RPSBLAST alignment of GI: 255764508 and MMDB domain: 3ca8_A_32-182

>3ca8_A (A:32-182) Protein YDCF; two domains, alpha/beta fold, helix bundle, structural genomics, structure 2 function project, S2F, unknown function; 1.80A {Escherichia coli K12}Length = 151
 Score = 85.1 bits (210), Expect = 8e-18
 Identities = 24/146 (16%), Positives = 55/146 (37%), Gaps = 8/146 (5%)

Query: 69  IVLLGNGTTIIPTIPAIRIEPSFQSYSRIFETMRLYKSCKQHSMHCTIIISGGDPQKHGL 128
           ++L GN   ++PTI A   + +      +  +  +  S                 +  G 
Sbjct: 9   VILAGNA--VMPTIDAA-CKIARDQQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRTTGR 65

Query: 129 AESIVYNNKLLE-SGVERDDIKLETQSLDTFQNAQFSSSMIK--NMQGKNIILVSSAYHL 185
           AE+ +  +   +   +  + I +E QS +  +NA+FS +++     +    I+V      
Sbjct: 66  AEATILADIAHQFWHIPHEKIWIEDQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQ 125

Query: 186 KRSQLYFQHFGINTKASCSDYLNAYY 211
           +R+   F+    +   +      +Y 
Sbjct: 126 RRTMATFRRMTGDNPDAPRWL--SYP 149