RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764506|ref|YP_003065297.2| GTP cyclohydrolase I [Candidatus Liberibacter asiaticus str. psy62] (205 letters) >gnl|CDD|30650 COG0302, FolE, GTP cyclohydrolase I [Coenzyme metabolism]. Length = 195 Score = 237 bits (607), Expect = 1e-63 Identities = 92/182 (50%), Positives = 127/182 (69%), Gaps = 3/182 (1%) Query: 19 EEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASK 78 E + A+R +L +G+DPDREGL +TP RV K+Y+ELF+GY + P F E Sbjct: 13 ERIEAAVRELLEALGEDPDREGLLETPKRVAKAYRELFSGYDEDPAEIVLEAT-FEEDH- 70 Query: 79 YQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL 138 +MVL+KDI F+S CEHH+LP +GK H+AYIP VIGLSK+ RI+++++RRLQ+QERL Sbjct: 71 -DEMVLVKDIEFYSLCEHHLLPFFGKAHVAYIPDGKVIGLSKIARIVDIFARRLQVQERL 129 Query: 139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFL 198 T QIA A++ +GVAV+IE +HMCMSMRG+++ G +TVT+A G F D FL Sbjct: 130 TEQIADALQEILKPRGVAVVIEAEHMCMSMRGVRKPGSSTVTSALRGLFKEDAKTRAEFL 189 Query: 199 KM 200 ++ Sbjct: 190 RL 191 >gnl|CDD|29763 cd00642, GTP_cyclohydro1, GTP cyclohydrolase I (GTP-CH-I) catalyzes the conversion of GTP into dihydroneopterin triphosphate. The enzyme product is the precursor of tetrahydrofolate in eubacteria, fungi, and plants and of the folate analogs in methanogenic bacteria. In vertebrates and insects it is the biosynthtic precursor of tetrahydrobiopterin (BH4) which is involved in the formation of catacholamines, nitric oxide, and the stimulation of T lymphocytes. The biosynthetic reaction of BH4 is controlled by a regulatory protein GFRP which mediates feedback inhibition of GTP-CH-I by BH4. This inhibition is reversed by phenylalanine. The decameric GTP-CH-I forms a complex with two pentameric GFRP in the presence of phenylalanine or a combination of GTP and BH4, respectively.. Length = 185 Score = 198 bits (505), Expect = 9e-52 Identities = 92/183 (50%), Positives = 128/183 (69%), Gaps = 3/183 (1%) Query: 18 VEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEAS 77 +E+ A+R IL +G+DP+REGL +TP+RV K+Y+E+ +GY Q + F E Sbjct: 3 LEKIAAAVREILELLGEDPNREGLLETPERVAKAYQEITSGYDQALNDPKNTAI-FDE-- 59 Query: 78 KYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQER 137 + +MV++KDI+ FS CEHH++P +GK+H+AYIPK VIGLSKL RI+E +SRRLQ+QER Sbjct: 60 DHDEMVIVKDITLFSMCEHHLVPFYGKVHIAYIPKDKVIGLSKLARIVEFFSRRLQVQER 119 Query: 138 LTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFF 197 LT QIA AI+ +GVAV+IE HMCM MRG+++ G TVT+A G F D + F Sbjct: 120 LTKQIAVAIQEILGPQGVAVVIEATHMCMVMRGVRKPGSKTVTSAMLGVFKEDPKTREEF 179 Query: 198 LKM 200 L++ Sbjct: 180 LRL 182 >gnl|CDD|37909 KOG2698, KOG2698, KOG2698, GTP cyclohydrolase I [Coenzyme transport and metabolism]. Length = 247 Score = 179 bits (456), Expect = 4e-46 Identities = 82/192 (42%), Positives = 121/192 (63%), Gaps = 5/192 (2%) Query: 12 KLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ-IPTTQDTSR 70 + + + E A IL+ +G+DP+R+GL TP+R K+ GY+Q + + + Sbjct: 58 EESEEVLPEMANAYSSILKSLGEDPNRQGLLKTPERAAKAMLYFTKGYEQNLNDVLNEAV 117 Query: 71 FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130 F + +MV++KDI FS CEHH++P +GK+H+ YIP K V+GLSKL RI+E+YSR Sbjct: 118 FD----EDHDEMVIVKDIEMFSMCEHHLVPFYGKVHIGYIPNKKVLGLSKLARIVEMYSR 173 Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190 RLQ+QERLT QIA A+ + GVAV++E HMCM MRG+++ G +TVT+ G F D Sbjct: 174 RLQVQERLTKQIAVALSQAVQPAGVAVVVEATHMCMVMRGVQKIGSSTVTSTMLGVFRDD 233 Query: 191 KGKTDFFLKMTH 202 + FL + + Sbjct: 234 PKTREEFLNLIN 245 >gnl|CDD|144718 pfam01227, GTP_cyclohydroI, GTP cyclohydrolase I. This family includes GTP cyclohydrolase enzymes and a family of related bacterial proteins. Length = 86 Score = 142 bits (361), Expect = 6e-35 Identities = 48/86 (55%), Positives = 65/86 (75%) Query: 100 PIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLI 159 P +GK H+AYIP VIGLSKL R ++ ++RRLQ+QERLT QIA A+ + KGVAV+I Sbjct: 1 PFFGKAHIAYIPNGKVIGLSKLARYVDSFARRLQVQERLTNQIADALVEALKPKGVAVVI 60 Query: 160 EGQHMCMSMRGIKRDGLTTVTTAFTG 185 E +H+CM+MRG+++ G TVT+A G Sbjct: 61 EAEHLCMTMRGVRKPGSKTVTSALRG 86 >gnl|CDD|29764 cd00651, TFold, Tunnelling fold (T-fold). The five known T-folds are found in five different enzymes with different functions: dihydroneopterin-triphosphate epimerase (DHNTPE), dihydroneopterin aldolase (DHNA) , GTP cyclohydrolase I (GTPCH-1), 6-pyrovoyl tetrahydropterin synthetase (PTPS), and uricase (UO,uroate/urate oxidase). They bind to substrates belonging to the purine or pterin families, and share a fold-related binding site with a glutamate or glutamine residue anchoring the substrate and a lot of conserved interactions. They also share a similar oligomerization mode: several T-folds join together to form a beta(2n)alpha(n) barrel, then two barrels join together in a head-to-head fashion to made up the native enzymes. The functional enzyme is a tetramer for UO, a hexamer for PTPS, an octamer for DHNA/DHNTPE and a decamer for GTPCH-1. The substrate is located in a deep and narrow pocket at the interface between monomers. In PTPS, the active site is located at the interface of three monomers, two from one trimer and one from the other trimer. In GTPCH-1, it is also located at the interface of three subunits, two from one pentamer and one from the other pentamer. There are four equivalent active sites in UO, six in PTPS, eight in DHNA/DHNTPE and ten in GTPCH-1. Each globular multimeric enzyme encloses a tunnel which is lined with charged residues for DHNA and UO, and with basic residues in PTPS. The N and C-terminal ends are located on one side of the T-fold while the residues involved in the catalytic activity are located at the opposite side. In PTPS, UO and DHNA/DHNTPE, the N and C-terminal extremities of the enzyme are located on the exterior side of the functional multimeric enzyme. In GTPCH-1, the extra C-terminal helix places the extremity inside the tunnel.. Length = 122 Score = 43.2 bits (101), Expect = 6e-05 Identities = 20/120 (16%), Positives = 39/120 (32%), Gaps = 16/120 (13%) Query: 80 QDMVLIKDISFFSYC----EHHILPIWGKIHLAYIPKKHV----------IGLSKLVRIL 125 D V +KD+ + + ++ + + + R+ Sbjct: 1 TDGVRVKDLLKVTRLGFVTLERTVGQIFEVDVTLSWDGKKAAASDDVATDTVYNTIYRLA 60 Query: 126 EVYSRRLQIQERLTMQIAHAIESSTDSK--GVAVLIEGQHMCMSMRGIKRDGLTTVTTAF 183 + Y Q+ ERL +IA+ I S V V + H + RG+ + + T Sbjct: 61 KEYVEGSQLIERLAEEIAYLIAEHFLSSVAEVKVEEKKPHAVIPDRGVFKPTDSPGVTIE 120 >gnl|CDD|31123 COG0780, COG0780, Enzyme related to GTP cyclohydrolase I [General function prediction only]. Length = 149 Score = 33.7 bits (77), Expect = 0.039 Identities = 11/58 (18%), Positives = 24/58 (41%) Query: 100 PIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAV 157 P + I++ YIP K + L L + E+ +I + +++ + + V Sbjct: 59 PDFATIYIEYIPDKACVESKSLKLYLFSFRNHGIFHEQCANRIFNDLKALLKPEYLEV 116 >gnl|CDD|31307 COG1110, COG1110, Reverse gyrase [DNA replication, recombination, and repair]. Length = 1187 Score = 29.1 bits (65), Expect = 0.81 Identities = 20/42 (47%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Query: 2 KCLRTGVFNMKLKKPTVEEAKE-AIRVILRWIGDDPDREGLK 42 KC R G N++ K TVE +E A+ V IG DPD EG K Sbjct: 710 KCPRCGSRNVEDKTETVEALRELALEVDEILIGTDPDTEGEK 751 >gnl|CDD|33360 COG3558, COG3558, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 154 Score = 28.5 bits (63), Expect = 1.5 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 7/77 (9%) Query: 17 TVEEAKEAIRVILR-WIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGE 75 T E A + +R+ W DP + L T D ++ E F G ++I F + Sbjct: 10 TAETAIQKVRMAEDAWNSRDPAKVALAYTEDSFWRNRAEFFQGREKI------QEFLTRK 63 Query: 76 ASKYQDMVLIKDISFFS 92 + + LIK++ F+ Sbjct: 64 WDRELEYRLIKELWAFT 80 >gnl|CDD|173781 cd03361, TOPRIM_TopoIA_RevGyr, TopoIA_RevGyr : The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to the ATP-dependent reverse gyrase found in archaea and thermophilic bacteria. Type IA DNA topoisomerases remove (relax) negative supercoils in the DNA by: cleaving one strand of the DNA duplex, covalently linking to the 5' phosphoryl end of the DNA break and, allowing the other strand of the duplex to pass through the gap. Reverse gyrase is also able to insert positive supercoils in the presence of ATP and negative supercoils in the presence of AMPPNP. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD). For topoisomerases the conserved glutamate is believed to act as a general base in strand joining and, as a general acid in strand cleavage. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function. Length = 170 Score = 27.3 bits (61), Expect = 3.1 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Query: 2 KCLRTGVFNMKLKKPTVEE----AKEAIRVILRWIGDDPDREGLK 42 KC R G N+ K T+E A E V+ I DPD EG K Sbjct: 93 KCPRCGSENIDDKLETLEALRELALEVDEVL---IATDPDTEGEK 134 >gnl|CDD|173783 cd03363, TOPRIM_TopoIA_TopoI, TOPRIM_TopoIA_TopoI: The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to Escherichia coli DNA topoisomerase I. Type IA DNA topoisomerases remove (relax) negative supercoils in the DNA by: cleaving one strand of the DNA duplex, covalently linking to the 5' phosphoryl end of the DNA break and, allowing the other strand of the duplex to pass through the gap. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD). For topoisomerases the conserved glutamate is believed to act as a general base in strand joining and, as a general acid in strand cleavage. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function. Length = 123 Score = 27.1 bits (61), Expect = 3.2 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 7/31 (22%) Query: 14 KKPTVEE----AKEAIRVILRWIGDDPDREG 40 KK V+E AK+A + L DPDREG Sbjct: 59 KKKVVKELKKLAKKADEIYL---ATDPDREG 86 >gnl|CDD|29502 cd00801, INT_P4, Bacteriophage P4 integrase. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. They share the same fold in their catalytic domain and the overall reaction mechanism with the superfamily of DNA breaking-rejoining enzymes. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes.. Length = 357 Score = 26.8 bits (59), Expect = 4.4 Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 95 EHHILPIWGKIHLAYIPKKHVIGL 118 E H+LP+ GK + I + ++ + Sbjct: 101 EKHVLPVLGKKPITEITARDLLDV 124 >gnl|CDD|37737 KOG2526, KOG2526, KOG2526, Predicted aminopeptidases - M20/M25/M40 family [Amino acid transport and metabolism]. Length = 555 Score = 26.9 bits (59), Expect = 4.4 Identities = 14/58 (24%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Query: 22 KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGY----KQIPTTQDTSRFHFGE 75 KEA+ L P GL+ + + + K + GY K T D F + + Sbjct: 439 KEAVDSFLDQFASRPRPAGLQRKDESITSNLKSVLEGYLNVVKSAHTKTDAEFFFYDQ 496 >gnl|CDD|173955 cd08196, DHQS-like1, Dehydroquinate synthase (DHQS)-like. DHQS catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis. Dehydroquinate synthase-like proteins. Dehydroquinate synthase (DHQS) catalyzes the conversion of 3-deoxy-D-arabino-heptulosonate-7-phosphate (DAHP) to dehydroquinate (DHQ) in the second step of the shikimate pathway. This pathway involves seven sequential enzymatic steps in the conversion of erythrose 4-phosphate and phosphoenolpyruvate into chorismate for subsequent synthesis of aromatic compounds. The activity of DHQS requires NAD as cofactor. Proteins of this family share sequence similarity and functional motifs with that of dehydroquinate synthase, but the specific function has not been characterized. Length = 346 Score = 26.6 bits (59), Expect = 4.6 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 6/37 (16%) Query: 144 HAIESSTD---SKGVAVLIEGQHMCMSMRGIKRDGLT 177 HA+ES+T+ G+AV G M M+ G T Sbjct: 231 HALESATNFAIPHGIAV---GLGMLMANTIAVLAGGT 264 >gnl|CDD|37281 KOG2070, KOG2070, KOG2070, Guanine nucleotide exchange factor [Nucleotide transport and metabolism]. Length = 661 Score = 26.2 bits (57), Expect = 6.9 Identities = 20/71 (28%), Positives = 26/71 (36%), Gaps = 2/71 (2%) Query: 115 VIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRD 174 GLSK R L+ Y LQ ER M+ H + +AV C +R K Sbjct: 230 TTGLSKPFRRLDKYPTLLQELERH-MEDYHPDRGDI-QRSMAVFKNLSAQCQELRKQKEL 287 Query: 175 GLTTVTTAFTG 185 L +T Sbjct: 288 ELQILTEPIRN 298 >gnl|CDD|35298 KOG0075, KOG0075, KOG0075, GTP-binding ADP-ribosylation factor-like protein [General function prediction only]. Length = 186 Score = 26.0 bits (57), Expect = 8.3 Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 162 QHMCMSMRGIKRDGLTT-VTTAFTGEFSRDKGKT 194 + M +S+ G++ G TT V G++ D T Sbjct: 19 EEMELSLVGLQNSGKTTLVNVIARGQYLEDMIPT 52 >gnl|CDD|99985 cd03814, GT1_like_2, This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.. Length = 364 Score = 26.0 bits (58), Expect = 8.3 Identities = 10/45 (22%), Positives = 14/45 (31%), Gaps = 6/45 (13%) Query: 17 TVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQ 61 + V L +GD P R L+ V F G+ Sbjct: 218 ADLPLRRRPPVRLVIVGDGPARARLEARYPNVH------FLGFLD 256 >gnl|CDD|147324 pfam05088, Bac_GDH, Bacterial NAD-glutamate dehydrogenase. This family consists of several bacterial proteins which are closely related to NAD-glutamate dehydrogenase found in Streptomyces clavuligerus. Glutamate dehydrogenases (GDHs) are a broadly distributed group of enzymes that catalyse the reversible oxidative deamination of glutamate to ketoglutarate and ammonia. Length = 1526 Score = 25.9 bits (58), Expect = 8.7 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Query: 120 KLVRILEVYSRR--LQIQERLTMQIAHAIESSTDSKGVAVLI 159 L+ ILE Y R QI E ++IA I S + V + + Sbjct: 292 ALLNILETYPRDELFQISEDELLEIAMGILSLQERPRVRLFL 333 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.138 0.407 Gapped Lambda K H 0.267 0.0826 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,468,812 Number of extensions: 125649 Number of successful extensions: 331 Number of sequences better than 10.0: 1 Number of HSP's gapped: 327 Number of HSP's successfully gapped: 28 Length of query: 205 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 116 Effective length of database: 4,340,536 Effective search space: 503502176 Effective search space used: 503502176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 55 (24.8 bits)