>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=99.63 E-value=3.1e-15 Score=131.24 Aligned_cols=107 Identities=21% Similarity=0.329 Sum_probs=92.5 Q ss_pred EEEEHHHHHHHHHHHHCCCCCEEEECCCCCEEEEEEECCCHH-----HHHH-C--CCCCCCHHHHCCCCCEEEC------ Q ss_conf 551002388889874104662000000432323241234035-----6761-7--8233709883488978977------ Q gi|255764505|r 232 LVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIF-----RNFH-K--DLNTLSVEDVMIKNPKVIL------ 297 (341) Q Consensus 232 ~V~~~~si~eal~~m~~~~~g~v~Vvd~~~~liGIITdgDlr-----R~l~-~--~~~~~~v~~iMt~~p~~I~------ 297 (341) T Consensus 5 tv~~dtti~eA~~~M~~~~v~~l~VvD~~~~lvGIiT~~Dl~~~~~~~~~~~~~~~~~~l~V~dvMt~~~~~~a~~~~~~ 84 (126) T cd04640 5 VIPADTSIDEALELMIKHGVRLLLVVDSDDNFIGVITAVDLLGEEPIKRIQEGGISRSELTVADVMTPKEDLKALDLEEL 84 (126) T ss_pred EECCCCCHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCCCCCCHHHHHHHHCCCCHHHCCHHHCCCCCCCEEEECCCCC T ss_conf 96899959999999998397679898799979999976300121568888644898255053133554520463022000 Q ss_pred CCCCHHHHHHHHHHCCCCEEEEEECCC-EEEEEEEHHHHHHC Q ss_conf 998789999999967995899980698-48999858889743 Q gi|255764505|r 298 EDTLLTVAMQLLRQHNISVLMVVDDCQ-KAIGIVHFLDLLRF 338 (341) Q Consensus 298 ~d~~i~eAl~lM~~~kI~~LpVVD~~~-~lvGiIt~~DLlka 338 (341) T Consensus 85 ~~a~v~d~~~~m~~~~~~hllVvd~~~~~l~GiiS~~DI~R~ 126 (126) T cd04640 85 ENASVGDVVETLKASGRQHALVVDREHHQIRGIISTSDIARQ 126 (126) T ss_pred CCCCHHHHHHHHHHCCCEEEEEEECCCCEEEEEEEHHHHCCC T ss_conf 348599999999983980874998999889899987994269

HHsearch alignment for GI: 255764505 and conserved domain: cd04640