HHsearch alignment for GI: 255764505 and conserved domain: pfam01380

>pfam01380 SIS SIS domain. SIS (Sugar ISomerase) domains are found in many phosphosugar isomerases and phosphosugar binding proteins. SIS domains are also found in proteins that regulate the expression of genes involved in synthesis of phosphosugars. Presumably the SIS domains bind to the end-product of the pathway.
Probab=99.88  E-value=4.9e-22  Score=180.75  Aligned_cols=129  Identities=37%  Similarity=0.447  Sum_probs=119.9

Q ss_pred             HHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCC-CCCHHHHCCCEEECCCEEEEEECCCCCHHHHHHHHHHHCCC
Q ss_conf             98279959999338137999999999875088611012-33023202301210470789836878078876666632045
Q gi|255764505|r   60 IKAIKGRVVITGIGKSGHIGSKLASTLASTGTPSFFVH-AAEASHGDLGMITRDDLIIVLSWSGSSDELKAILYYARRFS  138 (341)
Q Consensus        60 i~~~~grv~~~GvG~S~~ia~k~a~tl~s~G~~a~~~~-~~ea~Hgdlg~i~~~Dv~i~iS~SG~t~e~~~~~~~~k~~~  138 (341)
T Consensus         2 l~~a~-rI~~~G~G~S~~~A~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~d~vi~iS~sG~t~~~~~~~~~a~~~g   80 (131)
T pfam01380         2 LAKAK-RIYVIGAGTSYAAALELALKLEEIGYIVVEVEDASEFRHGPLALVDPDDLVIAISQSGETRDLLEAAKLLKARG   80 (131)
T ss_pred             CCCCC-EEEEEEECHHHHHHHHHHHHHHHHCCCCEEECCHHHHHCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             76789-89999932699999999999998689877863658866067567999999999548986576898789999849


Q ss_pred             CCEEEEECCCCCHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             627998447889545214533768861554324752178999999999999999
Q gi|255764505|r  139 IPLIAITSENKSVVACHADIVLTLPKEPESCPHGLAPTTSAIMQLAIGDALAIA  192 (341)
Q Consensus       139 ~~iI~iT~~~~S~la~~ad~~l~~~~~~Ea~~~~~aPt~Stt~~l~~~Dalav~  192 (341)
T Consensus        81 ~~~i~iT~~~~S~la~~ad~~l~~~~~~e~---~~~~t~s~~~~l~~l~~l~~~  131 (131)
T pfam01380        81 AKIIAITDSKGSPLAREADHVLYIIAGPEA---GVASTKSLTLQLALLDALAIA  131 (131)
T ss_pred             CEEEEEECCCCCHHHHHCCEEEECCCCCEE---EECCHHHHHHHHHHHHHHHHC
T ss_conf             969999899999789968998987998756---545689999999999999869