BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|255764502|ref|YP_003064963.2| hypothetical protein
CLIBASIA_02185 [Candidatus Liberibacter asiaticus str. psy62]
         (100 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|255764502|ref|YP_003064963.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254547853|gb|ACT57023.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 100

 Score =  193 bits (490), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 100/100 (100%), Positives = 100/100 (100%)

Query: 1   MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK 60
           MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK
Sbjct: 1   MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK 60

Query: 61  AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI 100
           AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI
Sbjct: 61  AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI 100


>gi|117923784|ref|YP_864401.1| biopolymer transporter ExbD/TolR [Magnetococcus sp. MC-1]
 gi|117607540|gb|ABK42995.1| Cell division and transport-associated protein TolR [Magnetococcus
           sp. MC-1]
          Length = 141

 Score = 34.3 bits (77), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 32  SELQSTSLVGLVLVLFIILIGTVMVLIPKAEFIL------GLDIKRYPIMIDVKRDGEIR 85
           S++  T LV ++LVL II + T  +L    E  L       +  +  P+ I V  DG   
Sbjct: 19  SDINVTPLVDIMLVLLIIFMVTAPLLTHGIEVELPHVQSDAITAQVEPLTISVSPDGSAS 78

Query: 86  VQGQQVLLNEITKKI 100
           ++G+++ L+E+T K+
Sbjct: 79  IEGERMSLSEMTDKV 93


>gi|294056513|ref|YP_003550171.1| MscS Mechanosensitive ion channel [Coraliomargarita akajimensis DSM
           45221]
 gi|293615846|gb|ADE56001.1| MscS Mechanosensitive ion channel [Coraliomargarita akajimensis DSM
           45221]
          Length = 531

 Score = 33.5 bits (75), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 10  IRKIRSRSKGNRNLTILDGR----MNSELQSTSLVGLVLVLFIILIGTVMVLIP 59
           +R + ++ KG   L  LDG     MN  L      GLVL +FII I  V+   P
Sbjct: 177 LRYVEAKFKGKEMLKFLDGDSVVMMNENLMKVLRSGLVLAIFIIYIDVVLSFFP 230


Searching..................................................done


Results from round 2





CONVERGED!
>gi|255764502|ref|YP_003064963.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254547853|gb|ACT57023.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 100

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 100/100 (100%), Positives = 100/100 (100%)

Query: 1   MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK 60
           MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK
Sbjct: 1   MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK 60

Query: 61  AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI 100
           AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI
Sbjct: 61  AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI 100


>gi|117923784|ref|YP_864401.1| biopolymer transporter ExbD/TolR [Magnetococcus sp. MC-1]
 gi|117607540|gb|ABK42995.1| Cell division and transport-associated protein TolR [Magnetococcus
           sp. MC-1]
          Length = 141

 Score = 35.3 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 32  SELQSTSLVGLVLVLFIILIGTVMVLIPKAEFIL------GLDIKRYPIMIDVKRDGEIR 85
           S++  T LV ++LVL II + T  +L    E  L       +  +  P+ I V  DG   
Sbjct: 19  SDINVTPLVDIMLVLLIIFMVTAPLLTHGIEVELPHVQSDAITAQVEPLTISVSPDGSAS 78

Query: 86  VQGQQVLLNEITKKI 100
           ++G+++ L+E+T K+
Sbjct: 79  IEGERMSLSEMTDKV 93


>gi|294056513|ref|YP_003550171.1| MscS Mechanosensitive ion channel [Coraliomargarita akajimensis DSM
           45221]
 gi|293615846|gb|ADE56001.1| MscS Mechanosensitive ion channel [Coraliomargarita akajimensis DSM
           45221]
          Length = 531

 Score = 34.2 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 10  IRKIRSRSKGNRNLTILDG----RMNSELQSTSLVGLVLVLFIILIGTVMVLIP 59
           +R + ++ KG   L  LDG     MN  L      GLVL +FII I  V+   P
Sbjct: 177 LRYVEAKFKGKEMLKFLDGDSVVMMNENLMKVLRSGLVLAIFIIYIDVVLSFFP 230


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.325    0.144    0.380 

Lambda     K      H
   0.267   0.0478    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,835,731,315
Number of Sequences: 14124377
Number of extensions: 70834476
Number of successful extensions: 251795
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 38
Number of HSP's that attempted gapping in prelim test: 251771
Number of HSP's gapped (non-prelim): 43
length of query: 100
length of database: 4,842,793,630
effective HSP length: 69
effective length of query: 31
effective length of database: 3,868,211,617
effective search space: 119914560127
effective search space used: 119914560127
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 76 (33.7 bits)