RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} (A:1-192,A:307-327) Length = 213 Score = 43.3 bits (101), Expect = 1e-05 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Query: 1 MKACDFGVPQRRERLYIIDFLN--PSVEFKFPTPLGIKPR 38 + A D+G+PQ+RER+Y+I F N F+FP P + Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTF 191 >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* (B:182-386) Length = 205 Score = 43.3 bits (101), Expect = 1e-05 Identities = 6/75 (8%), Positives = 10/75 (13%), Gaps = 7/75 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPR--LGDILE--EHIDDKSTISNK 56 + G Q R++ S + N Sbjct: 128 IPDVHGGSLQNAVRVWSNIPAIRS-RHWALVSEEELSLLAQNKQSSKLAAKWPTKLVKNC 186 Query: 57 LWEGH--QKRKENNK 69 K Sbjct: 187 FLPLREYFKYFSTEL 201 >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural genomics, protein structure initiative, PSI; 1.75A {Escherichia coli O157} (A:1-188,A:352-376) Length = 213 Score = 42.6 bits (99), Expect = 2e-05 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG 60 +KA D+G P R R + I S++ + + + I+ E+I + N L EG Sbjct: 151 VKASDYGAPTIRTRYFFIGVK-KSLKLDISDEVFMPKMISPIVAEYI--LKGLYNLLNEG 207 Query: 61 HQ 62 H Sbjct: 208 HH 209 >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} (A:1-202,A:296-343) Length = 250 Score = 41.7 bits (97), Expect = 4e-05 Identities = 11/56 (19%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Query: 1 MKACDFGVPQRRERLYIIDFLNP-SVEFKFPTP-LGIKPRLGDILEEHIDDKSTIS 54 + G+P R R ++I L + F+ P L P++ + D +++ Sbjct: 148 LSPTSLGIPNSRLRYFLIAKLQSEPLPFQAPGQVLMEFPKIEIHRKNQQDSDLSVT 203 >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} (A:1-192,A:277-295) Length = 211 Score = 36.4 bits (83), Expect = 0.001 Identities = 4/35 (11%), Positives = 10/35 (28%), Gaps = 3/35 (8%) Query: 1 MKACDFGVPQRRERLY--IIDFLNPSVEFKFPTPL 33 + A + R + + P + P+ Sbjct: 163 IDAKEVSAAHRARYFWGNLPGMNRP-LASTVSVPV 196 >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} (B:1-177) Length = 177 Score = 34.3 bits (78), Expect = 0.006 Identities = 1/20 (5%), Positives = 3/20 (15%) Query: 3 ACDFGVPQRRERLYIIDFLN 22 G + + Sbjct: 154 PDVHGGSLQNAVRVWSNIPA 173 >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} (A:193-274) Length = 82 Score = 30.0 bits (68), Expect = 0.12 Identities = 7/39 (17%), Positives = 12/39 (30%), Gaps = 1/39 (2%) Query: 5 DFGVPQRRERLYIIDFLNP-SVEFKFPTPLGIKPRLGDI 42 D +P +ID + + RLG + Sbjct: 2 DLLLPDSEVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIV 40 >1uhr_A SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily...; structural genomics, chromatin remodeling; NMR {Mus musculus} (A:1-47) Length = 47 Score = 26.5 bits (59), Expect = 1.2 Identities = 9/31 (29%), Positives = 13/31 (41%) Query: 29 FPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 P + PRL +L H + I LW+ Sbjct: 8 QPPQFKLDPRLARLLGIHTQTRPVIIQALWQ 38 >3bfq_G Protein FIMG; incomplete IG-like fold, donor strand exchange, cell projection, fimbrium, cell adhesion; 1.34A {Escherichia coli str} PDB: 3bfw_A (G:) Length = 132 Score = 25.0 bits (54), Expect = 3.9 Identities = 3/42 (7%), Positives = 12/42 (28%), Gaps = 2/42 (4%) Query: 62 QKRKENNKIAGKGFGYGLFFENSATTNTL--SARYYKDGSEI 101 + + ++ G + ++S+ + R Sbjct: 75 ELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGA 116 >2nys_A AGR_C_3712P; SSPB, stringent starvation protein B, NESG, ATR88, structural genomics, PSI-2, protein structure initiative; 2.70A {Agrobacterium tumefaciens str} (A:) Length = 176 Score = 24.4 bits (53), Expect = 5.1 Identities = 15/71 (21%), Positives = 31/71 (43%), Gaps = 12/71 (16%) Query: 7 GVPQRRERLY-----IIDFLNPSVEF--KFPTPLGIKPRL--GDILEEHIDDKSTISNKL 57 P E+L I F +PSV F +F PL + +I + ++ +++ Sbjct: 90 DTP---EKLVIPYNAIRGFYDPSVNFELEFDVPLAKEEEXEEAEITAYPVSHEAKPASET 146 Query: 58 WEGHQKRKENN 68 + +++KE + Sbjct: 147 PKSGEEKKEGS 157 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 24.5 bits (53), Expect = 5.2 Identities = 13/98 (13%), Positives = 24/98 (24%), Gaps = 39/98 (39%) Query: 28 KFPTPL--------GIKPRLGDI----------LEEHIDDKSTISNKLWEGHQKRKENNK 69 K+ +P + R I L+ ++ + E +R Sbjct: 18 KYASPNLNMKYRKRQLVTREAQIKDWVENELEALKLEAEEIPSEDQN--EFLLERTR--- 72 Query: 70 IAGKGFGYGLFFENSATTNTLSARY------YKDGSEI 101 N A + +A+ YK I Sbjct: 73 ----------EIHNEAESQLRAAQQQWGNDFYKRDPRI 100 >1v31_A Hypothetical protein RAFL11-05-P19; SWI/SNF complex subunit, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} (A:) Length = 93 Score = 24.3 bits (53), Expect = 6.2 Identities = 6/31 (19%), Positives = 12/31 (38%) Query: 29 FPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 P + L D+L ++ + I +W Sbjct: 8 VPEKFKLSTALMDVLGIEVETRPRIIAAIWH 38 >1c96_A Mitochondrial aconitase; lyase, tricarboxylic acid cycle, iron-sulfur, mitochondrion, transit peptide, 4Fe-4S, 3D-structure; HET: FLC; 1.81A {Bos taurus} (A:1-198,A:495-534) Length = 238 Score = 23.8 bits (51), Expect = 7.7 Identities = 9/43 (20%), Positives = 18/43 (41%) Query: 32 PLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKENNKIAGKG 74 + + DI+ + ++ T+S K+ GH N +I Sbjct: 16 RYDLLEKNIDIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGK 58 >1jb0_B Photosystem I P700 chlorophyll A apoprotein A2; membrane protein, multiprotein-pigment complex, photosynthesis; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} (B:294-629) Length = 336 Score = 23.7 bits (51), Expect = 8.5 Identities = 4/29 (13%), Positives = 11/29 (37%) Query: 34 GIKPRLGDILEEHIDDKSTISNKLWEGHQ 62 GI + ++++ + + HQ Sbjct: 2 GIGHSIKEMMDAKDFFGTKVEGPFNMPHQ 30 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.318 0.139 0.419 Gapped Lambda K H 0.267 0.0609 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 811,372 Number of extensions: 33331 Number of successful extensions: 65 Number of sequences better than 10.0: 1 Number of HSP's gapped: 65 Number of HSP's successfully gapped: 18 Length of query: 101 Length of database: 4,956,049 Length adjustment: 59 Effective length of query: 42 Effective length of database: 2,961,554 Effective search space: 124385268 Effective search space used: 124385268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.3 bits)