RPSBLAST alignment for GI: 255764505 and conserved domain: cd04600

>gnl|CDD|73100 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain. These proteins are integral membrane proteins with four transmembrane spanning helices. The function of these proteins is uncertain, but they are thought to be transporters. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.. Length = 124
 Score = 41.4 bits (97), Expect = 4e-04
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 299 DTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLR 337
           DT L  A  LLR+H I  L VVD  ++ +GIV   DLLR
Sbjct: 10  DTSLEEAWALLRRHRIKALPVVDGDRRLVGIVTQRDLLR 48