>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=99.79 E-value=1.4e-18 Score=155.59 Aligned_cols=109 Identities=21% Similarity=0.272 Sum_probs=104.6 Q ss_pred CCEEEEEHHHHHHHHHHHHCCCCCEEEECCCCCEEEEEEECCCHHHHHHCCCCCCCHHHHCCCCCEEECCCCCHHHHHHH Q ss_conf 43055100238888987410466200000043232324123403567617823370988348897897799878999999 Q gi|255764505|r 229 SIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNFHKDLNTLSVEDVMIKNPKVILEDTLLTVAMQL 308 (341) Q Consensus 229 ~ip~V~~~~si~eal~~m~~~~~g~v~Vvd~~~~liGIITdgDlrR~l~~~~~~~~v~~iMt~~p~~I~~d~~i~eAl~l 308 (341) T Consensus 2 ~~~Tv~p~~tl~~a~~~~~~~~~~~~PVvd~~g~lvGivt~~di~~~l~~~~~~~~V~~vM~~~v~tv~~~~~l~~~~~~ 81 (111) T cd04639 2 HFETLSPADTLDDAADALLATTQHEFPVVDGDGHLVGLLTRDDLIRALAEGGPDAPVRGVMRRDFPTVSPSATLDAVLRL 81 (111) T ss_pred CCEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCEEEEEEHHHHHHHHHCCCCCCCHHHHCCCCCEEECCCCCHHHHHHH T ss_conf 88792998979999999997199789999389988999989999999872699970576354698799899949999999 Q ss_pred HHHCCCCEEEEEECCCEEEEEEEHHHHHH Q ss_conf 99679958999806984899985888974 Q gi|255764505|r 309 LRQHNISVLMVVDDCQKAIGIVHFLDLLR 337 (341) Q Consensus 309 M~~~kI~~LpVVD~~~~lvGiIt~~DLlk 337 (341) T Consensus 82 m~~~~~~~lpVVd~~g~lvGivT~~Di~E 110 (111) T cd04639 82 MQQGGAPAVPVVDGSGRLVGLVTLENVGE 110 (111) T ss_pred HHHCCCCEEEEECCCCEEEEEEEHHHHHC T ss_conf 99589988989957992999999788544

HHsearch alignment for GI: 255764505 and conserved domain: cd04639