RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|255764502|ref|YP_003064963.2| hypothetical protein
CLIBASIA_02185 [Candidatus Liberibacter asiaticus str. psy62]
         (100 letters)



>3d23_B 3C-like proteinase; main protease, ATP-binding, cytoplasm,
           endonuclease, exonuclease, helicase, hydrolase,
           membrane, metal-binding; HET: 3IH; 2.50A {Human
           coronavirus HKU1} (B:1-190)
          Length = 190

 Score = 24.8 bits (54), Expect = 4.8
 Identities = 13/45 (28%), Positives = 19/45 (42%), Gaps = 3/45 (6%)

Query: 20  NRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPKAEFI 64
             + TI+ GRM+  + S  + G  LVL    +       PK  F 
Sbjct: 65  LGDFTIMSGRMSLTVVSYQMQGCQLVL---TVSLQNPYTPKYTFG 106


>2zu2_A 3C-like proteinase; protease-inhibitor complex, cytoplasm,
           hydrolase, membrane, metal-binding, protease, ribosomal
           frameshifting; 1.80A {Human coronavirus 229E} PDB:
           1p9s_A (A:1-190)
          Length = 190

 Score = 24.0 bits (52), Expect = 6.9
 Identities = 7/48 (14%), Positives = 17/48 (35%), Gaps = 3/48 (6%)

Query: 17  SKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPKAEFI 64
                N +I+ G     +   ++ G+ L +    +    +  P+  F 
Sbjct: 59  IMRLHNFSIISGTAFLGVVGATMHGVTLKI---KVSQTNMHTPRHSFR 103


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.325    0.144    0.380 

Gapped
Lambda     K      H
   0.267   0.0640    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 674,653
Number of extensions: 25102
Number of successful extensions: 67
Number of sequences better than 10.0: 1
Number of HSP's gapped: 67
Number of HSP's successfully gapped: 5
Length of query: 100
Length of database: 4,956,049
Length adjustment: 59
Effective length of query: 41
Effective length of database: 2,961,554
Effective search space: 121423714
Effective search space used: 121423714
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.2 bits)