BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|255764502|ref|YP_003064963.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter asiaticus str. psy62] (100 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|255764502|ref|YP_003064963.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter asiaticus str. psy62] gi|254547853|gb|ACT57023.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter asiaticus str. psy62] Length = 100 Score = 161 bits (408), Expect = 3e-38, Method: Composition-based stats. Identities = 100/100 (100%), Positives = 100/100 (100%) Query: 1 MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK 60 MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK Sbjct: 1 MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK 60 Query: 61 AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI 100 AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI Sbjct: 61 AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI 100 >gi|117923784|ref|YP_864401.1| biopolymer transporter ExbD/TolR [Magnetococcus sp. MC-1] gi|117607540|gb|ABK42995.1| Cell division and transport-associated protein TolR [Magnetococcus sp. MC-1] Length = 141 Score = 35.3 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 6/75 (8%) Query: 32 SELQSTSLVGLVLVLFIILIGTVMVLIPKAEFIL------GLDIKRYPIMIDVKRDGEIR 85 S++ T LV ++LVL II + T +L E L + + P+ I V DG Sbjct: 19 SDINVTPLVDIMLVLLIIFMVTAPLLTHGIEVELPHVQSDAITAQVEPLTISVSPDGSAS 78 Query: 86 VQGQQVLLNEITKKI 100 ++G+++ L+E+T K+ Sbjct: 79 IEGERMSLSEMTDKV 93 >gi|294056513|ref|YP_003550171.1| MscS Mechanosensitive ion channel [Coraliomargarita akajimensis DSM 45221] gi|293615846|gb|ADE56001.1| MscS Mechanosensitive ion channel [Coraliomargarita akajimensis DSM 45221] Length = 531 Score = 34.2 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Query: 10 IRKIRSRSKGNRNLTILDG----RMNSELQSTSLVGLVLVLFIILIGTVMVLIP 59 +R + ++ KG L LDG MN L GLVL +FII I V+ P Sbjct: 177 LRYVEAKFKGKEMLKFLDGDSVVMMNENLMKVLRSGLVLAIFIIYIDVVLSFFP 230 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.325 0.144 0.380 Lambda K H 0.267 0.0478 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,069,939,261 Number of Sequences: 14124377 Number of extensions: 45553987 Number of successful extensions: 147212 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 21 Number of HSP's that attempted gapping in prelim test: 147198 Number of HSP's gapped (non-prelim): 23 length of query: 100 length of database: 4,842,793,630 effective HSP length: 69 effective length of query: 31 effective length of database: 3,868,211,617 effective search space: 119914560127 effective search space used: 119914560127 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 76 (33.7 bits)