>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans. NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes. Thus, defects in NOG1 can lead to defects in 60S biogenesis. The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function. It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.

Probab=96.71 E-value=0.0013 Score=43.52 Aligned_cols=54 Identities=17% Similarity=0.240 Sum_probs=38.9 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCEEEEEEEEECCCCCC--CCCCCCCCCCCHHHH Q ss_conf 9999888999989999999974898059982110798998--546875222379998 Q gi|255764507|r 17 MLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPN--EVDGKDYYFLSLSRF 71 (222) Q Consensus 17 iivl~GpsG~GK~tl~~~L~~~~~~~~~~v~~TTR~~R~g--E~~G~dY~Fvs~~~F 71 (222) T Consensus 2 ~VaivG~pNvGKStL~N~L~g~~~~v-~~~p~TTr~~~~~~~~~~~~~~~liDTpGi 57 (168) T cd01897 2 TLVIAGYPNVGKSSLVNKLTRAKPEV-APYPFTTKSLFVGHFDYKYLRWQVIDTPGL 57 (168) T ss_pred EEEEECCCCCCHHHHHHHHHCCCCEE-CCCCCCCCCCEEEEEEECCCEEEEECCCCC T ss_conf 79998899988999999995898602-375872357436899983727687248865

HHsearch alignment for GI: 255764507 and conserved domain: cd01897