Query         gi|255764502|ref|YP_003064963.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 100
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 23785
Date          Tue May 31 20:22:45 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 255764502.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3enu_A Nitrollin, putative unc  18.6      20 0.00086   16.1   0.0   23   10-32     58-81  (114)
  2 2jwk_A Protein TOLR; periplasm  14.6      51  0.0021   13.9   1.2   16   72-87      3-18  (74)
  3 1nr3_A MTH0916, DNA-binding pr  13.2      69  0.0029   13.2   2.3   24   63-87     96-119 (122)
  4 2pfu_A Biopolymer transport EX  12.3      33  0.0014   14.9  -0.3   39   58-97      7-45  (99)
  5 2knc_B Integrin beta-3; transm  10.1      89  0.0037   12.6   3.1   34   28-61      1-34  (79)
  6 3kl4_B DPAP B, YSCV, signal pe   8.9      99  0.0042   12.4   2.2   17   39-57     15-31  (42)
  7 3bo0_B Preprotein translocase    8.3 1.1E+02  0.0044   12.2   1.6   34   34-67     29-63  (65)
  8 1z70_X C-alpha-formyglycine-ge   6.9      58  0.0024   13.6  -0.7   14   55-68     19-32  (311)
  9 2ek0_A Stage V sporulation pro   6.0 1.4E+02  0.0058   11.6   2.2   20   66-85     57-76  (90)
 10 1y4j_A Sulfatase modifying fac   5.6      77  0.0032   13.0  -0.7   14   55-68      4-17  (284)

No 1  
>3enu_A Nitrollin, putative uncharacterized protein; betagamma crystallin, structural protein; 1.86A {Nitrosospira multiformis} PDB: 3ent_A
Probab=18.60  E-value=20  Score=16.07  Aligned_cols=23  Identities=43%  Similarity=0.520  Sum_probs=18.1

Q ss_pred             HHHHHHHCCCCC-EEEEECCCCCC
Q ss_conf             899762133686-04897132132
Q gi|255764502|r   10 IRKIRSRSKGNR-NLTILDGRMNS   32 (100)
Q Consensus        10 irkirsrskgnr-nltildgrmns   32 (100)
                      -|||||-|-|.| ||+|.|..|-.
T Consensus        58 ~~~i~SV~VGPRA~L~i~~~~~~r   81 (114)
T 3enu_A           58 ENKVRSVKVGPRANLTIFDNHNYR   81 (114)
T ss_dssp             TTTCCEEEECTTEEEEEESSSTTC
T ss_pred             HHCCCEEEECCCCEEEEEECCCCC
T ss_conf             532634642686404885034433


No 2  
>2jwk_A Protein TOLR; periplasmic domain, membrane, inner membrane, protein transport, transmembrane, transport, membrane protein; NMR {Haemophilus influenzae} PDB: 2jwl_A
Probab=14.58  E-value=51  Score=13.94  Aligned_cols=16  Identities=19%  Similarity=0.534  Sum_probs=12.3

Q ss_pred             CEEEEEEECCCEEEEE
Q ss_conf             5079997037706960
Q gi|255764502|r   72 YPIMIDVKRDGEIRVQ   87 (100)
Q Consensus        72 ypimidvkrdgeirvq   87 (100)
                      -|+.|.+..+|.+.+.
T Consensus         3 ~P~ivsI~~~G~~~l~   18 (74)
T 2jwk_A            3 VPVILEVAGIGKYAIS   18 (74)
T ss_dssp             SCEEEEECSSSCEEEE
T ss_pred             CCEEEEECCCCCEEEE
T ss_conf             8999998389429996


No 3  
>1nr3_A MTH0916, DNA-binding protein TFX; northeast structural genomics consortium, reduced- dimensionality PSI; NMR {Methanothermobacterthermautotrophicus} SCOP: d.236.1.1
Probab=13.18  E-value=69  Score=13.22  Aligned_cols=24  Identities=38%  Similarity=0.371  Sum_probs=17.4

Q ss_pred             EEEEEECCCCEEEEEEECCCEEEEE
Q ss_conf             5674211115079997037706960
Q gi|255764502|r   63 FILGLDIKRYPIMIDVKRDGEIRVQ   87 (100)
Q Consensus        63 filgldikrypimidvkrdgeirvq   87 (100)
                      .+-|-- -+-|+-|.+.+||+++|.
T Consensus        96 ~i~~r~-vk~~~~I~v~~dG~i~V~  119 (122)
T 1nr3_A           96 RIVHRV-VKSDFEIGVTRDGEIIVD  119 (122)
T ss_dssp             SCCCCC-SSSCEEEEESSSSSEEEE
T ss_pred             HHCCCE-ECCCEEEEECCCCEEEEE
T ss_conf             642774-433369998479719997


No 4  
>2pfu_A Biopolymer transport EXBD protein; TONB system, proton motive force, periplasmic domain, transport protein; NMR {Escherichia coli K12}
Probab=12.26  E-value=33  Score=14.94  Aligned_cols=39  Identities=15%  Similarity=0.230  Sum_probs=24.9

Q ss_pred             HCCCCEEEEEECCCCEEEEEEECCCEEEEEHHHHHHHHHH
Q ss_conf             2021056742111150799970377069601566787775
Q gi|255764502|r   58 IPKAEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEIT   97 (100)
Q Consensus        58 ipkaefilgldikrypimidvkrdgeirvqgqqvllneit   97 (100)
                      .|++..-- ..-..-|+.|.+..||.+.+.++.+-+.++.
T Consensus         7 LP~a~~~~-~~~~~~~i~I~I~~dG~i~i~~~~v~~~~L~   45 (99)
T 2pfu_A            7 LPASTSTP-QPRPEKPVYLSVKADNSMFIGNDPVTDETMI   45 (99)
T ss_dssp             CCCCCCCC-CCCCCCCCEEEEETTTEEEETTEEECSSSHH
T ss_pred             CCCCCCCC-CCCCCCCEEEEEECCCCEEECCCCCCHHHHH
T ss_conf             89887877-8899976899994699799876034489999


No 5  
>2knc_B Integrin beta-3; transmembrane signaling, coiled coil, protein structure, alternative splicing, calcium, cell adhesion; NMR {Homo sapiens}
Probab=10.06  E-value=89  Score=12.64  Aligned_cols=34  Identities=35%  Similarity=0.336  Sum_probs=20.7

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             3213200121059999999999996798872021
Q gi|255764502|r   28 GRMNSELQSTSLVGLVLVLFIILIGTVMVLIPKA   61 (100)
Q Consensus        28 grmnselqstslvglvlvlfiiligtvmvlipka   61 (100)
                      |.|.|+-...-.+-+-.+.-|+|||-+..++=|.
T Consensus         1 ~~~~~~~pni~~Ivlgvi~~IvliGl~~LliwKl   34 (79)
T 2knc_B            1 GAMGSKGPDILVVLLSVMGAILLIGLAALLIWKL   34 (79)
T ss_dssp             CCSSCSSSCSHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9888899894339999999999999999999999


No 6  
>3kl4_B DPAP B, YSCV, signal peptide of yeast dipeptidyl aminopeptidase; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Saccharomyces cerevisiae}
Probab=8.91  E-value=99  Score=12.39  Aligned_cols=17  Identities=59%  Similarity=0.987  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             5999999999999679887
Q gi|255764502|r   39 LVGLVLVLFIILIGTVMVL   57 (100)
Q Consensus        39 lvglvlvlfiiligtvmvl   57 (100)
                      -||..|||.|  -|||..|
T Consensus        15 rvgiilvlli--wgtvlll   31 (42)
T 3kl4_B           15 RVGIILVLLI--WGTVLLL   31 (42)
T ss_pred             HHHHHHHHHH--HHHHHHH
T ss_conf             6716686899--8799998


No 7  
>3bo0_B Preprotein translocase SECE subunit; ribosome-SECY complex, protein translocation; 9.60A {Escherichia coli} PDB: 3bo1_B 3kcr_B
Probab=8.26  E-value=1.1e+02  Score=12.23  Aligned_cols=34  Identities=29%  Similarity=0.323  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEE
Q ss_conf             012105999999999999679887202-1056742
Q gi|255764502|r   34 LQSTSLVGLVLVLFIILIGTVMVLIPK-AEFILGL   67 (100)
Q Consensus        34 lqstslvglvlvlfiiligtvmvlipk-aefilgl   67 (100)
                      .|+|-.|=.+..++.+++|-+-.++-. ..|++|+
T Consensus        29 ~~~T~vVi~~~ii~~~~~~~~D~~~~~~~~~i~gl   63 (65)
T 3bo0_B           29 KDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGI   63 (65)
T ss_dssp             TTHHHHHHHHHHHHHHHHHHHHHHHTTTTHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             75888888899999999999999999999999751


No 8  
>1z70_X C-alpha-formyglycine-generating enzyme; formylglycine, multiple sulfatase deficiency, cysteine sulfenic acid, oxidoreductase; HET: OCS NAG CXS; 1.15A {Homo sapiens} SCOP: d.169.1.7 PDB: 1y1f_X* 1y1e_X* 1y1h_X* 1y1i_X* 1y1g_X* 1y1j_X* 2aii_X* 2aij_X* 2aft_X* 2aik_X* 2hi8_X* 2hib_X* 2afy_X*
Probab=6.87  E-value=58  Score=13.63  Aligned_cols=14  Identities=50%  Similarity=0.819  Sum_probs=0.0

Q ss_pred             HHHHCCCCEEEEEE
Q ss_conf             88720210567421
Q gi|255764502|r   55 MVLIPKAEFILGLD   68 (100)
Q Consensus        55 mvlipkaefilgld   68 (100)
                      ||+||...|.+|-+
T Consensus        19 mV~Ip~G~f~mG~~   32 (311)
T 1z70_X           19 MVPIPAGVFTMGTD   32 (311)
T ss_dssp             EEEECCEEEEESCS
T ss_pred             CEEECCCEEEECCC
T ss_conf             46967937871899


No 9  
>2ek0_A Stage V sporulation protein S (spovs) related protein; structural genomics, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2eh1_A
Probab=6.00  E-value=1.4e+02  Score=11.60  Aligned_cols=20  Identities=25%  Similarity=0.461  Sum_probs=0.0

Q ss_pred             EEECCCCEEEEEEECCCEEE
Q ss_conf             42111150799970377069
Q gi|255764502|r   66 GLDIKRYPIMIDVKRDGEIR   85 (100)
Q Consensus        66 gldikrypimidvkrdgeir   85 (100)
                      |+|+.--|-..|+.-|||-|
T Consensus        57 giDl~~~PaF~~v~idge~r   76 (90)
T 2ek0_A           57 NLDLVVKPAFVKLELENEER   76 (90)
T ss_dssp             TEEEEEEEEEEEEEETTEEE
T ss_pred             CCEEEEEECEEEEEECCEEE
T ss_conf             85599950469996688788


No 10 
>1y4j_A Sulfatase modifying factor 2; formylglycine, sulfatases, multiple sulfatase deficiency, homodimer, DUF323, sugar binding protein; HET: NAG FUC; 1.86A {Homo sapiens} SCOP: d.169.1.7
Probab=5.59  E-value=77  Score=12.97  Aligned_cols=14  Identities=29%  Similarity=0.681  Sum_probs=0.0

Q ss_pred             HHHHCCCCEEEEEE
Q ss_conf             88720210567421
Q gi|255764502|r   55 MVLIPKAEFILGLD   68 (100)
Q Consensus        55 mvlipkaefilgld   68 (100)
                      ||.||-.+|++|-+
T Consensus         4 mV~IpgG~f~~G~~   17 (284)
T 1y4j_A            4 MVQLQGGRFLMGTN   17 (284)
T ss_dssp             EEEECCEEEEESCC
T ss_pred             CCEECCEEEECCCC
T ss_conf             73889908874799


Done!