RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|255764508|ref|YP_003065363.2| hypothetical protein CLIBASIA_04245 [Candidatus Liberibacter asiaticus str. psy62] (242 letters) >gnl|CDD|182497 PRK10494, PRK10494, hypothetical protein; Provisional. Length = 259 Score = 44.6 bits (106), Expect = 2e-05 Identities = 50/195 (25%), Positives = 79/195 (40%), Gaps = 28/195 (14%) Query: 55 RPLLS--PQW--KKDGNIIVLLGNGTTIIPTIPAIRIEPSFQ----SYSRIFETMRLYKS 106 RP+ S P W + + IV+LG G T P PS S R+ E +RL+++ Sbjct: 64 RPIESRYPTWNGSQKVDYIVVLGGGYTWNPQWA-----PSSNLINNSLPRLTEGIRLWRA 118 Query: 107 CKQHSMHCTIIISGGDPQKHGLAESIVYNNKLLES-GVERDDIKLETQSLDTFQNAQFSS 165 + T + + + V +S GV R+DI DT + A Sbjct: 119 NPGAKLIFTGGAAKTNTVSTAEVGARV-----AQSLGVPREDIITLDLPKDTEEEAAAVK 173 Query: 166 SMIKNMQGKNIILVSSAYHLKRSQLYFQHFGIN------TKASCSDYLNAYYSIIPLSAN 219 I + +LV+SA HL R+ ++FQ G+N + + LN + IP Sbjct: 174 QAIGD---APFLLVTSASHLPRAMIFFQQEGLNPLPAPANQLAIDSPLNPWERAIPSPVW 230 Query: 220 FYLTELALKEYIGIL 234 +E A E +G + Sbjct: 231 LMHSERAGYETLGRI 245 >gnl|CDD|130916 TIGR01857, FGAM-synthase, phosphoribosylformylglycinamidine synthase, clade II. This model represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis. This model represents a second clade of these enzymes found in Clostridia, Bifidobacteria and Streptococcus species. This enzyme performs the fourth step in IMP biosynthesis (the precursor of all purines) from PRPP. Length = 1239 Score = 27.9 bits (62), Expect = 2.7 Identities = 27/130 (20%), Positives = 49/130 (37%), Gaps = 22/130 (16%) Query: 55 RPLLSPQWKKDGNIIVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHC 114 R ++SP++K G I L IP F F ++ + H Sbjct: 805 RRVISPEFKAAGENIYL-------IPGQALEDGTIDFDLLKENFA--QIEELIADHK--- 852 Query: 115 TIIISGGDPQKHGLAESIV---YNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNM 171 ++S + G+AES+ + N++ G E ++ +LE L T Q F + + Sbjct: 853 --VVSASAVKYGGVAESLAKMTFGNRI---GAELNNPELED--LFTAQYGSFIFESPEEL 905 Query: 172 QGKNIILVSS 181 N+ + Sbjct: 906 SIANVEKIGQ 915 >gnl|CDD|129656 TIGR00565, trpE_proteo, anthranilate synthase component I, proteobacterial subset. This enzyme resembles some other chorismate-binding enzymes, including para-aminobenzoate synthase (pabB) and isochorismate synthase. There is a fairly deep split between two sets, seen in the pattern of gaps as well as in amino acid sequence differences. This group includes proteobacteria such as E. coli and Helicobacter pylori but also the gram-positive organism Corynebacterium glutamicum. The second group includes eukaryotes, archaea, and most other bacterial lineages; sequences from the second group may resemble pabB more closely than other trpE from this group. Length = 498 Score = 26.0 bits (57), Expect = 8.8 Identities = 7/25 (28%), Positives = 12/25 (48%) Query: 97 IFETMRLYKSCKQHSMHCTIIISGG 121 +F+ +RL +S K + GG Sbjct: 107 VFDALRLLQSVKNKPKEPFAMFFGG 131 >gnl|CDD|179613 PRK03629, tolB, translocation protein TolB; Provisional. Length = 429 Score = 25.9 bits (57), Expect = 9.6 Identities = 10/22 (45%), Positives = 12/22 (54%), Gaps = 3/22 (13%) Query: 48 HLQFSYQR---PLLSPQWKKDG 66 + QF R PL+SP W DG Sbjct: 189 YNQFVVHRSPQPLMSPAWSPDG 210 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.326 0.140 0.427 Gapped Lambda K H 0.267 0.0625 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,922,114 Number of extensions: 243061 Number of successful extensions: 671 Number of sequences better than 10.0: 1 Number of HSP's gapped: 671 Number of HSP's successfully gapped: 20 Length of query: 242 Length of database: 5,994,473 Length adjustment: 91 Effective length of query: 151 Effective length of database: 4,028,145 Effective search space: 608249895 Effective search space used: 608249895 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 56 (25.6 bits)