RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|255764502|ref|YP_003064963.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter asiaticus str. psy62] (100 letters) >d2duca1 b.47.1.4 (A:2-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]} Length = 300 Score = 25.2 bits (55), Expect = 1.7 Identities = 6/30 (20%), Positives = 12/30 (40%) Query: 17 SKGNRNLTILDGRMNSELQSTSLVGLVLVL 46 K N + + G + + S+ +L L Sbjct: 59 RKSNHSFLVQAGNVQLRVIGHSMQNCLLRL 88 >d1p9sa_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus 229E [TaxId: 11137]} Length = 300 Score = 25.2 bits (55), Expect = 1.8 Identities = 5/30 (16%), Positives = 12/30 (40%) Query: 17 SKGNRNLTILDGRMNSELQSTSLVGLVLVL 46 N +I+ G + ++ G+ L + Sbjct: 59 IMRLHNFSIISGTAFLGVVGATMHGVTLKI 88 >d1lvoa_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Transmissible gastroenteritis virus [TaxId: 11149]} Length = 299 Score = 24.0 bits (52), Expect = 4.0 Identities = 10/48 (20%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Query: 17 SKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPKAEFI 64 S N ++ + + S G+ LVL + V P+ +F Sbjct: 59 SVRLHNFSVSKNNVFLGVVSARYKGVNLVL---KVNQVNPNTPEHKFK 103 >d1h3ga2 b.71.1.1 (A:518-600) Cyclomaltodextrinase {Flavobacterium sp. 92 [TaxId: 197856]} Length = 83 Score = 23.1 bits (50), Expect = 7.1 Identities = 9/43 (20%), Positives = 17/43 (39%) Query: 53 TVMVLIPKAEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNE 95 +MV + + + L R+ M+ G + G+ V L Sbjct: 22 RIMVAMNNNDKPMTLPTARFQEMLKGAPSGVDFLSGKTVGLGR 64 >d2bs2c1 f.21.2.1 (C:1-254) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]} Length = 254 Score = 23.0 bits (49), Expect = 7.1 Identities = 8/28 (28%), Positives = 12/28 (42%), Gaps = 2/28 (7%) Query: 38 SLVGLVLVLFII--LIGTVMVLIPKAEF 63 S GL L LF+I + +L+ Sbjct: 31 SATGLFLGLFMIGHMFFVSTILLGDNVM 58 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.325 0.144 0.380 Gapped Lambda K H 0.267 0.0624 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 336,907 Number of extensions: 13269 Number of successful extensions: 36 Number of sequences better than 10.0: 1 Number of HSP's gapped: 36 Number of HSP's successfully gapped: 9 Length of query: 100 Length of database: 2,407,596 Length adjustment: 62 Effective length of query: 38 Effective length of database: 1,556,336 Effective search space: 59140768 Effective search space used: 59140768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 47 (22.1 bits)