RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|255764504|ref|YP_003064930.2| DNA-methyltransferase MKpn2kI [Candidatus Liberibacter asiaticus str. psy62] (101 letters) >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 Score = 26.9 bits (58), Expect = 0.55 Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 10/111 (9%) Query: 1 MKACDFGVPQRRERLYIIDFLNPSV--EFKFPTPLGIKPRLGDILEEHIDDKSTISN--- 55 + A D+G+PQ+RER+Y+I F N F+FP P + + D+L + + + + Sbjct: 152 LNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDSEVEHLVIDRKD 211 Query: 56 -----KLWEGHQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI 101 + E + I GKG + TLSA ++ Sbjct: 212 LVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITLSAYGGGIFAKT 262 >d1uhra_ a.42.1.1 (A:) SWI/SNF related regulator of chromatin (BRG1-associated factor 60a) {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 Score = 24.3 bits (53), Expect = 3.0 Identities = 9/31 (29%), Positives = 13/31 (41%) Query: 29 FPTPLGIKPRLGDILEEHIDDKSTISNKLWE 59 P + PRL +L H + I LW+ Sbjct: 8 QPPQFKLDPRLARLLGIHTQTRPVIIQALWQ 38 >d1jb0b_ f.29.1.1 (B:) Apoprotein a2, PsaB {Synechococcus elongatus [TaxId: 32046]} Length = 739 Score = 23.3 bits (50), Expect = 6.2 Identities = 5/32 (15%), Positives = 12/32 (37%) Query: 31 TPLGIKPRLGDILEEHIDDKSTISNKLWEGHQ 62 T GI + ++++ + + HQ Sbjct: 292 TQFGIGHSIKEMMDAKDFFGTKVEGPFNMPHQ 323 >d1dcsa_ b.82.2.1 (A:) Deacetoxycephalosporin C synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 311 Score = 23.0 bits (48), Expect = 6.7 Identities = 9/34 (26%), Positives = 14/34 (41%) Query: 12 RERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEE 45 R + FL P+ +F F PL + L+ Sbjct: 256 SSRTSSVFFLRPNADFTFSVPLARECGFDVSLDG 289 >d1tjna_ c.92.1.3 (A:) Sirohydrochlorin cobaltochelatase CbiX {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 125 Score = 23.0 bits (49), Expect = 6.8 Identities = 2/25 (8%), Positives = 7/25 (28%) Query: 23 PSVEFKFPTPLGIKPRLGDILEEHI 47 + P+G + + + Sbjct: 97 EGKKVVICEPIGEDYFVTYAILNSV 121 >d2c6ja1 a.264.1.1 (A:15-308) Duffy receptor, alpha form {Plasmodium knowlesi [TaxId: 5850]} Length = 294 Score = 23.1 bits (49), Expect = 7.9 Identities = 7/61 (11%), Positives = 22/61 (36%) Query: 8 VPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEGHQKRKEN 67 + RR +L + + N + + I ++ + + D + + L + + + Sbjct: 23 ISDRRYQLCMKELTNLVNNTRTHSHNDITFLKLNLKRKLMYDAAVEGDLLLKKNNYQYNK 82 Query: 68 N 68 Sbjct: 83 E 83 >d1q15a1 c.26.2.1 (A:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]} Length = 296 Score = 22.6 bits (47), Expect = 8.9 Identities = 3/42 (7%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Query: 29 FPTPLGIKPRLGDILEEHIDDKST---ISNKLWEGHQKRKEN 67 + ++L +D+ T + ++++ + + + Sbjct: 241 IHEGSSVNQAFANVLGSTVDNYQTKSRFTYRVYQAFLRGRLS 282 >d2hg6a1 d.364.1.1 (A:1-106) Hypothetical protein PA1123 {Pseudomonas aeruginosa [TaxId: 287]} Length = 106 Score = 22.6 bits (48), Expect = 9.0 Identities = 6/22 (27%), Positives = 14/22 (63%) Query: 36 KPRLGDILEEHIDDKSTISNKL 57 + +L +LE++I+++ I L Sbjct: 66 REQLQILLEQNINERLNIGEPL 87 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.139 0.419 Gapped Lambda K H 0.267 0.0724 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 397,011 Number of extensions: 16765 Number of successful extensions: 33 Number of sequences better than 10.0: 1 Number of HSP's gapped: 33 Number of HSP's successfully gapped: 9 Length of query: 101 Length of database: 2,407,596 Length adjustment: 62 Effective length of query: 39 Effective length of database: 1,556,336 Effective search space: 60697104 Effective search space used: 60697104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (21.9 bits)