RPSBLAST alignment for GI: 255764505 and conserved domain: cd04633

>gnl|CDD|73131 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).. Length = 121
 Score = 49.4 bits (118), Expect = 2e-06
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 14/117 (11%)

Query: 233 VKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDI------------FRNFHKDL 280
           V     +  A  ++ +     + V++ G KL GI+TE DI             R+  + +
Sbjct: 6   VSPDDRVSHARRLMLDHDISRLPVIEGG-KLVGIVTEKDIADALRSFRPLVRDRHQERRI 64

Query: 281 NTLSVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLR 337
             L V D+M +    I  DT ++    L+ ++NI  L VVDD  K +GIV   D+LR
Sbjct: 65  RNLPVSDIMTRPVITIEPDTSVSDVASLMLENNIGGLPVVDD-GKLVGIVTRTDILR 120