RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|255764500|ref|YP_003064987.2| hypothetical protein CLIBASIA_02305 [Candidatus Liberibacter asiaticus str. psy62] (200 letters) >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Score = 34.9 bits (79), Expect = 0.011 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 14/73 (19%) Query: 112 LAARDRYQKTNNEEAIASIIWH-----RYQHMDYKGKT-EQEKRALAKQSRDDFQRYATA 165 +A DR T E+I W R Q +D K EQE R AK+ +++ + + Sbjct: 74 IAQADRL--TQEPESIRK--WREEQRKRLQELDAASKVMEQEWREKAKKDLEEWNQRQSE 129 Query: 166 QAA----NQKAAD 174 Q N + AD Sbjct: 130 QVEKNKINNRIAD 142 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Score = 31.3 bits (70), Expect = 0.13 Identities = 24/89 (26%), Positives = 35/89 (39%), Gaps = 35/89 (39%) Query: 103 PTEAEKEKILAARDRYQKTNNEEAIASIIWHRYQHMDYKGKTEQEKRALAKQSRDDF--- 159 P+E + E +L +R ++ +NE E + RA +Q +DF Sbjct: 1279 PSEDQNEFLL---ERTREIHNE-------------------AESQLRAAQQQWGNDFYKR 1316 Query: 160 -QRYATAQAANQKAADMLMLATYGLQYDD 187 R A + A LATYGL DD Sbjct: 1317 DPRIAPLRGA---------LATYGLTIDD 1336 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 30.7 bits (68), Expect = 0.21 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 5/29 (17%) Query: 147 EKRALAK-QSRDDFQRYA--TAQAANQKA 172 EK+AL K Q+ + YA +A A KA Sbjct: 18 EKQALKKLQA--SLKLYADDSAPALAIKA 44 >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, acetylation, ATP-binding, calmodulin-binding, chaperone, cytoplasm; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 Score = 27.9 bits (61), Expect = 1.5 Identities = 16/83 (19%), Positives = 29/83 (34%), Gaps = 10/83 (12%) Query: 98 ENLRKPTEAEKEKILAARDRYQKTNNEEAIASIIWHRYQHMDYKGKTEQEKRALAKQSRD 157 E ++AEK K+ ++ ++ +E SI K K + LA Sbjct: 570 EYAPFASDAEKTKLQGMLNKAEEWLYDEGFDSI----------KAKYIAKYEELASLGNI 619 Query: 158 DFQRYATAQAANQKAADMLMLAT 180 RY + ++A A+ Sbjct: 620 IRGRYLAKEEEKKQAIRSKQEAS 642 >2nrk_A Hypothetical protein GRPB; UPF0157, PFAM04229, glutamate-rich protein, PSI-2, protein structure initiative; 1.65A {Enterococcus faecalis V583} SCOP: d.218.1.14 Length = 173 Score = 26.9 bits (59), Expect = 3.1 Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Query: 118 YQKTNNEEAIASIIWHRY--QHMDYKGKTEQEKRALAKQSRDDFQRYATAQAA 168 YQ N +E + + + Y ++ K+ LA+ D +Y + A Sbjct: 106 YQFDNTQEILRHLAFRNYLRENPAIATTYGTLKKQLAQAHPDSIDKYMDGKDA 158 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.311 0.129 0.370 Gapped Lambda K H 0.267 0.0475 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,677,992 Number of extensions: 71746 Number of successful extensions: 141 Number of sequences better than 10.0: 1 Number of HSP's gapped: 141 Number of HSP's successfully gapped: 12 Length of query: 200 Length of database: 5,693,230 Length adjustment: 88 Effective length of query: 112 Effective length of database: 3,559,758 Effective search space: 398692896 Effective search space used: 398692896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 54 (25.2 bits)