/295 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+  S +T+  Y+ DL+  ++F+  + I S +A S   +  YL  L +++   S+  
Sbjct: 16  LKMEKNHSPHTIVNYELDLRHFRDFMEQQSIPSFAAVSYAFVRHYLTVLYEQEYARSTVS 75

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R FY FL  E    +NP      PK    LP  L+++ +  LL+    ++    
Sbjct: 76  RKLSTLRSFYQFLVREKWVMENPFLLAHTPKGVKKLPSFLYEEEMEQLLDALNGDS---- 131

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                ++R   L E +YA+G+RVSE   L    ++L+  T+ + GKG KER V +   A 
Sbjct: 132 ---PLQLRNRALFETIYASGLRVSECCGLKLQDVDLSIGTVFVFGKGRKERYVPIGSFAC 188

Query: 181 HALQMYKKTCSSMKMTGN---DLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISP 237
            A+Q Y +      +  +   DL         G    +   R +   A         +SP
Sbjct: 189 DAIQEYIENGREKLLKKSKSVDLPGDLFLNYRGGPLTERGVRKILHQALDQAALSTRVSP 248

Query: 238 HIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H +RH+FA+HLL  GADLR +Q LLGH ++STTQ+YTH+  D+L+ + + +HP A
Sbjct: 249 HSLRHSFATHLLNNGADLRVVQDLLGHENLSTTQVYTHVTKDRLRDVYRTHHPRA 303


>gi|307289082|ref|ZP_07569038.1| tyrosine recombinase XerD [Enterococcus faecalis TX0109]
 gi|306499791|gb|EFM69152.1| tyrosine recombinase XerD [Enterococcus faecalis TX0109]
          Length = 296

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 97/292 (33%), Positives = 150/292 (51%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT  +Y+RDLK+  +FL  + + S        +  +L  L + +  ++S  
Sbjct: 12  LQIERGLSNNTRRSYERDLKKYVDFLQEQGLHSWDEVDRYMITEFLQSLHEEQQASASVI 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R F+ FL  E L + NP   ++ PKK   LP TL  D +  L+E          
Sbjct: 72  RMISSLRGFHQFLRQERLSEHNPMQHIDSPKKVQKLPSTLSVDEVTRLIETP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATG+RVSEL+ +    L+L+   +   GKG+KER++ L   A+
Sbjct: 125 TSKPLGMRNRAILEVMYATGLRVSELIEIKLGDLHLSIGLLQTIGKGDKERIIPLGDYAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +Q Y        +  +           G    +           R    +KNI+PH +
Sbjct: 185 QWIQRYMNEARPQLIKNHPNETHLFVNHHGEPLSRQGIWKNLKQIVREAQIEKNITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   ++  + +++ P A
Sbjct: 245 RHSFATHLLENGADLRIVQELLGHADISTTQIYTHITKQRMADVYKEHFPRA 296


>gi|189485678|ref|YP_001956619.1| tyrosine recombinase XerC [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170287637|dbj|BAG14158.1| tyrosine recombinase XerC [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 314

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 94/293 (32%), Positives = 160/293 (54%), Gaps = 13/293 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +++ER  S +TL AYKRD+ +   FL  K ++ S A    +  +L  L  +KL  ++  R
Sbjct: 34  LNAERNFSAHTLRAYKRDISDFALFLQKKRLNFSHAGKRDIREFLEELGNKKLSRATLAR 93

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELP-KKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           K++V+  FY FL    + K+N  +++    KK+  +P  L ++ +  LL    ++     
Sbjct: 94  KLAVLHSFYKFLIINKIIKENFIESMPASLKKDKKVPSFLTENEMQMLLNLPDLKP---- 149

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                  R   +IEL Y+ G+R+ ELV+L    ++     + + GK NKER+V +    L
Sbjct: 150 -------RDRAMIELFYSCGLRIEELVSLDLKNIDFISNVVTVTGKRNKERIVPVGDICL 202

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
           HA++ Y     ++ +  +       S +   L ++   R L     +AG  KK +SPH +
Sbjct: 203 HAIKDYINKRRNLGLPYDIRSPVFLSDRAKRLGQRTARRILHRYFVKAGFTKK-VSPHTL 261

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAK 293
           RH FA+H+L+ G DLR++Q +LGH ++S+TQIYTH+  + L+K+ ++ HP AK
Sbjct: 262 RHTFATHILDRGCDLRSVQEMLGHKNLSSTQIYTHVTIESLKKVYKETHPRAK 314


>gi|114319227|ref|YP_740910.1| tyrosine recombinase XerC [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225621|gb|ABI55420.1| tyrosine recombinase XerC [Alkalilimnicola ehrlichii MLHE-1]
          Length = 304

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 89/294 (30%), Positives = 137/294 (46%), Gaps = 11/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSA-ASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S +TL AY+RDL    ++     ++     S + +  +     ++ L   S +
Sbjct: 15  LRYERGLSPHTLQAYQRDLTRFHHWCAENGLADRDAVSAHDIRRFAAARHRQGLAPGSVQ 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S +R  + +L  EG    NP++ +  P++   LP  L  D  A LLE          
Sbjct: 75  RTLSSLRSLFRYLVREGRLTGNPAEGVAAPRRPRRLPGVLSPDEAARLLE-------GSP 127

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 +R   L EL+Y++G+R++E V L    L+LTE  + + GKG K R V +   A 
Sbjct: 128 EDDPLALRDRALYELIYSSGLRLAEAVGLDLGRLDLTEGLVEVVGKGAKTRRVPVGGKAR 187

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            ALQ +     ++                             A  +  G   + + PH++
Sbjct: 188 EALQAWLAVRPALAGADEPAVFVSQRGGRLSARSVQARLARLATLSGVG---RPVHPHML 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH+FASHLLE   DLR +Q LLGH DI+TTQ+YTHL    L ++    HP A+K
Sbjct: 245 RHSFASHLLESSGDLRAVQELLGHADIATTQVYTHLDFQHLARVYDQAHPRARK 298


>gi|315163991|gb|EFU08008.1| tyrosine recombinase XerD [Enterococcus faecalis TX1302]
          Length = 296

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 97/292 (33%), Positives = 149/292 (51%), Gaps = 8/292 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI-SLSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  ER  S NT  +Y+RDLK+   FL  + + S        +  +L  L + +  ++S  
Sbjct: 12  LQIERGLSNNTRRSYERDLKKYVAFLQEQGLHSWDEVDRYMITEFLQSLHEEQQASASVI 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R IS +R F+ FL  E L + NP   ++ PKK   LP TL  D +  L+E          
Sbjct: 72  RMISSLRGFHQFLRQERLSEHNPMQHIDSPKKVQKLPSTLSVDEVTRLIETP-------D 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   ++E++YATG+RVSEL+ +    L+L+   +   GKG+KER++ L   A+
Sbjct: 125 TSKPLGMRNRAILEVMYATGLRVSELIEIKLGDLHLSIGLLQTIGKGDKERIIPLGDYAI 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
             +Q Y        +  +           G    +           R    +KNI+PH +
Sbjct: 185 QWIQRYMNEARPQLIKNHPNETHLFVNHHGEPLSRQGIWKNLKQIVREAQIEKNITPHTL 244

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR +Q LLGH DISTTQIYTH+   ++  + +++ P A
Sbjct: 245 RHSFATHLLENGADLRIVQELLGHADISTTQIYTHITKQRMADVYKEHFPRA 296


>gi|314933431|ref|ZP_07840796.1| tyrosine recombinase XerC [Staphylococcus caprae C87]
 gi|313653581|gb|EFS17338.1| tyrosine recombinase XerC [Staphylococcus caprae C87]
          Length = 296

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 95/294 (32%), Positives = 149/294 (50%), Gaps = 10/294 (3%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+  ER  S  TL +Y  DL +  +FL ++ + L+        +YL  L    L  ++  
Sbjct: 11  MLKVERNFSEYTLKSYHDDLIQFNDFLVSEHLDLATFEYKDARNYLAFLYSHNLKRTTVS 70

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS +R FY +   +     NP   L  PKK   LP+  +++ +  L +  + +     
Sbjct: 71  RKISTLRTFYEYWMTQDELIVNPFVQLVHPKKEQYLPQFFYEEEMEALFQTVEQD----- 125

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               K +R  ++IELLYATG+RVSEL+ +    +++    + + GKGNKER +       
Sbjct: 126 --NKKGMRDRVIIELLYATGIRVSELINIKIKDIDMNLPGVKVLGKGNKERFIPFGEFCK 183

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++ Y       K + +  +L  + +      R V       +   AG+    I PH +
Sbjct: 184 QSIERYLDEFQPRK-SSDHEYLIVNMSGAPITERGVRYVLNDVVKRTAGVTD--IHPHKL 240

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+  + HP AKK
Sbjct: 241 RHTFATHLLNQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLRKVYLNAHPRAKK 294


>gi|237800088|ref|ZP_04588549.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331022943|gb|EGI03000.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 298

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 97/291 (33%), Positives = 157/291 (53%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L  A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFNGWLQERNVDLPVAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLIAVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEEAIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYMRGARDELLGGKPSDVLFPSTRGDQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEMHAKHHPRG 298


>gi|148264429|ref|YP_001231135.1| tyrosine recombinase XerD [Geobacter uraniireducens Rf4]
 gi|146397929|gb|ABQ26562.1| tyrosine recombinase XerD subunit [Geobacter uraniireducens Rf4]
          Length = 295

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 111/292 (38%), Positives = 163/292 (55%), Gaps = 9/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVTSSQR 60
           +  E+  + NTL AY RDL    +FL  ++ +     +   ++ ++  L    L   S+ 
Sbjct: 12  LLVEKGLTKNTLEAYSRDLSVYLDFLAERKRTNPENVTALDVVEHVTRLKDSGLAPRSRA 71

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R +S IR F+ FL  E     NP+  +E PK  + LP+ L    + +LL  AK +     
Sbjct: 72  RALSAIRMFHRFLLVENYSVSNPTAIIETPKTVNRLPEVLSGREVESLLATAKGDGTF-- 129

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                 VR   ++E+LYATG+RVSELV+L    +N+    ++  GKG KERLV +  SA 
Sbjct: 130 -----EVRDRAMLEVLYATGLRVSELVSLKLRDVNIDAGYLLTMGKGEKERLVPMGESAR 184

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            A+  Y      +     D      S   G +SRQ F   +K  +  AGI +KNISPH +
Sbjct: 185 TAIGEYLAGIRILLDRKGDNEYLFLSRLGGKMSRQAFWNIIKKRSGAAGI-RKNISPHTL 243

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLE GADLR++QI+LGH D+S+TQIYTH+  ++L+KL Q++HP  
Sbjct: 244 RHSFATHLLENGADLRSVQIMLGHADLSSTQIYTHVTRERLKKLHQEFHPRG 295


>gi|183221814|ref|YP_001839810.1| tyrosine recombinase XerC [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189911886|ref|YP_001963441.1| tyrosine site-specific recombinase XerC [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167776562|gb|ABZ94863.1| Tyrosine site-specific recombinase XerC [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167780236|gb|ABZ98534.1| Tyrosine recombinase XerC [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 311

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 94/294 (31%), Positives = 138/294 (46%), Gaps = 12/294 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLV-TSSQR 60
           +  E+  S +TL AY RDLK    F   +EI + +     + +Y   L   K     +Q 
Sbjct: 29  LKIEKNYSEHTLFAYLRDLKFFFEFCLKEEIDILSVDVLDVRAYFADLKSSKKQDKRTQS 88

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R FY FL  E     NP   +  PK    LPK        ++L+    E     
Sbjct: 89  RKLSSLRTFYKFLFREEKIGANPILQVSFPKTKKRLPKNFTPIETEDILDYEDPE----- 143

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +    R   ++E+LY+TG+RV ELV      LN    ++ + GK  KER V + P A 
Sbjct: 144 KKEVLGKRDKAIVEVLYSTGLRVFELVNAKLSDLNEELTSLKVMGKRRKERFVFIGPEAK 203

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            ALQ Y          GN         + G        R + +        +K I+PH  
Sbjct: 204 VALQEYLDER------GNGGPEEIFLNQRGGKLTTRGIRYILSERRSVMGMEKAITPHKF 257

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH FA+ LL  GAD+R +Q LLGH+ +S+TQ+Y  +  D+L+++ ++ HP AKK
Sbjct: 258 RHTFATDLLNAGADIRAVQELLGHSSLSSTQVYLSVSRDRLKEVYRNAHPHAKK 311


>gi|116748125|ref|YP_844812.1| tyrosine recombinase XerD [Syntrophobacter fumaroxidans MPOB]
 gi|116697189|gb|ABK16377.1| tyrosine recombinase XerD subunit [Syntrophobacter fumaroxidans
           MPOB]
          Length = 294

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 104/295 (35%), Positives = 163/295 (55%), Gaps = 13/295 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEIS-LSAASTNHLISYLNHLSQRKLVT 56
            +   + E+  S NT++ Y  DL+EM  +     +S   A S   ++SYL  +S R L  
Sbjct: 8   FLNHITVEKGLSPNTVAGYGGDLQEMLGYFGKHGVSSWEAVSREDIVSYLESVSGR-LSH 66

Query: 57  SSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEA 116
            S+ R+++ +R F+ +L   G    +P+  +  PK N  LPKTL    +  LL       
Sbjct: 67  RSKARRLAALRAFFKYLERTGKMSGSPAALVRFPKFNPGLPKTLTGREVDALLAAP---- 122

Query: 117 ENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILS 176
              A G     R   ++ELLYATG+RVSEL  L    ++L    ++ +GKG+KER V + 
Sbjct: 123 ---AAGTPLGQRDRAMLELLYATGLRVSELADLQLDQVHLEAGYLVARGKGDKERPVPMG 179

Query: 177 PSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
             A  ALQ+Y +      +          + +   L+RQ   + +K  A ++GI ++N++
Sbjct: 180 EPAGEALQIYLRDGRRRLLKDGRSREVFLNRRAVKLTRQGIWKIIKQYALKSGI-RQNLT 238

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           PH++RH+FA+HLLE GADLR++Q +LGH DISTTQIYTH+   +L+++   +HP 
Sbjct: 239 PHVLRHSFATHLLENGADLRSLQAMLGHADISTTQIYTHVAKKRLKEVHLKFHPR 293


>gi|323493661|ref|ZP_08098782.1| site-specific tyrosine recombinase XerD [Vibrio brasiliensis LMG
           20546]
 gi|323312184|gb|EGA65327.1| site-specific tyrosine recombinase XerD [Vibrio brasiliensis LMG
           20546]
          Length = 302

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 106/288 (36%), Positives = 166/288 (57%), Gaps = 7/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           ER  S NTL++Y+ DL ++  ++      L   S + L  Y + LS      +S+ R +S
Sbjct: 22  ERGLSENTLASYRNDLVKLLQWMTANNYRLDFISLSGLQEYQSWLSDSGYKQTSRARMLS 81

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            IR+ + +L  E +R D+PS  L  PK    LPK L +D +  LL           P   
Sbjct: 82  AIRRLFQYLHREKIRSDDPSALLVSPKLPKRLPKDLTEDQVEALLNAP-------DPNDA 134

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
             +R   ++ELLYATG+RV+ELV+L+   ++L +  + + GKG KERLV +  +A+  ++
Sbjct: 135 MELRDKAMLELLYATGLRVTELVSLTMENISLRQGVVRVTGKGGKERLVPMGENAVEWIE 194

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            + +   S  +      +   S +   ++RQ F   +K  A  AGI  + +SPH++RHAF
Sbjct: 195 TFLQQGRSELLGETTSDVVFPSKRARQMTRQTFWHRIKHYAVLAGIDTELLSPHVLRHAF 254

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L  ++HP A
Sbjct: 255 ATHLLNYGADLRVVQMLLGHSDLSTTQIYTHVATERLKQLHSEHHPRA 302


>gi|254511455|ref|ZP_05123522.1| tyrosine recombinase XerD [Rhodobacteraceae bacterium KLH11]
 gi|221535166|gb|EEE38154.1| tyrosine recombinase XerD [Rhodobacteraceae bacterium KLH11]
          Length = 318

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 119/302 (39%), Positives = 176/302 (58%), Gaps = 13/302 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +   ++E  ++ NTL AY RDLK+  ++L  ++   + A  + +  YL     + L  +
Sbjct: 14  FLEAQAAELGAANNTLLAYGRDLKDFADWLMRRKSGFAEADRDQIEGYLIDCDAQGLSRA 73

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           ++ R++S I+Q Y F   EG R+ NP+  ++ P +   LPKTL    +  LLE A+    
Sbjct: 74  TRARRLSAIKQLYRFAFEEGWREANPAIQIKGPGRAKRLPKTLDVPEVDRLLEAARRTG- 132

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                   R+R   L+ELLYATGMRV+ELV+L   +     R +++ GKG KER+V LSP
Sbjct: 133 ---RSAADRIRNTCLMELLYATGMRVTELVSLPVSSARGDPRMLLVLGKGGKERMVPLSP 189

Query: 178 SALHALQMYKKTCSSM------KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ 231
            A  AL  + K           K      +LFPS  K+G+L+R  F   +K LA   G+ 
Sbjct: 190 PARDALAEWLKQRDDAEERTVAKGGQASRFLFPSRGKSGYLTRHRFFLLVKELAVEGGVS 249

Query: 232 KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
              ++PH +RHAFA+HLL  GADLR+IQ LLGH D++TT+IYTH+L ++L +LV ++HPL
Sbjct: 250 PAKVTPHTLRHAFATHLLANGADLRSIQTLLGHADVATTEIYTHVLDERLAELVLEHHPL 309

Query: 292 AK 293
           AK
Sbjct: 310 AK 311


>gi|254488719|ref|ZP_05101924.1| tyrosine recombinase XerD [Roseobacter sp. GAI101]
 gi|214045588|gb|EEB86226.1| tyrosine recombinase XerD [Roseobacter sp. GAI101]
          Length = 324

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 119/302 (39%), Positives = 170/302 (56%), Gaps = 13/302 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +   ++E  +S NT  AY RDLK+  +FL  + +  + A+ + +  YL     + L  S
Sbjct: 12  FLEAQAAELGASTNTQLAYGRDLKDFDSFLAGRHLDFARATRDDVERYLVWCDAQGLAKS 71

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           ++ R++S I+Q Y F   E  R DNP+  +  P ++  LPK L +  +  LLE A+    
Sbjct: 72  TRARRLSAIKQIYRFAFEESWRSDNPAIQISGPGQDKRLPKILSEHEVDRLLEAARGSG- 130

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
                  +++R   L+ELLYATGMRVSELV+L         R ++I GKGNKERLV LSP
Sbjct: 131 ---RNLHEKLRNTCLMELLYATGMRVSELVSLPVSATRGDPRLLLIMGKGNKERLVPLSP 187

Query: 178 SALHALQMYKKTCSSM------KMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ 231
            A  AL  +      +      K      +LFPS    G+L+R  F   +K  A   G+ 
Sbjct: 188 PARVALTDWLIARDQIDAAAQAKKQPASRFLFPSRGVAGYLTRHRFYLMIKEFAVAGGVD 247

Query: 232 KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
              ++PH +RHAFA+HLL  GADLR IQ +LGH D++TT+IYTH+L  +L +LV + HPL
Sbjct: 248 PSKVTPHTLRHAFATHLLANGADLRAIQTMLGHADVATTEIYTHVLEARLSELVLENHPL 307

Query: 292 AK 293
           AK
Sbjct: 308 AK 309


>gi|238855698|ref|ZP_04645995.1| tyrosine recombinase XerC [Lactobacillus jensenii 269-3]
 gi|260664453|ref|ZP_05865305.1| tyrosine recombinase XerC [Lactobacillus jensenii SJ-7A-US]
 gi|282932212|ref|ZP_06337659.1| tyrosine recombinase XerC [Lactobacillus jensenii 208-1]
 gi|313472147|ref|ZP_07812639.1| tyrosine recombinase XerC [Lactobacillus jensenii 1153]
 gi|238831683|gb|EEQ24023.1| tyrosine recombinase XerC [Lactobacillus jensenii 269-3]
 gi|239529518|gb|EEQ68519.1| tyrosine recombinase XerC [Lactobacillus jensenii 1153]
 gi|260561518|gb|EEX27490.1| tyrosine recombinase XerC [Lactobacillus jensenii SJ-7A-US]
 gi|281303662|gb|EFA95817.1| tyrosine recombinase XerC [Lactobacillus jensenii 208-1]
          Length = 302

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 90/296 (30%), Positives = 151/296 (51%), Gaps = 10/296 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEI--SLSAASTNHLISYLNHLSQRKLVTSSQ 59
           ++ ER  S  TL+AY  DLK+ ++F  N          ++  +  Y+  L+   L  +SQ
Sbjct: 14  LAYERGYSNLTLTAYLNDLKQAEDFWKNNGGFNGFKQVTSRDIEIYIASLASTGLSQASQ 73

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            RK+S ++ FY FL    L + +P+ T+ + +K+  LP+  ++  I  +L+         
Sbjct: 74  ARKLSSLKSFYKFLTRRNLVEVDPTQTVSIHRKSKKLPEFFYEPEIKKVLDSL------- 126

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
           +      VR   + EL YATGMRVSE+  L+   ++   + +++ GKGNK+R V     A
Sbjct: 127 SASDKLTVRNKAMFELFYATGMRVSEVSNLTLEQIDFDVQMILVHGKGNKDRYVPFGDYA 186

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
              L  Y      +    +D        +   L+ +     ++ +  + G+   N+ PH 
Sbjct: 187 KACLLRYLNEARRLFNPDDDNHYVFLDNRGHQLTSRGIEYIMRKVFQKGGLS-ANVHPHE 245

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKE 295
           +RH FA+ +L  GADLR++Q LLGH  +STTQIYTH+  ++LQK  + + P  K +
Sbjct: 246 LRHTFATQMLNNGADLRSVQELLGHESLSTTQIYTHVTMERLQKDYEKFFPRNKGK 301


>gi|325273831|ref|ZP_08140016.1| site-specific tyrosine recombinase XerD [Pseudomonas sp. TJI-51]
 gi|324101037|gb|EGB98698.1| site-specific tyrosine recombinase XerD [Pseudomonas sp. TJI-51]
          Length = 298

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 100/291 (34%), Positives = 164/291 (56%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L+ + ++L  A  + ++ +L    ++     S  R
Sbjct: 16  LWLEKGLSDNTRVSYRSDLALFNGWLHERSVALPDAGRDLILDHLAWRLEQGYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            IS +R F+ +L  E L   +P+  +++P+    LPK+L +  +  LL+           
Sbjct: 76  FISGLRGFFRYLLREKLVAIDPTLQVDMPQLGKPLPKSLSEADVEALLQAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
           G+    R   ++E+LYA G+RV+ELV+L+   +NL +  + + GKG+KERLV +   A+ 
Sbjct: 129 GEAIGQRDRAMLEVLYACGLRVTELVSLALDQVNLRQGVLRVMGKGSKERLVPMGEEAVV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            L+ Y ++  +  + G    +   S +   ++RQ F   +K  A  AGI K  +SPH +R
Sbjct: 189 WLERYLRSGRAELLNGRPSDVLFPSLRGEQMTRQTFWHRIKHHARVAGIDKP-LSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ+L   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVAKARLQQLHAQHHPRG 298


>gi|221135227|ref|ZP_03561530.1| site-specific tyrosine recombinase XerD [Glaciecola sp. HTCC2999]
          Length = 303

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 104/297 (35%), Positives = 165/297 (55%), Gaps = 14/297 (4%)

Query: 1   MMSS---ERASSINTLSAYKRDLKEMQNFLNNKE--ISLSAASTNHLISYLNHLSQRKLV 55
            +     E+  S NTLSAY+ DL+++  FL  ++   SL   +   + +YL+H     + 
Sbjct: 16  FLEVLYLEKGLSDNTLSAYQTDLRQLCRFLTQQDAAFSLVDITDTDIRAYLSHRQANNVS 75

Query: 56  TSSQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIE 115
             S  R +S ++ F  +   E +R D+P   ++ PK    LP +L +  + +LL      
Sbjct: 76  ARSTARALSSLKTFIKYCLSEKIRDDDPLRHIKPPKVAVSLPDSLTEAQVESLLAAP--- 132

Query: 116 AENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVIL 175
                       R   ++E+LYATG+RV+ELV L    ++L +  + + GKGNKERLV L
Sbjct: 133 ----DTALAVGQRDKAMLEVLYATGLRVTELVGLRLDQMSLLQGVVRVIGKGNKERLVPL 188

Query: 176 SPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNI 235
              A+ AL ++ +      +  +   +FPS+     ++RQ F   +K  A  AGIQ  ++
Sbjct: 189 GEPAIEALTLFLQQGRHELLKHSSDVVFPSTR-GTQMTRQTFWHRIKHYAMVAGIQV-HL 246

Query: 236 SPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           SPH +RHAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L  +++ +HP  
Sbjct: 247 SPHTLRHAFATHLLNHGADLRVVQLLLGHSDLSTTQIYTHVASERLTHIIESHHPRG 303


>gi|302185529|ref|ZP_07262202.1| site-specific tyrosine recombinase XerD [Pseudomonas syringae pv.
           syringae 642]
          Length = 298

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 96/291 (32%), Positives = 158/291 (54%), Gaps = 8/291 (2%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E+  S NT  +Y+ DL     +L  + + L +A    ++ +L    +      S  R
Sbjct: 16  LWLEKGLSDNTRDSYRSDLALFHGWLQERNVDLISAGREVILDHLAWRVENAYKPRSTAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S  R FY +L  E L   +P+  +++P+    LPK+L +  +  LL            
Sbjct: 76  FLSGARGFYRYLLREKLISVDPTLQIDMPQLGKPLPKSLSEADVEALLAAP-------DL 128

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            +    R   ++E+LYA G+RV+EL++L+   +NL +  + + GKG+KERLV +   ++ 
Sbjct: 129 SEPIGERDRAMLEVLYACGLRVTELISLTLEQVNLRQGVLRVMGKGSKERLVPMGEESIV 188

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
            ++ Y +      + G    +   ST+   ++RQ F   +K  A  AGI  K++SPH +R
Sbjct: 189 WVERYLRGARDELLGGKPSDVLFPSTRGEQMTRQTFWHRIKHQATVAGI-GKSLSPHTLR 247

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           HAFA+HLL  GADLR +Q+LLGH+D+STTQIYTH+   +LQ++   +HP  
Sbjct: 248 HAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARARLQEMHARHHPRG 298


>gi|312972864|ref|ZP_07787037.1| tyrosine recombinase XerD [Escherichia coli 1827-70]
 gi|310332806|gb|EFQ00020.1| tyrosine recombinase XerD [Escherichia coli 1827-70]
          Length = 283

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 108/286 (37%), Positives = 172/286 (60%), Gaps = 7/286 (2%)

Query: 6   RASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKISV 65
           +  + NTL+AY+RDL  M  +L+++ ++L+ A ++ L + L    +     +S  R +S 
Sbjct: 4   KNLAENTLNAYRRDLSMMVEWLHHRGLTLATAQSDDLQALLAERLEGGYKATSSARLLSA 63

Query: 66  IRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQWK 125
           +R+ + +L  E  R+D+PS  L  PK    LPK L +  +  LL+   I+       Q  
Sbjct: 64  VRRLFQYLYREKFREDDPSAHLASPKLPQRLPKDLSEAQVERLLQAPLID-------QPL 116

Query: 126 RVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQM 185
            +R   ++E+LYATG+RVSELV L+   ++L +  + + GKGNKERLV L   A++ L+ 
Sbjct: 117 ELRDKAMLEVLYATGLRVSELVGLTMSDISLRQGVVRVIGKGNKERLVPLGEEAVYWLET 176

Query: 186 YKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAFA 245
           Y +      + G  + +   S +   ++RQ F   +K  A  AGI  + +SPH++RHAFA
Sbjct: 177 YLEHGRPWLLNGVSIDVLFPSQRAQQMTRQTFWHRIKHYAVLAGIDSEKLSPHVLRHAFA 236

Query: 246 SHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
           +HLL  GADLR +Q+LLGH+D+STTQIYTH+  ++L++L Q +HP 
Sbjct: 237 THLLNHGADLRVVQMLLGHSDLSTTQIYTHVATERLRQLHQQHHPR 282


>gi|288555956|ref|YP_003427891.1| integrase/recombinase [Bacillus pseudofirmus OF4]
 gi|288547116|gb|ADC50999.1| integrase/recombinase [Bacillus pseudofirmus OF4]
          Length = 295

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 107/293 (36%), Positives = 161/293 (54%), Gaps = 11/293 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNN--KEISLSAASTNHLISYLNHLSQRKLVTSSQ 59
           +  ER  + NT+ +Y+RDL     FL N     +    + + ++ YL  L ++    ++ 
Sbjct: 12  IQIERGLAENTIQSYRRDLLNYAKFLQNVIDIQTFKDVTRHMIVDYLFFLKEQGRAEATI 71

Query: 60  RRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENP 119
            R I+ IR F+ FL  E L + +PS  L++PK +  LPK L  + +  LL          
Sbjct: 72  ARTIASIRAFHQFLLREKLSEQDPSVHLDIPKASKRLPKVLSLEEVEALL--------TI 123

Query: 120 APGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSA 179
           +      +R   ++E LYATGMRVSEL+ L     +L+   +   GKGNKER++ L   A
Sbjct: 124 SGQDHLSIRNRAMMETLYATGMRVSELINLKLTDTHLSMGFVRCIGKGNKERIIPLGQQA 183

Query: 180 LHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHI 239
             ALQ+Y +   S  +  N       +     L+RQ F + +K LA  A I+K+ ++PH 
Sbjct: 184 TKALQLYLEQARSTMLKKNRHEYVFVNHYGRPLTRQGFWKIVKKLAEAAKIEKE-LTPHT 242

Query: 240 IRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           +RH+FA+HLLE GADLR +Q +LGH DISTTQIYTH+   +++ +   YHP A
Sbjct: 243 LRHSFATHLLENGADLRAVQEMLGHVDISTTQIYTHVTKTRMKDVYAQYHPRA 295


>gi|254521772|ref|ZP_05133827.1| tyrosine recombinase XerC [Stenotrophomonas sp. SKA14]
 gi|219719363|gb|EED37888.1| tyrosine recombinase XerC [Stenotrophomonas sp. SKA14]
          Length = 296

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 97/298 (32%), Positives = 152/298 (51%), Gaps = 15/298 (5%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S +TL AY+RDL  +  +   + +++ A     L  ++    +R L   S +R
Sbjct: 11  LQVERRMSAHTLDAYRRDLDALSVWAEPRGMAVEALDAETLRQFVADEHRRGLSAKSLQR 70

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           ++S  R FY +L   G  + +P+ TL+ P+    LP+ L  D    L+E          P
Sbjct: 71  RLSACRSFYAWLLKHGRIEVSPAATLKAPRAPRRLPQVLDADEAVQLVE--------LEP 122

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
                 R   L+EL Y++G+R+SE+  L+   L+     + + GKGN++R V     A  
Sbjct: 123 EGELGRRDRALLELFYSSGLRLSEVCALTWRDLDFASGLVNVMGKGNRQRRVPFGRPARE 182

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           ALQ ++        +G          + G +S++     ++ LA R G+  K++ PH++R
Sbjct: 183 ALQAWRAE------SGGGPASPVFPGRNGPISQRAVQIRIRQLAQRQGL-FKHVHPHMLR 235

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKHY 299
           H+FASH+LE   DLR +Q LLGH DI+TTQIYTHL    L K+    HP AK+  K  
Sbjct: 236 HSFASHILESSGDLRGVQELLGHADIATTQIYTHLDFQHLAKVYDAAHPRAKRRSKGD 293


>gi|45657471|ref|YP_001557.1| putative integrase/recombinase protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
 gi|45600710|gb|AAS70194.1| putative integrase/recombinase protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 332

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 91/294 (30%), Positives = 150/294 (51%), Gaps = 10/294 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRK-LVTSSQR 60
           +  E+  S NT++AY  DLK    F   +++ +       + SY  +L+++  +   SQ 
Sbjct: 48  LKIEKNYSQNTINAYSIDLKFFFEFCEKEQLDIFQIEPVDIRSYFAYLAKKHEIDRRSQS 107

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RK+S +R FY  L  E L K NP+  L  PK    +PK    +    +LE     A    
Sbjct: 108 RKLSSLRTFYKVLLREDLVKSNPATQLSFPKVRKEVPKNFRINETEEILEFESENA---- 163

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
             +   +R   +IE+LY++G+RV ELV    ++L+     + + GKG KER V     A+
Sbjct: 164 -SEVSEIRDRAMIEVLYSSGLRVFELVNAKLNSLSKDLTVLKVLGKGRKERFVYFGKEAV 222

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +LQ Y +  +       +++L         L+ +     L     + G + K I+PH  
Sbjct: 223 SSLQKYLEYRNVSFPDAEEIFLNQR---GKKLTTRGVRYILNERRKKMGWE-KTITPHKF 278

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKK 294
           RH FA+ LL+ GA++R +Q LLGH+ +STTQIY  +  +K++++ +  HP A+K
Sbjct: 279 RHTFATDLLDAGAEIRAVQELLGHSSLSTTQIYLSVSKEKIKEVYRKAHPHARK 332


>gi|172040772|ref|YP_001800486.1| integrase/recombinase [Corynebacterium urealyticum DSM 7109]
 gi|171852076|emb|CAQ05052.1| integrase/recombinase [Corynebacterium urealyticum DSM 7109]
          Length = 303

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 94/292 (32%), Positives = 153/292 (52%), Gaps = 10/292 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQ-RKLVTSSQR 60
           +  ER  S NTL +Y+RD      +L  +  S++  +T  + S++  L++   L  S++ 
Sbjct: 20  LRLERNLSRNTLDSYRRDTDRYLAWLGAR--SVTELNTGDIESFMASLAKGEGLAASTRA 77

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R ++ +R F+ FL  EG+ + + +D +  P +   +PK L    +  +LE    +     
Sbjct: 78  RILAAVRNFHRFLTGEGVTEGDVADDVARPGQAASIPKALSIAEVTAILESCPND----D 133

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
                ++R   L+E+LY+TG RVSEL+ L    ++ TE+ +I++GKG+KER+V +   AL
Sbjct: 134 AASLIQIRDRALLEMLYSTGARVSELLGLDVDDVDPTEKLIIVRGKGSKERVVPVGDPAL 193

Query: 181 HALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            ALQ Y               LF +        +  F                 +SPH  
Sbjct: 194 DALQHYLVRVRPAFNKKGSAALFLNRNGGRMGRQSAFNMVSSVSEKAG---VAGVSPHSF 250

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           RH+FA+HLLEGGAD+R +Q LLGH+++ TTQIYT + PD L++   + HP +
Sbjct: 251 RHSFATHLLEGGADIRVVQELLGHSNVVTTQIYTKVSPDHLREAWSESHPRS 302


>gi|219669469|ref|YP_002459904.1| tyrosine recombinase XerD [Desulfitobacterium hafniense DCB-2]
 gi|219539729|gb|ACL21468.1| tyrosine recombinase XerD [Desulfitobacterium hafniense DCB-2]
          Length = 322

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 102/307 (33%), Positives = 163/307 (53%), Gaps = 17/307 (5%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           ++ ER  S NT ++Y+RDL++   FL  +  ++ A   N L  +L     +     +  R
Sbjct: 16  LNVERGLSPNTRNSYERDLRKFTAFLQQRGKNIIACEGNDLFLFLLQEKNQGRSARTLAR 75

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLL------------ 109
            ++ +R F+ FL  E +R+D+P++ L  PK    LP  L + +I+ L+            
Sbjct: 76  YLATLRGFFAFLLGEEMREDDPTEYLSTPKLEQHLPHVLSEGSISKLMGEGGDRDKEGPK 135

Query: 110 ----EQAKIEAENPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQG 165
                +   ++++    +   +R   +IE+LY  G+RVSELV L    +    RT+  +G
Sbjct: 136 PGKSSKKAGDSDSEGKDKGLLMRNMAMIEVLYGCGLRVSELVGLKVSDIIFETRTLRCRG 195

Query: 166 KGNKERLVILSPSALHALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALA 225
           KGNKER+V +   AL  LQ Y +         +   +   +++   L+RQ     LK  A
Sbjct: 196 KGNKERIVPIGEYALEVLQNYLEHDRERLRGKHKTEVLFLNSRGTALTRQGIWDILKKWA 255

Query: 226 ARAGIQKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLV 285
              G+Q +NI PH  RH+FA+HLL+ GADLR++Q +LGH DI+TTQIYTHL   +L ++ 
Sbjct: 256 QTHGVQ-ENIYPHKFRHSFATHLLDHGADLRSVQEMLGHADIATTQIYTHLSRQRLLEVF 314

Query: 286 QDYHPLA 292
           +  HP A
Sbjct: 315 RKAHPRA 321


>gi|32474020|ref|NP_867014.1| integrase/recombinase [Rhodopirellula baltica SH 1]
 gi|32444557|emb|CAD74556.1| integrase/recombinase [Rhodopirellula baltica SH 1]
 gi|327543299|gb|EGF29732.1| integrase/recombinase [Rhodopirellula baltica WH47]
          Length = 300

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 90/296 (30%), Positives = 151/296 (51%), Gaps = 13/296 (4%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKE---ISLSAASTNHLISYLNHLSQRKLVTSS 58
           M++ER +S  T+ AY+ DL     ++   E   I L + +   L  +   L Q     ++
Sbjct: 12  MATERNASDLTIKAYREDLFAFAEWIGQAEAGRIQLDSLTPQQLRQFQAALQQAGYARTT 71

Query: 59  QRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAEN 118
             RK++ +R F+ F   EG+   NP+  L  P+ +  LP  L  + +  LL      +E 
Sbjct: 72  IARKLASLRSFFKFAMREGMASSNPAKPLRNPRSSRKLPHVLTSEEVGRLLVAPPAISE- 130

Query: 119 PAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPS 178
                   +R   ++E +Y++G+RVSELV L    L+ ++    ++GKG KER+  L   
Sbjct: 131 ------AGLRDRAILETMYSSGLRVSELVGLRDGDLDFSQGITRVRGKGRKERISPLGSY 184

Query: 179 ALHALQMYKKTCSSMKMTGN--DLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNIS 236
           A+ A+Q Y    S    +           +     L+ +   R L+   A+A +  +  S
Sbjct: 185 AIKAIQAYAGRRSRSPESEKLGRAAPVFVNRFGNILTTRSVGRMLEKYIAKAELDTRT-S 243

Query: 237 PHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           PH +RH+FA+HLL+ GAD+R++Q LLGH  ++TTQIYTH+    L+++ +  HP +
Sbjct: 244 PHTLRHSFATHLLDRGADIRSVQELLGHKSLTTTQIYTHVSAANLRQVYEKAHPRS 299


>gi|329733650|gb|EGG69978.1| tyrosine recombinase XerC [Staphylococcus aureus subsp. aureus
           21193]
          Length = 298

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 96/297 (32%), Positives = 152/297 (51%), Gaps = 10/297 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  ER  S +TL +Y+ DL +   FL  + + L+        +YL++L    L  +S  R
Sbjct: 12  LKVERNFSEHTLKSYQDDLIQFNQFLEQEHLELNTFEYRDARNYLSYLYSNHLKRTSVSR 71

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           KIS +R FY +         NP   L  PKK   LP+  +++ +  L +  + +      
Sbjct: 72  KISTLRTFYEYWMTLDENIINPFVQLVHPKKEKYLPQFFYEEEMEVLFKTVEED------ 125

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
              K +R  +++ELLYATG+RVSELV +    ++     + + GKG+KER V        
Sbjct: 126 -TSKNLRDRVILELLYATGIRVSELVNIKKQDIDFYANGVTVLGKGSKERFVPFGAYCRQ 184

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           +++ Y +    ++ + N  +L  +        R V       +   AG+ +  I PH +R
Sbjct: 185 SIENYLEHFKPIQ-SCNHDFLIVNMKGEAITERGVRYVLNDIVKRTAGVSE--IHPHKLR 241

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKKH 298
           H FA+HLL  GADLRT+Q LLGH ++STT  YTH+   +L+K+  + HP AKKE + 
Sbjct: 242 HTFATHLLNQGADLRTVQSLLGHVNLSTTGKYTHVSNQQLRKVYLNAHPRAKKENET 298


>gi|160884146|ref|ZP_02065149.1| hypothetical protein BACOVA_02123 [Bacteroides ovatus ATCC 8483]
 gi|156110488|gb|EDO12233.1| hypothetical protein BACOVA_02123 [Bacteroides ovatus ATCC 8483]
          Length = 319

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 107/297 (36%), Positives = 170/297 (57%), Gaps = 9/297 (3%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E++ S NTL AY  DL ++ NFL  +++ +     + L  +   L    +   SQ R
Sbjct: 24  LKLEKSLSPNTLDAYLTDLYKLINFLEQEKVGILDVCLSDLQHFAAGLHDIGIHPRSQAR 83

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
            +S I+ F+ FL  E   + +PS+ LE PK    LP+ L  + I  ++            
Sbjct: 84  ILSGIKSFFRFLIIEDYLEADPSELLEGPKIGFKLPEVLTVEEIDRIISAV-------DR 136

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
            + +  R   ++E LY+ G+RVSELVTL    L   E  + ++GKG+K+RLV +SP A++
Sbjct: 137 SKAEGQRNRAILETLYSCGLRVSELVTLKLSDLYFDEGFIKVEGKGSKQRLVPISPRAIN 196

Query: 182 ALQMYKKTCSSMK-MTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHII 240
            +++Y    + ++   G++ ++F S  +   LSR +    +K LA +AGI  KNISPH  
Sbjct: 197 EIKLYIPDRNQIEVKKGHEDFVFVSQRRGKGLSRIMIFHMIKELAEKAGIT-KNISPHTF 255

Query: 241 RHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLAKKEKK 297
           RH+FA+HLLEGGA+LR IQ +LGH  I+TT+IYTH+  + L+  + ++HP   K +K
Sbjct: 256 RHSFATHLLEGGANLRAIQCMLGHESIATTEIYTHIDRNMLRSEIIEHHPRNIKYRK 312


>gi|254463512|ref|ZP_05076928.1| tyrosine recombinase XerD [Rhodobacterales bacterium HTCC2083]
 gi|206680101|gb|EDZ44588.1| tyrosine recombinase XerD [Rhodobacteraceae bacterium HTCC2083]
          Length = 314

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 126/301 (41%), Positives = 184/301 (61%), Gaps = 13/301 (4%)

Query: 1   MM---SSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTS 57
            +   ++E  ++ NT  AY RDLK+   +L+ +++S   A+ +H+ +YL     + L  S
Sbjct: 14  FLDAQAAELGAATNTQLAYARDLKDFAEYLSGRKLSFENAARDHVEAYLIFCDAQGLAKS 73

Query: 58  SQRRKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAE 117
           ++ R++S I+Q Y F   EG R DNP+  +  P K+  LPKTL+   +  LL  A++   
Sbjct: 74  TRARRLSAIKQLYRFGFEEGWRSDNPAIQIAGPGKDKRLPKTLNMGEVDGLLAAARVVGR 133

Query: 118 NPAPGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSP 177
           +P      R+R   L+ELLYATGMRVSELV+L           ++I+GKG+KER+V LSP
Sbjct: 134 SPTD----RLRNTCLMELLYATGMRVSELVSLPISAARGNPSMLLIRGKGDKERMVPLSP 189

Query: 178 SALHALQMYKKTCSSMKMTGN------DLWLFPSSTKTGHLSRQVFARDLKALAARAGIQ 231
            A  AL  + +T   ++  G         +LFPS  K GHL+R  F   +K L+  AG+ 
Sbjct: 190 PARDALTEWLETLDDLQEAGRLKGKAVSRFLFPSRGKEGHLTRHRFYILIKELSVHAGVP 249

Query: 232 KKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPL 291
              ++PH +RHAFA+HLLE GADLR+IQ LLGH D++TT+IYTH+L  +LQ+LV  +HPL
Sbjct: 250 PAKVTPHTLRHAFATHLLENGADLRSIQTLLGHADVATTEIYTHVLEARLQELVLQHHPL 309

Query: 292 A 292
           A
Sbjct: 310 A 310


>gi|262202039|ref|YP_003273247.1| integrase family protein [Gordonia bronchialis DSM 43247]
 gi|262085386|gb|ACY21354.1| integrase family protein [Gordonia bronchialis DSM 43247]
          Length = 304

 Score =  182 bits (460), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 86/291 (29%), Positives = 145/291 (49%), Gaps = 5/291 (1%)

Query: 2   MSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRR 61
           +  E   S +T+ AY  D++ +  F   + ++ +      L ++L   ++R    ++  R
Sbjct: 19  LRLEMGRSPHTVRAYVGDVRGLIAFAGARGVATADIDLTLLRAWLAEHTRRGAARTTIAR 78

Query: 62  KISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAP 121
           ++S ++ F  +   EGL  D+PS  L  PK +  LP  L    + +++  A  E      
Sbjct: 79  QVSSVKTFCAWAVREGLMSDDPSHRLRAPKAHRTLPAVLAPAQVPDVIAAAAAERPQ--- 135

Query: 122 GQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALH 181
           G    +R  +++E+LYA G+RV EL  L    ++   R + + GKG+KER V     A  
Sbjct: 136 GDPIALRDTVIVEVLYAGGIRVGELCGLDVDDVDRDRRVLRVIGKGDKERTVPYGAPAAV 195

Query: 182 ALQMYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIR 241
           AL  + +       T           + G L +++    +     +AG     + PH +R
Sbjct: 196 ALDAWLRHGRPALATERSGAALLLGARGGRLDQRMARTVVTRAVEQAG--GPAMGPHGLR 253

Query: 242 HAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           H+ A+HLLEGGADLR +Q LLGH+ ++TTQIYTH+  ++L+ +    HP A
Sbjct: 254 HSAATHLLEGGADLRVVQELLGHSSLATTQIYTHVSVERLRAVHNQAHPRA 304


>gi|222149986|ref|YP_002550943.1| site-specific tyrosine recombinase XerD [Agrobacterium vitis S4]
 gi|221736968|gb|ACM37931.1| tyrosine recombinase XerD [Agrobacterium vitis S4]
          Length = 332

 Score =  182 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 159/318 (50%), Positives = 216/318 (67%), Gaps = 19/318 (5%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           MMS+ER ++ NTLS+Y+RDL+++  FL  +++S+ AA+++ L +YL  L  R    SSQ 
Sbjct: 15  MMSAERGAAGNTLSSYERDLEDLHGFLATRKVSVMAATSDDLSAYLADLGHRGFEASSQA 74

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           R++S +RQFY FL  EGLR D+P+  L+ PKK   LPKTL    +  LL  A+ EA    
Sbjct: 75  RRLSALRQFYKFLYAEGLRGDDPTSILDTPKKGRPLPKTLSIADVDKLLSLAQAEAALDG 134

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
           P + +R+R   L+ELLYATGMRVSELV+L A+ L    R ++I+GKGNKERLV LS SA+
Sbjct: 135 PDRLQRLRRLALLELLYATGMRVSELVSLPANVLAQEGRFLVIRGKGNKERLVPLSRSAI 194

Query: 181 HALQMY-------------------KKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDL 221
            A+Q+Y                   K+T S +  +    +LFP++++ G+L RQVFAR+L
Sbjct: 195 AAMQVYAQAKEIEQAEKPPSKKTASKQTESKLGKSSGIGFLFPAASREGYLPRQVFAREL 254

Query: 222 KALAARAGIQKKNISPHIIRHAFASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKL 281
           K LA RAG+    +SPH++RHAFASHLLE GADLR +Q LLGH+DISTTQIYTH+L ++L
Sbjct: 255 KDLAIRAGLSGDAVSPHVLRHAFASHLLENGADLRVVQELLGHSDISTTQIYTHVLEERL 314

Query: 282 QKLVQDYHPLAKKEKKHY 299
           Q LV+ +HPLAK  K H 
Sbjct: 315 QILVETHHPLAKHRKNHD 332


>gi|254513968|ref|ZP_05126029.1| tyrosine recombinase XerD [gamma proteobacterium NOR5-3]
 gi|219676211|gb|EED32576.1| tyrosine recombinase XerD [gamma proteobacterium NOR5-3]
          Length = 302

 Score =  182 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 109/288 (37%), Positives = 160/288 (55%), Gaps = 8/288 (2%)

Query: 5   ERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQRRKIS 64
           E+  S NTL+AY+RDL+    + + +  S +  +   + +YL +L   K    S  R +S
Sbjct: 23  EKGLSENTLAAYRRDLQSFARWASTRNRSTTKVARTDIEAYLAYLLAHKRSPRSAARALS 82

Query: 65  VIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPAPGQW 124
            +R +Y  L   G  K++P+  L+ P+    LPKTL +  +  LL+   +E       + 
Sbjct: 83  CLRGYYRHLLRSGQLKEDPTLGLDSPRLGRPLPKTLSEADVDALLQAPNLE-------EL 135

Query: 125 KRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSALHALQ 184
              R   ++ELLYA G+RVSEL  L+   L+L +  + I GKG KERLV +   ALH LQ
Sbjct: 136 IGFRDRCMLELLYACGLRVSELTGLTVSQLSLNQGVVRISGKGGKERLVPVGEEALHWLQ 195

Query: 185 MYKKTCSSMKMTGNDLWLFPSSTKTGHLSRQVFARDLKALAARAGIQKKNISPHIIRHAF 244
            Y +      +      +   S +   ++RQ F   +K  A  AGI K  ISPH++RHAF
Sbjct: 196 RYLREIRPQLLGETSSEVLFPSRRAQMMTRQTFWHRIKQHAITAGIHKP-ISPHVLRHAF 254

Query: 245 ASHLLEGGADLRTIQILLGHTDISTTQIYTHLLPDKLQKLVQDYHPLA 292
           A+HL+  GADLR +Q+LLGH+D+STTQIYTH+   +LQ L   +HP  
Sbjct: 255 ATHLVNHGADLRVVQLLLGHSDLSTTQIYTHVARQRLQSLHAKHHPRG 302


>gi|239947482|ref|ZP_04699235.1| tyrosine recombinase XerD [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921758|gb|EER21782.1| tyrosine recombinase XerD [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 306

 Score =  182 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 115/303 (37%), Positives = 169/303 (55%), Gaps = 17/303 (5%)

Query: 1   MMSSERASSINTLSAYKRDLKEMQNFLNNKEISLSAASTNHLISYLNHLSQRKLVTSSQR 60
           M+ +ERA S N++ +YKRDL + QN+L  +++S    +T ++  ++ +L+   L   S  
Sbjct: 10  MLLAERALSKNSILSYKRDLFDFQNYLAKQKLSELNITTENVRDWIEYLATNDLQARSIN 69

Query: 61  RKISVIRQFYNFLCYEGLRKDNPSDTLELPKKNHILPKTLHKDTIANLLEQAKIEAENPA 120
           RKIS I+ +Y FL  E     NP   ++LPK  + LP+ L  D I +LLE    +     
Sbjct: 70  RKISTIKSYYEFLISENHIAFNPVLNVDLPKYQNKLPEILSIDQIKSLLEHCSQD----- 124

Query: 121 PGQWKRVRIFLLIELLYATGMRVSELVTLSAHTLNLTERTMIIQGKGNKERLVILSPSAL 180
               + +R+  +I LLYA+G+RVSELV+L    +   + +     K             +
Sbjct: 125 -NSPEGIRLNAMIHLLYASGLRVSELVSL