>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.

Probab=98.27 E-value=2.8e-06 Score=66.06 Aligned_cols=54 Identities=20% Similarity=0.374 Sum_probs=50.1 Q ss_pred HHHHHHHCCCCCCEEEEEHHHHHHHHHHHHCCCCCEEEECCCCCEEEEEEECCCHH Q ss_conf 33333210475430551002388889874104662000000432323241234035 Q gi|255764505|r 218 VCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIF 273 (341) Q Consensus 218 l~V~DiM~~~~~ip~V~~~~si~eal~~m~~~~~g~v~Vvd~~~~liGIITdgDlr 273 (341) T Consensus 58 ~~v~~im~~--~~~~i~~~~~~~~a~~~m~~~~i~~lPVvd~~~~lvGiit~~Dll 111 (113) T cd04607 58 DPVSEVMNR--NPITAKVGSSREEILALMRERSIRHLPILDEEGRVVGLATLDDLL 111 (113) T ss_pred CCHHHHHCC--EEEEEECCCCHHHHHHHHHHCCCCEEEEECCCCEEEEEEEHHHHH T ss_conf 615675212--129998799899999999877974999997899499999979930

HHsearch alignment for GI: 255764505 and conserved domain: cd04607