>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=99.82 E-value=9.4e-20 Score=164.15 Aligned_cols=109 Identities=30% Similarity=0.470 Sum_probs=101.7 Q ss_pred CCEEEEEHHHHHHHHHHHHCCCCCEEEECCCCCEEEEEEECCCHHHHHHC---CCCCCCHHHHCCCCCEEECCCCCHHHH Q ss_conf 43055100238888987410466200000043232324123403567617---823370988348897897799878999 Q gi|255764505|r 229 SIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNFHK---DLNTLSVEDVMIKNPKVILEDTLLTVA 305 (341) Q Consensus 229 ~ip~V~~~~si~eal~~m~~~~~g~v~Vvd~~~~liGIITdgDlrR~l~~---~~~~~~v~~iMt~~p~~I~~d~~i~eA 305 (341) T Consensus 2 ~vvti~~~~tl~ea~~~m~~~~~~~l~Vvd~~~~l~Giit~~Di~~~~~~~~~~~~~~~V~~iM~~~~~~v~~~~~l~~a 81 (113) T cd04623 2 DVITVRPDATVAEAAKLMAEKNIGAVVVVDDGGRLVGIFSERDIVRKVALRGASALDTPVSEIMTRNVITVTPDDTVDEA 81 (113) T ss_pred CCEEECCCCCHHHHHHHHHHCCCCEEEEECCCCCEEEEEEHHHHHHHHHHCCCCHHHCHHHHHCCCEEEEEECCCCHHHH T ss_conf 97696893979999999997399889999089829999976899999986499846640123121102899169919999 Q ss_pred HHHHHHCCCCEEEEEECCCEEEEEEEHHHHHHC Q ss_conf 999996799589998069848999858889743 Q gi|255764505|r 306 MQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRF 338 (341) Q Consensus 306 l~lM~~~kI~~LpVVD~~~~lvGiIt~~DLlka 338 (341) T Consensus 82 ~~~m~~~~i~~lpV~d~-~~lvGiit~~Dllra 113 (113) T cd04623 82 MALMTERRFRHLPVVDG-GKLVGIVSIGDVVKA 113 (113) T ss_pred HHHHHHCCCEEEEEEEC-CEEEEEEEHHHHHCC T ss_conf 99999769259999999-999999997996469

HHsearch alignment for GI: 255764505 and conserved domain: cd04623