BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764502|ref|YP_003064963.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter asiaticus str. psy62] (100 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764502|ref|YP_003064963.2| hypothetical protein CLIBASIA_02185 [Candidatus Liberibacter asiaticus str. psy62] Length = 100 Score = 193 bits (490), Expect = 6e-52, Method: Compositional matrix adjust. Identities = 100/100 (100%), Positives = 100/100 (100%) Query: 1 MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK 60 MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK Sbjct: 1 MMNIRSQEGIRKIRSRSKGNRNLTILDGRMNSELQSTSLVGLVLVLFIILIGTVMVLIPK 60 Query: 61 AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI 100 AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI Sbjct: 61 AEFILGLDIKRYPIMIDVKRDGEIRVQGQQVLLNEITKKI 100 >gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 21.2 bits (43), Expect = 3.7, Method: Composition-based stats. Identities = 8/17 (47%), Positives = 11/17 (64%) Query: 12 KIRSRSKGNRNLTILDG 28 KIR + G +N T+ DG Sbjct: 45 KIRESAVGRKNFTLHDG 61 >gi|254781112|ref|YP_003065525.1| putative amino acid-binding periplasmic ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 274 Score = 21.2 bits (43), Expect = 4.2, Method: Compositional matrix adjust. Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 8/38 (21%) Query: 64 ILGLDIKRYPIMIDV--------KRDGEIRVQGQQVLL 93 I GLD RY ++++V K D I +VLL Sbjct: 95 ITGLDTNRYDVLVNVAITPERQKKYDFSIPYIAHRVLL 132 >gi|254780458|ref|YP_003064871.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 449 Score = 21.2 bits (43), Expect = 4.6, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 15/29 (51%) Query: 4 IRSQEGIRKIRSRSKGNRNLTILDGRMNS 32 I S E I IR R + +TI D R+ S Sbjct: 295 IESGENIADIRVRFSKIKGITISDNRLRS 323 >gi|254780697|ref|YP_003065110.1| large conductance mechanosensitive channel protein [Candidatus Liberibacter asiaticus str. psy62] Length = 141 Score = 20.4 bits (41), Expect = 6.3, Method: Compositional matrix adjust. Identities = 11/16 (68%), Positives = 11/16 (68%) Query: 43 VLVLFIILIGTVMVLI 58 VLV F IL G V VLI Sbjct: 93 VLVNFFILAGVVFVLI 108 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.144 0.380 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,346 Number of Sequences: 1233 Number of extensions: 1987 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 100 length of database: 328,796 effective HSP length: 61 effective length of query: 39 effective length of database: 253,583 effective search space: 9889737 effective search space used: 9889737 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 32 (16.9 bits)