RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764507|ref|YP_003065323.2| guanylate kinase [Candidatus Liberibacter asiaticus str. psy62] (222 letters) >gnl|CDD|178968 PRK00300, gmk, guanylate kinase; Provisional. Length = 205 Score = 288 bits (739), Expect = 9e-79 Identities = 93/208 (44%), Positives = 136/208 (65%), Gaps = 4/208 (1%) Query: 12 NHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRF 71 RG+++++S PSG GKST+ + LL+ D N ++S+S TTR RP EVDG DY+F+S F Sbjct: 2 MRRGLLIVLSGPSGAGKSTLVKALLERDPNLQLSVSATTRAPRPGEVDGVDYFFVSKEEF 61 Query: 72 NELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSF 131 E+ + F+E AEV GN+YGT R P+EE ++ GKD+L +IDWQGA+ + K+M + +S Sbjct: 62 EEMIENGEFLEWAEVFGNYYGTPRSPVEEALAAGKDVLLEIDWQGARQVKKKMP-DAVSI 120 Query: 132 FILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSI 191 FILPP+++EL RL R + +E + RL A EI YDYV++NDDL+ +L Sbjct: 121 FILPPSLEELERRLRGRG---TDSEEVIARRLAKAREEIAHASEYDYVIVNDDLDTALEE 177 Query: 192 LKSVIEVERIRRHRLKNGIGGFVGKLLK 219 LK++I ER+RR R + + +LL Sbjct: 178 LKAIIRAERLRRSRQQQRHAELIEELLA 205 >gnl|CDD|132307 TIGR03263, guanyl_kin, guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP. Length = 180 Score = 246 bits (631), Expect = 3e-66 Identities = 87/182 (47%), Positives = 125/182 (68%), Gaps = 4/182 (2%) Query: 15 GMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNEL 74 G++++IS PSGVGKST+ + LL+ D N + SIS TTR RP EVDG DY+F+S F E+ Sbjct: 1 GLLIVISGPSGVGKSTLVKALLEEDPNLKFSISATTRKPRPGEVDGVDYFFVSKEEFEEM 60 Query: 75 KKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFIL 134 A F+E AEVHGN+YGT + P+EE ++ GKD+L +ID QGA+ + K+ + +S FIL Sbjct: 61 IAAGEFLEWAEVHGNYYGTPKSPVEEALAAGKDVLLEIDVQGARQVKKKF-PDAVSIFIL 119 Query: 135 PPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKS 194 PP+++EL RL R + +E ++ RL A EI + +DYV++NDDLE ++ LKS Sbjct: 120 PPSLEELERRLRKR---GTDSEEVIERRLAKAKKEIAHADEFDYVIVNDDLEKAVEELKS 176 Query: 195 VI 196 +I Sbjct: 177 II 178 >gnl|CDD|128386 smart00072, GuKc, Guanylate kinase homologues. Active enzymes catalyze ATP-dependent phosphorylation of GMP to GDP. Structure resembles that of adenylate kinase. So-called membrane-associated guanylate kinase homologues (MAGUKs) do not possess guanylate kinase activities; instead at least some possess protein-binding functions. Length = 184 Score = 157 bits (398), Expect = 3e-39 Identities = 73/188 (38%), Positives = 109/188 (57%), Gaps = 5/188 (2%) Query: 14 RGMMLIISSPSGVGKSTIARHLLKCDQN-FEMSISVTTRVRRPNEVDGKDYYFLSLSRFN 72 +++S PSGVGK T+ L++ + FE +S TTR RP EV+G DY+F+S F Sbjct: 1 DRRPIVLSGPSGVGKGTLLAELIQEIPDAFERVVSHTTRPPRPGEVNGVDYHFVSREEFE 60 Query: 73 ELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFF 132 + K+ F+E E GN+YGT ++ I + +GK L DID QG + L K + F Sbjct: 61 DDIKSGLFLEWGEYSGNYYGTSKETIRQVAEQGKHCLLDIDPQGVKQLRKAQ-LYPIVIF 119 Query: 133 ILPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSIL 192 I PP+ +EL RL R E E++Q RL A E +++ +DYV++NDDLE++ L Sbjct: 120 IAPPSSEELERRLRGR---GTETAERIQKRLAAAQKEAQEYHLFDYVIVNDDLEDAYEEL 176 Query: 193 KSVIEVER 200 K ++E E+ Sbjct: 177 KEILEAEQ 184 >gnl|CDD|184809 PRK14738, gmk, guanylate kinase; Provisional. Length = 206 Score = 143 bits (363), Expect = 3e-35 Identities = 65/194 (33%), Positives = 116/194 (59%), Gaps = 6/194 (3%) Query: 14 RGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNE 73 + ++++IS PSGVGK + + + F ++ TTR +RP E+DG DY+F++ F E Sbjct: 12 KPLLVVISGPSGVGKDAVLARMRERKLPFHFVVTATTRPKRPGEIDGVDYHFVTPEEFRE 71 Query: 74 LKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFI 133 + N +E AEV+GN+YG + P+ + ++ G+D++ +D QGA ++ + + V F+ Sbjct: 72 MISQNELLEWAEVYGNYYGVPKAPVRQALASGRDVIVKVDVQGAASIKRLVPEAVF-IFL 130 Query: 134 LPPTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLIN--DDLENSLSI 191 PP+M EL RL LR E E+++ RL A E+++ +DYV++N D L+ +++ Sbjct: 131 APPSMDELTRRLELR---RTESPEELERRLATAPLELEQLPEFDYVVVNPEDRLDEAVAQ 187 Query: 192 LKSVIEVERIRRHR 205 + ++I E+ R H Sbjct: 188 IMAIISAEKSRVHP 201 >gnl|CDD|173199 PRK14737, gmk, guanylate kinase; Provisional. Length = 186 Score = 142 bits (359), Expect = 7e-35 Identities = 70/180 (38%), Positives = 112/180 (62%), Gaps = 3/180 (1%) Query: 17 MLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKK 76 + IISS +G GKSTI + LL+ +F SIS TTR RP + +GK Y+FL++ F + Sbjct: 6 LFIISSVAGGGKSTIIQALLEEHPDFLFSISCTTRAPRPGDEEGKTYFFLTIEEFKKGIA 65 Query: 77 ANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPP 136 F+E AEVH N+YGT + IE+ +G+ + DID QGA+ + ++ +++ FI PP Sbjct: 66 DGEFLEWAEVHDNYYGTPKAFIEDAFKEGRSAIMDIDVQGAKIIKEKFPERIVTIFIEPP 125 Query: 137 TMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDLENSLSILKSVI 196 + +E RL R ++E EK R++N E+ + +DY +INDDLE++++ L+++I Sbjct: 126 SEEEWEERLIHRGTDSEESIEK---RIENGIIELDEANEFDYKIINDDLEDAIADLEAII 182 >gnl|CDD|178371 PLN02772, PLN02772, guanylate kinase. Length = 398 Score = 123 bits (309), Expect = 5e-29 Identities = 70/183 (38%), Positives = 103/183 (56%), Gaps = 8/183 (4%) Query: 18 LIISSPSGVGKSTIARHLLK-CDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKK 76 ++IS PSGVGK T+ L+K F S+S TTR R E DG Y+F S + K Sbjct: 138 IVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRAPREMEKDGVHYHFTERSVMEKEIK 197 Query: 77 ANAFIEKAEVHGNFYGTLRDPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPP 136 F+E A VHGN YGT + +E GK + DID QGA+++ + + FI PP Sbjct: 198 DGKFLEFASVHGNLYGTSIEAVEVVTDSGKRCILDIDVQGARSV-RASSLEAIFIFICPP 256 Query: 137 TMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWE---FYDYVLINDDLENSLSILK 193 +M+EL RL R E +E++Q RL+NA +E+++ + +D++L ND+LE LK Sbjct: 257 SMEELEKRLRARGT---ETEEQIQKRLRNAEAELEQGKSSGIFDHILYNDNLEECYKNLK 313 Query: 194 SVI 196 ++ Sbjct: 314 KLL 316 >gnl|CDD|162806 TIGR02322, phosphon_PhnN, phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP. Length = 179 Score = 37.7 bits (88), Expect = 0.002 Identities = 27/98 (27%), Positives = 43/98 (43%), Gaps = 7/98 (7%) Query: 15 GMMLIISSPSGVGKSTI---ARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRF 71 G ++ + PSG GK T+ AR L D V TR P G+++ LS F Sbjct: 1 GRLIYVVGPSGAGKDTLLDYARARLAGDPRVHFVRRVITR---PASAGGENHIALSTEEF 57 Query: 72 NELKKANAFIEKAEVHGNFYGTLRDPIEETISKGKDML 109 + + AF + HG YG + I++ + G ++ Sbjct: 58 DHREDGGAFALSWQAHGLSYGIPAE-IDQWLEAGDVVV 94 >gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment. Length = 148 Score = 32.3 bits (73), Expect = 0.10 Identities = 17/72 (23%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Query: 18 LIISSPSGVGKSTIAR---HLLKCDQNFEMSISVTT---RVRRPNEVDGKDYYFLSLSRF 71 ++I P G GK+T+AR L + I V + S S Sbjct: 5 ILIVGPPGSGKTTLARALARELGPPGGGVIYIDGEDILEEVLDQLLLIIVGGKKASGSGE 64 Query: 72 NELKKANAFIEK 83 L+ A A K Sbjct: 65 LRLRLALALARK 76 >gnl|CDD|180615 PRK06547, PRK06547, hypothetical protein; Provisional. Length = 172 Score = 31.6 bits (72), Expect = 0.15 Identities = 8/26 (30%), Positives = 13/26 (50%) Query: 13 HRGMMLIISSPSGVGKSTIARHLLKC 38 + ++I SG GK+T+A L Sbjct: 13 GGMITVLIDGRSGSGKTTLAGALAAR 38 >gnl|CDD|179346 PRK01889, PRK01889, GTPase RsgA; Reviewed. Length = 356 Score = 31.8 bits (73), Expect = 0.16 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 9/39 (23%) Query: 23 PSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGK 61 SGVGKST+ LL + T VR E D K Sbjct: 203 SSGVGKSTLVNALLGEE---VQK---TGAVR---EDDSK 232 >gnl|CDD|183407 PRK12289, PRK12289, GTPase RsgA; Reviewed. Length = 352 Score = 31.1 bits (71), Expect = 0.22 Identities = 11/35 (31%), Positives = 17/35 (48%) Query: 1 MNRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHL 35 L L R + +++ PSGVGKS++ L Sbjct: 158 ETGIGLEALLEQLRNKITVVAGPSGVGKSSLINRL 192 >gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional. Length = 262 Score = 30.8 bits (69), Expect = 0.32 Identities = 13/23 (56%), Positives = 16/23 (69%) Query: 13 HRGMMLIISSPSGVGKSTIARHL 35 H G M+ + PSG GKST+ RHL Sbjct: 28 HHGEMVALLGPSGSGKSTLLRHL 50 >gnl|CDD|179771 PRK04182, PRK04182, cytidylate kinase; Provisional. Length = 180 Score = 30.5 bits (70), Expect = 0.36 Identities = 11/20 (55%), Positives = 15/20 (75%) Query: 16 MMLIISSPSGVGKSTIARHL 35 M++ IS P G GK+T+AR L Sbjct: 1 MIITISGPPGSGKTTVARLL 20 >gnl|CDD|181191 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated. Length = 647 Score = 30.2 bits (69), Expect = 0.42 Identities = 10/14 (71%), Positives = 11/14 (78%) Query: 25 GVGKSTIARHLLKC 38 GVGK+TIAR L K Sbjct: 48 GVGKTTIARLLAKG 61 >gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates. Length = 243 Score = 30.0 bits (68), Expect = 0.49 Identities = 10/23 (43%), Positives = 14/23 (60%) Query: 13 HRGMMLIISSPSGVGKSTIARHL 35 + G + I PSG GKST+ R + Sbjct: 26 NPGEFVAIIGPSGAGKSTLLRCI 48 >gnl|CDD|180177 PRK05636, PRK05636, replicative DNA helicase; Provisional. Length = 505 Score = 29.8 bits (67), Expect = 0.53 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 23/92 (25%) Query: 13 HRGMMLIISSPSGVGKSTIARHLLKCDQ----------NFEMS--------ISVTTRVR- 53 G M+I+++ GVGKST+A ++ + EMS +S VR Sbjct: 263 RGGQMIIVAARPGVGKSTLALDFMRSASIKHNKASVIFSLEMSKSEIVMRLLSAEAEVRL 322 Query: 54 ---RPNEVDGKDYYFLSLSRFNELKKANAFIE 82 R ++D + L R ++ +A FI+ Sbjct: 323 SDMRGGKMDEDAWEKLV-QRLGKIAQAPIFID 353 >gnl|CDD|161848 TIGR00381, cdhD, CO dehydrogenase/acetyl-CoA synthase, delta subunit. This is the small subunit of a heterodimer which catalyzes the reaction CO + H2O + Acceptor = CO2 + Reduced acceptor and is involved in the synthesis of acetyl-CoA from CO2 and H2. Length = 389 Score = 29.5 bits (66), Expect = 0.62 Identities = 14/45 (31%), Positives = 23/45 (51%) Query: 111 DIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQED 155 D+D++ N K+ G VLS+ I+ MQ+ +R L+ D Sbjct: 226 DLDYEKIANAAKKYGHVVLSWTIMDINMQKTLNRYLLKRGLMPRD 270 >gnl|CDD|183453 PRK12338, PRK12338, hypothetical protein; Provisional. Length = 319 Score = 29.7 bits (67), Expect = 0.62 Identities = 11/21 (52%), Positives = 16/21 (76%) Query: 17 MLIISSPSGVGKSTIARHLLK 37 +++I S SG+GKSTIA L + Sbjct: 6 VILIGSASGIGKSTIASELAR 26 >gnl|CDD|181868 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed. Length = 375 Score = 29.5 bits (67), Expect = 0.72 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 7 FPLTVNHRGMMLIISSPSGVGKSTIAR 33 LT+N+ G L + PSG GK+T+ R Sbjct: 33 LDLTINN-GEFLTLLGPSGCGKTTVLR 58 >gnl|CDD|162744 TIGR02173, cyt_kin_arch, cytidylate kinase, putative. Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017. Length = 171 Score = 28.5 bits (64), Expect = 1.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Query: 16 MMLIISSPSGVGKSTIARHL 35 M++ IS P G GK+T+A+ L Sbjct: 1 MIITISGPPGSGKTTVAKIL 20 >gnl|CDD|129547 TIGR00455, apsK, adenylylsulfate kinase (apsK). Important residue (active site in E.coli) is residue 100 of the seed alignment. Length = 184 Score = 28.2 bits (63), Expect = 1.7 Identities = 13/25 (52%), Positives = 18/25 (72%) Query: 13 HRGMMLIISSPSGVGKSTIARHLLK 37 HRG+++ ++ SG GKSTIA L K Sbjct: 16 HRGVVIWLTGLSGSGKSTIANALEK 40 >gnl|CDD|129128 TIGR00017, cmk, cytidylate kinase. This family consists of cytidylate kinase, which catalyzes the phosphorylation of cytidine 5-monophosphate (dCMP) to cytidine 5 -diphosphate (dCDP) in the presence of ATP or GTP. UMP and dCMP can also act as acceptors. Length = 217 Score = 28.2 bits (63), Expect = 2.0 Identities = 10/22 (45%), Positives = 15/22 (68%) Query: 14 RGMMLIISSPSGVGKSTIARHL 35 M++ I PSG GKST+A+ + Sbjct: 1 MAMIIAIDGPSGAGKSTVAKAV 22 >gnl|CDD|178887 PRK00131, aroK, shikimate kinase; Reviewed. Length = 175 Score = 27.8 bits (63), Expect = 2.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 14 RGMMLIISSPSGVGKSTIARHL 35 +G +++ G GKSTI R L Sbjct: 3 KGPNIVLIGFMGAGKSTIGRLL 24 >gnl|CDD|149019 pfam07728, AAA_5, AAA domain (dynein-related subfamily). This Pfam entry includes some of the AAA proteins not detected by the pfam00004 model. Length = 139 Score = 28.0 bits (63), Expect = 2.2 Identities = 7/29 (24%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Query: 18 LIISSPSGVGKSTIARHLLK--CDQNFEM 44 +++ P G GKS +A L ++ Sbjct: 2 VLLVGPPGTGKSELAERLAAALSNRPVFY 30 >gnl|CDD|183730 PRK12765, PRK12765, flagellar capping protein; Provisional. Length = 595 Score = 27.9 bits (62), Expect = 2.3 Identities = 14/47 (29%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Query: 154 EDKEKVQLRLQNAYSEI-KKWEFYDYVLINDDLENSLSILKSVIEVE 199 KE Q + Y + KW YD ++ LE S LK++I Sbjct: 546 TSKESTQELIDTKYETMANKWLQYDSIIAK--LEQQFSTLKNMINAA 590 >gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional. Length = 590 Score = 27.9 bits (63), Expect = 2.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 2 NRDRLFPLTVNHRGMMLIISSPSGVGKSTIARHL 35 N +L+ L + G + I P+G+GK+T + L Sbjct: 86 NGFKLYGLPIPKEGKVTGILGPNGIGKTTAVKIL 119 >gnl|CDD|179218 PRK01077, PRK01077, cobyrinic acid a,c-diamide synthase; Validated. Length = 451 Score = 27.8 bits (63), Expect = 2.3 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Query: 14 RGMM-LIISSP-SGVGKSTIA 32 M L+I++P SG GK+T+ Sbjct: 1 MRMPALVIAAPASGSGKTTVT 21 >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se. Length = 224 Score = 27.7 bits (62), Expect = 2.3 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 9 LTVNHRGMMLIISSPSGVGKSTIARHL 35 LTVN G + +S PSG GKST+ + L Sbjct: 29 LTVN-AGECVALSGPSGAGKSTLLKSL 54 >gnl|CDD|184924 PRK14960, PRK14960, DNA polymerase III subunits gamma and tau; Provisional. Length = 702 Score = 27.7 bits (61), Expect = 2.6 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Query: 25 GVGKSTIARHLLKCDQNFEMSISVT 49 GVGK+TIAR L KC N E ++ T Sbjct: 47 GVGKTTIARILAKC-LNCETGVTST 70 >gnl|CDD|183084 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional. Length = 327 Score = 27.6 bits (62), Expect = 2.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Query: 13 HRGMMLIISSPSGVGKSTIARHL 35 RG L + SG GKST+AR L Sbjct: 39 ERGKTLAVVGESGCGKSTLARLL 61 >gnl|CDD|184934 PRK14970, PRK14970, DNA polymerase III subunits gamma and tau; Provisional. Length = 367 Score = 27.5 bits (61), Expect = 2.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Query: 12 NHRGMMLIISSPSGVGKSTIARHLLK 37 NH L+ P GVGK+T AR L + Sbjct: 36 NHLAQALLFCGPRGVGKTTCARILAR 61 >gnl|CDD|179921 PRK05057, aroK, shikimate kinase I; Reviewed. Length = 172 Score = 27.4 bits (61), Expect = 3.3 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Query: 14 RGMMLIISSPSGVGKSTIARHLLK 37 R + L+ P G GKSTI R L + Sbjct: 5 RNIFLV--GPMGAGKSTIGRQLAQ 26 >gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional. Length = 232 Score = 27.2 bits (61), Expect = 3.4 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Query: 7 FPLTVNHRGMMLIISSPSGVGKSTI 31 F LTV RG + I PSG GKST+ Sbjct: 18 FDLTVE-RGERVAILGPSGAGKSTL 41 >gnl|CDD|177855 PLN02205, PLN02205, alpha,alpha-trehalose-phosphate synthase [UDP-forming]. Length = 854 Score = 27.3 bits (60), Expect = 3.4 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Query: 8 PLTVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMS 45 P+TV G ++ P GV K +A+ LL Q M Sbjct: 744 PVTVK-SGQNIVEVKPQGVSKGLVAKRLLSIMQERGML 780 >gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans. Length = 303 Score = 27.2 bits (60), Expect = 3.9 Identities = 23/80 (28%), Positives = 31/80 (38%), Gaps = 1/80 (1%) Query: 23 PSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVDGKDYYFLSLSRFNELKKANAFIE 82 P+G GKSTIAR LL I+V P+ + +F+ L E Sbjct: 38 PNGAGKSTIARMLLGMISPDRGKITVLGE-PVPSRARLARVAIGVVPQFDNLDPEFTVRE 96 Query: 83 KAEVHGNFYGTLRDPIEETI 102 V G ++G IE I Sbjct: 97 NLLVFGRYFGMSTREIEAVI 116 >gnl|CDD|178433 PLN02840, PLN02840, tRNA dimethylallyltransferase. Length = 421 Score = 27.1 bits (60), Expect = 3.9 Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 12 NHRGMMLIISSPSGVGKSTIARHLLK 37 + +++IS P+G GKS +A L K Sbjct: 18 TKKEKVIVISGPTGAGKSRLALELAK 43 >gnl|CDD|181925 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed. Length = 712 Score = 27.1 bits (60), Expect = 3.9 Identities = 9/23 (39%), Positives = 17/23 (73%) Query: 15 GMMLIISSPSGVGKSTIARHLLK 37 +++ I P+GVGKS+++R L + Sbjct: 1 MIIVAIDGPAGVGKSSVSRALAQ 23 >gnl|CDD|162555 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. Length = 544 Score = 26.9 bits (60), Expect = 4.0 Identities = 12/22 (54%), Positives = 15/22 (68%) Query: 15 GMMLIISSPSGVGKSTIARHLL 36 G L I PSG GKST+AR ++ Sbjct: 344 GEALAIIGPSGSGKSTLARLIV 365 >gnl|CDD|150077 pfam09287, CEP1-DNA_bind, CEP-1, DNA binding. Members of this family of DNA-binding domains are found the transcription factor CEP-1. They adopt a beta sandwich structure, with nine strands in two beta-sheets, in a Greek-key topology. Length = 196 Score = 27.0 bits (59), Expect = 4.1 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 1/78 (1%) Query: 96 DPIEETISKGKDMLFDIDWQGAQNLHKQMGSNVLSFFILPPTMQELCSRLSLRAKKNQED 155 D +++ ++K DM F I + + L +MG V + S LSLR + + D Sbjct: 7 DVLKQKVAKSSDMAFAISSEHEKYLWTKMGCLVPIQVKWKLDKRHFNSNLSLRIRFVKYD 66 Query: 156 -KEKVQLRLQNAYSEIKK 172 KE V+ ++N S++ K Sbjct: 67 KKENVEYAIRNPRSDVMK 84 >gnl|CDD|178800 PRK00023, cmk, cytidylate kinase; Provisional. Length = 225 Score = 27.0 bits (61), Expect = 4.1 Identities = 6/11 (54%), Positives = 9/11 (81%) Query: 23 PSGVGKSTIAR 33 P+G GK T+A+ Sbjct: 12 PAGSGKGTVAK 22 >gnl|CDD|163508 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein. This protein describes an multidomain ABC transporter subunit that is one of three protein families associated with some regularity with a distinctive family of putative bacteriocins. It includes a bacteriocin-processing peptidase domain at the N-terminus. Model TIGR03793 describes a conserved propeptide region for this bacteriocin family, unusual because it shows obvious homology a region of the enzyme nitrile hydratase up to the classic Gly-Gly cleavage motif. This family is therefore predicted to be a subunit of a bacteriocin processing and export system characteristic to this system that we designate NHPM, Nitrile Hydratase Propeptide Microcin. Length = 710 Score = 26.8 bits (60), Expect = 4.2 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Query: 7 FPLTVNHRGMMLIISSPSGVGKSTIAR 33 F LT+ G + + SG GKSTIA+ Sbjct: 498 FSLTLQP-GQRVALVGGSGSGKSTIAK 523 >gnl|CDD|161993 TIGR00678, holB, DNA polymerase III, delta' subunit. At position 126-127 of the seed alignment, this family lacks the HM motif of gamma/tau; at 132 it has a near-invariant A vs. an invariant F in gamma/tau. Length = 188 Score = 26.8 bits (60), Expect = 4.3 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 18 LIISSPSGVGKSTIARHLLK 37 + + P GVGK +A L K Sbjct: 17 YLFAGPEGVGKELLALALAK 36 >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein. This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins. Length = 576 Score = 27.0 bits (60), Expect = 4.3 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 7 FPLTVNHRGMMLIISSPSGVGKSTIARHLLK 37 LTV G + + PSG GKST+ + LL+ Sbjct: 359 LNLTVR-PGETVALVGPSGAGKSTLFQLLLR 388 >gnl|CDD|161784 TIGR00238, TIGR00238, KamA family protein. Note that the E. coli homolog was expressed in E. coli and purified and found not to display display lysine 2,3-aminomutase activity. Active site residues are found in 100 residue extension in B. subtilis. Name changed to KamA family protein. Length = 331 Score = 26.7 bits (59), Expect = 4.3 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Query: 142 CSRLSLRAKKNQEDKEKVQLRLQ--NAYSEIKKWEFY--DYVLIND-DLENSLSILKSVI 196 C R K+N +K+K Q L + EI + D ++ D +LE L L+ + Sbjct: 130 CFRRHFPYKENPGNKKKWQKALDYIAEHPEIIEILISGGDPLMAKDHELEWLLKRLEEIP 189 Query: 197 EVERIRRH 204 + R+R Sbjct: 190 HLVRLRIG 197 >gnl|CDD|162188 TIGR01070, mutS1, DNA mismatch repair protein MutS. Length = 840 Score = 26.7 bits (59), Expect = 4.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Query: 8 PLTVNHRGMMLIISSPSGVGKSTIARHL 35 L + H ML+I+ P+ GKST R Sbjct: 585 DLEMAHNRRMLLITGPNMGGKSTYMRQT 612 >gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found. Length = 213 Score = 26.7 bits (59), Expect = 4.5 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 7 FPLTVNHRGMMLIISSPSGVGKSTI 31 F L V G ++ I PSG GKST+ Sbjct: 17 FDLNVA-DGEIVAIMGPSGAGKSTL 40 >gnl|CDD|180644 PRK06647, PRK06647, DNA polymerase III subunits gamma and tau; Validated. Length = 563 Score = 26.7 bits (59), Expect = 4.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 19 IISSPSGVGKSTIARHLLKC 38 I S P GVGK++ AR +C Sbjct: 42 IFSGPRGVGKTSSARAFARC 61 >gnl|CDD|131458 TIGR02405, trehalos_R_Ecol, trehalose operon repressor, proteobacterial. This family consists of repressors of the LacI family typically associated with trehalose utilization operons. Trehalose is imported as trehalose-6-phosphate and then hydrolyzed by alpha,alpha-phosphotrehalase to glucose and glucose-6-P. This family includes repressors mostly from Gammaproteobacteria and does not include the GntR family TreR of Bacillus subtilis. Length = 311 Score = 26.8 bits (59), Expect = 4.6 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 5/34 (14%) Query: 20 ISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVR 53 I+ +GVGKST++R L N E +S+ TR R Sbjct: 7 IARLAGVGKSTVSRVL-----NNEPKVSIETRER 35 >gnl|CDD|178749 PLN03210, PLN03210, Resistant to P. syringae 6; Provisional. Length = 1153 Score = 26.8 bits (59), Expect = 4.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 17 MLIISSPSGVGKSTIARHL 35 M+ I SG+GK+TIAR L Sbjct: 209 MVGIWGSSGIGKTTIARAL 227 >gnl|CDD|183986 PRK13342, PRK13342, recombination factor protein RarA; Reviewed. Length = 413 Score = 26.6 bits (60), Expect = 4.9 Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 23 PSGVGKSTIAR 33 P G GK+T+AR Sbjct: 44 PPGTGKTTLAR 54 >gnl|CDD|131688 TIGR02640, gas_vesic_GvpN, gas vesicle protein GvpN. Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728). Length = 262 Score = 26.7 bits (59), Expect = 5.0 Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 23 PSGVGKSTIARHLLKC 38 P+G GK+T+A H+ + Sbjct: 29 PAGTGKTTLAMHVARK 44 >gnl|CDD|184917 PRK14953, PRK14953, DNA polymerase III subunits gamma and tau; Provisional. Length = 486 Score = 26.7 bits (59), Expect = 5.0 Identities = 11/19 (57%), Positives = 13/19 (68%) Query: 19 IISSPSGVGKSTIARHLLK 37 I + P G GK+TIAR L K Sbjct: 42 IFAGPRGTGKTTIARILAK 60 >gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional. Length = 242 Score = 26.5 bits (59), Expect = 5.1 Identities = 12/34 (35%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Query: 15 GMMLIISSPSGVGKSTIAR--HLLKCDQNFEMSI 46 G L++ PSG GKS++ R +LL+ ++ ++I Sbjct: 28 GETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNI 61 >gnl|CDD|180917 PRK07279, dnaE, DNA polymerase III DnaE; Reviewed. Length = 1034 Score = 26.5 bits (59), Expect = 5.3 Identities = 17/50 (34%), Positives = 20/50 (40%) Query: 136 PTMQELCSRLSLRAKKNQEDKEKVQLRLQNAYSEIKKWEFYDYVLINDDL 185 P ++EL L K+ Q RL S I F DY LI DL Sbjct: 237 PAVEELRELAELGLKEKGLWSSPYQERLDKELSVIHDMGFDDYFLIVWDL 286 >gnl|CDD|178861 PRK00098, PRK00098, GTPase RsgA; Reviewed. Length = 298 Score = 26.7 bits (60), Expect = 5.4 Identities = 7/13 (53%), Positives = 11/13 (84%) Query: 19 IISSPSGVGKSTI 31 +++ SGVGKST+ Sbjct: 168 VLAGQSGVGKSTL 180 >gnl|CDD|184920 PRK14956, PRK14956, DNA polymerase III subunits gamma and tau; Provisional. Length = 484 Score = 26.4 bits (58), Expect = 5.6 Identities = 13/23 (56%), Positives = 14/23 (60%) Query: 15 GMMLIISSPSGVGKSTIARHLLK 37 G I P GVGK+TIAR L K Sbjct: 40 GHAYIFFGPRGVGKTTIARILAK 62 >gnl|CDD|182699 PRK10751, PRK10751, molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional. Length = 173 Score = 26.6 bits (59), Expect = 5.8 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 10/65 (15%) Query: 17 MLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVD--GKDYYFLSLSRFNEL 74 +L I++ SG GK+T+ + L+ + + +VD GKD Y EL Sbjct: 8 LLAIAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDVDKPGKDSY--------EL 59 Query: 75 KKANA 79 +KA A Sbjct: 60 RKAGA 64 >gnl|CDD|162839 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamma and tau. This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis. Length = 355 Score = 26.4 bits (59), Expect = 6.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 21 SSPSGVGKSTIARHLLKC 38 S P G GK++IAR K Sbjct: 42 SGPRGTGKTSIARIFAKA 59 >gnl|CDD|183258 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional. Length = 356 Score = 26.3 bits (59), Expect = 6.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 15 GMMLIISSPSGVGKSTIAR 33 G +++ PSG GKST+ R Sbjct: 30 GEFIVLVGPSGCGKSTLLR 48 >gnl|CDD|163076 TIGR02928, TIGR02928, orc1/cdc6 family replication initiation protein. Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other. Length = 365 Score = 26.4 bits (59), Expect = 6.4 Identities = 5/20 (25%), Positives = 13/20 (65%) Query: 18 LIISSPSGVGKSTIARHLLK 37 + I +G GK+ + ++++K Sbjct: 43 VFIYGKTGTGKTAVTKYVMK 62 >gnl|CDD|183183 PRK11537, PRK11537, putative GTP-binding protein YjiA; Provisional. Length = 318 Score = 26.2 bits (58), Expect = 6.6 Identities = 7/22 (31%), Positives = 15/22 (68%) Query: 25 GVGKSTIARHLLKCDQNFEMSI 46 G GK+T+ RH+L +++++ Sbjct: 14 GAGKTTLLRHILNEQHGYKIAV 35 >gnl|CDD|181905 PRK09492, treR, trehalose repressor; Provisional. Length = 315 Score = 26.4 bits (59), Expect = 6.6 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 5/30 (16%) Query: 24 SGVGKSTIARHLLKCDQNFEMSISVTTRVR 53 SGVGKST++R L N E +S TR R Sbjct: 14 SGVGKSTVSRVL-----NNESGVSEETRER 38 >gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional. Length = 351 Score = 26.2 bits (58), Expect = 6.7 Identities = 9/20 (45%), Positives = 14/20 (70%) Query: 14 RGMMLIISSPSGVGKSTIAR 33 +G M+ + PSG GK+T+ R Sbjct: 31 QGTMVTLLGPSGCGKTTVLR 50 >gnl|CDD|184193 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional. Length = 280 Score = 26.2 bits (58), Expect = 6.7 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Query: 2 NRDRLFPLTVNH------RGMMLIISSPSGVGKSTIARHL 35 N + L ++ +G L+I +G GKSTIA+H+ Sbjct: 17 NEESTEKLALDDVNLEVKKGEFLVILGRNGSGKSTIAKHM 56 >gnl|CDD|184123 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional. Length = 340 Score = 26.3 bits (58), Expect = 6.9 Identities = 10/14 (71%), Positives = 12/14 (85%) Query: 23 PSGVGKSTIARHLL 36 P+G GKSTIAR +L Sbjct: 75 PNGAGKSTIARMIL 88 >gnl|CDD|177379 PHA02544, 44, clamp loader, small subunit; Provisional. Length = 316 Score = 26.1 bits (58), Expect = 6.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 17 MLIISSPSGVGKSTIARHL 35 ML+ S G GK+T+A+ L Sbjct: 45 MLLHSPSPGTGKTTVAKAL 63 >gnl|CDD|162162 TIGR01026, fliI_yscN, ATPase FliI/YscN family. This family of ATPases demonstrates extensive homology with ATP synthase F1, beta subunit. It is a mixture of members with two different protein functions. The first group is exemplified by Salmonella typhimurium FliI protein. It is needed for flagellar assembly, its ATPase activity is required for flagellation, and it may be involved in a specialized protein export pathway that proceeds without signal peptide cleavage. The second group of proteins function in the export of virulence proteins; exemplified by Yersinia sp. YscN protein an ATPase involved in the type III secretory pathway for the antihost Yops proteins. Length = 440 Score = 26.2 bits (58), Expect = 7.1 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 5/30 (16%) Query: 9 LTVNHRGMMLIISSPSGVGKST----IARH 34 LTV +G + I + SGVGKST IAR+ Sbjct: 158 LTVG-KGQRIGIFAGSGVGKSTLLGMIARN 186 >gnl|CDD|163042 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD. Length = 529 Score = 26.1 bits (58), Expect = 7.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 15 GMMLIISSPSGVGKSTIARHLL 36 G + + PSG GKST+ LL Sbjct: 348 GERVALVGPSGAGKSTLLNLLL 369 >gnl|CDD|162313 TIGR01351, adk, adenylate kinases. Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason. Length = 210 Score = 26.0 bits (58), Expect = 7.2 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 17 MLIISSPSGVGKSTIARHL 35 L++ P G GK T A+ + Sbjct: 1 RLVLLGPPGSGKGTQAKRI 19 >gnl|CDD|163509 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC transporter, ATP-binding protein. Members of this protein family are ABC transporter ATP-binding subunits, part of a three-gene putative bacteriocin transport operon. The other subunits include another ATP-binding subunit (TIGR03796), which has an N-terminal propeptide cleavage domain, and an HlyD homolog (TIGR03794). In a number of genomes, a conserved propeptide sequence with a classic Gly-Gly motif. Length = 686 Score = 26.1 bits (58), Expect = 7.4 Identities = 11/17 (64%), Positives = 12/17 (70%) Query: 20 ISSPSGVGKSTIARHLL 36 I PSG GKST+ R LL Sbjct: 484 IVGPSGSGKSTLLRLLL 500 >gnl|CDD|151555 pfam11111, CENP-M, Centromere protein M (CENP-M). The prime candidate for specifying centromere identity is the array of nucleosomes assembles with CENP-A. CENP-A recruits a nucleosome associated complex (NAC) comprised of CENP-M along with two other proteins. Assembly of the CENP-A NAC at centromeres is partly dependant on CENP-M. The CENP-A NAC is essential, as disruption of the complex causes errors of chromosome alignment and segregation that preclude cell survival. Length = 176 Score = 26.3 bits (58), Expect = 7.4 Identities = 13/50 (26%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Query: 10 TVNHRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRPNEVD 59 +N ++L+ G + +A +LK D++FE++I + T + P+E + Sbjct: 12 ELNTATVLLV--GTEGALQQQLAEAMLKEDKDFELNIHLATSLPLPSERN 59 >gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown. Length = 223 Score = 26.0 bits (57), Expect = 7.5 Identities = 10/43 (23%), Positives = 20/43 (46%) Query: 13 HRGMMLIISSPSGVGKSTIARHLLKCDQNFEMSISVTTRVRRP 55 +G +L + P+G GK+T+ R +L + ++ V Sbjct: 4 DKGELLGLLGPNGAGKTTLLRAILGLIPPAKGTVKVAGASPGK 46 >gnl|CDD|183331 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional. Length = 269 Score = 25.9 bits (57), Expect = 7.9 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Query: 9 LTVNHRGMMLIISSPSGVGKSTIAR 33 LTV RG + I PSG+GK+T+ R Sbjct: 28 LTVP-RGKITAIMGPSGIGKTTLLR 51 >gnl|CDD|179793 PRK04220, PRK04220, 2-phosphoglycerate kinase; Provisional. Length = 301 Score = 26.1 bits (58), Expect = 8.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Query: 16 MMLIISSPSGVGKSTIA 32 ++++I SGVG STIA Sbjct: 93 IIILIGGASGVGTSTIA 109 >gnl|CDD|185483 PTZ00154, PTZ00154, 40S ribosomal protein S17; Provisional. Length = 134 Score = 25.8 bits (57), Expect = 8.4 Identities = 14/27 (51%), Positives = 16/27 (59%) Query: 193 KSVIEVERIRRHRLKNGIGGFVGKLLK 219 K V EV I RL+N I GFV L+K Sbjct: 33 KIVEEVAIIPSKRLRNKIAGFVTHLMK 59 >gnl|CDD|162859 TIGR02442, Cob-chelat-sub, cobaltochelatase subunit. A number of genomes (actinobacteria, cyanobacteria, betaproteobacteria and pseudomonads) which apparently biosynthesize B12, encode a cobN gene but are demonstrably lacking cobS and cobT. These genomes do, however contain a homolog (modelled here) of the magnesium chelatase subunits BchI/BchD family. Aside from the cyanobacteria (which have a separate magnesium chelatase trimer), these species do not make chlorins, so do not have any use for a magnesium chelatase. Furthermore, in nearly all cases the members of this family are proximal to either CobN itself or other genes involved in cobalt transport or B12 biosynthesis. Length = 633 Score = 25.8 bits (57), Expect = 9.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Query: 18 LIISSPSGVGKSTIARHL 35 ++I G KST AR L Sbjct: 28 VLIRGEKGTAKSTAARGL 45 >gnl|CDD|181036 PRK07568, PRK07568, aspartate aminotransferase; Provisional. Length = 397 Score = 26.0 bits (58), Expect = 9.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 178 YVLINDDLENSLSILKSVIEV 198 YVL +DL+ ++ ILK +E Sbjct: 372 YVLNEEDLKRAMEILKEALEK 392 >gnl|CDD|180064 PRK05416, PRK05416, glmZ(sRNA)-inactivating NTPase; Provisional. Length = 288 Score = 25.8 bits (58), Expect = 9.6 Identities = 7/17 (41%), Positives = 11/17 (64%) Query: 17 MLIISSPSGVGKSTIAR 33 ++I++ SG GKS R Sbjct: 8 LVIVTGLSGAGKSVALR 24 >gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional. Length = 569 Score = 25.8 bits (57), Expect = 9.6 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 4/24 (16%) Query: 15 GMMLIISSPSGVGKST----IARH 34 G ML I P+G GKST I RH Sbjct: 341 GQMLGICGPTGSGKSTLLSLIQRH 364 >gnl|CDD|181111 PRK07773, PRK07773, replicative DNA helicase; Validated. Length = 886 Score = 25.9 bits (57), Expect = 9.8 Identities = 6/20 (30%), Positives = 13/20 (65%) Query: 13 HRGMMLIISSPSGVGKSTIA 32 H G ++I+++ +GK+T Sbjct: 215 HPGQLIIVAARPSMGKTTFG 234 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.137 0.392 Gapped Lambda K H 0.267 0.0751 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,648,504 Number of extensions: 225743 Number of successful extensions: 875 Number of sequences better than 10.0: 1 Number of HSP's gapped: 859 Number of HSP's successfully gapped: 125 Length of query: 222 Length of database: 5,994,473 Length adjustment: 90 Effective length of query: 132 Effective length of database: 4,049,753 Effective search space: 534567396 Effective search space used: 534567396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (24.9 bits)