RPSBLAST alignment for GI: 255764505 and conserved domain: TIGR01137

>gnl|CDD|162220 TIGR01137, cysta_beta, cystathionine beta-synthase. Members of this family closely resemble cysteine synthase but contain an additional C-terminal CBS domain. The function of any bacterial member included in this family is proposed but not proven. Length = 454
 Score = 48.3 bits (115), Expect = 3e-06
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 5/100 (5%)

Query: 241 DAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNF--HKDLNTLSVEDVMIKNPKVILE 298
           DAI IL E  F  + VV E  K+ G +T  ++       K     +V  VM K    I E
Sbjct: 356 DAIEILREYGFDQLPVVTEAGKVLGSVTLRELLSALFAGKANPDDAVSKVMSKKFIQIGE 415

Query: 299 DTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRF 338
              L+   + L ++  S  +V ++  K IG+V  +DLL F
Sbjct: 416 GEKLSDLSKFLEKN--SSAIVTEE-GKPIGVVTKIDLLSF 452