RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|255764508|ref|YP_003065363.2| hypothetical protein CLIBASIA_04245 [Candidatus Liberibacter asiaticus str. psy62] (242 letters) >d2oqoa1 d.2.1.10 (A:57-243) Penicillin-binding protein 1a, PBP1a {Aquifex aeolicus [TaxId: 63363]} Length = 187 Score = 25.7 bits (56), Expect = 4.1 Identities = 8/41 (19%), Positives = 16/41 (39%) Query: 191 YFQHFGINTKASCSDYLNAYYSIIPLSANFYLTELALKEYI 231 ++ HFGI+ A + Y + + +T+ K Sbjct: 31 FWHHFGIDPVAIVRAAIVNYRAGRIVQGGSTITQQLAKNLF 71 >d1iqva_ a.75.1.1 (A:) Ribosomal protein S7 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 201 Score = 25.2 bits (55), Expect = 5.2 Identities = 10/94 (10%), Positives = 26/94 (27%), Gaps = 16/94 (17%) Query: 96 RIFETMRLYKSCKQHSMHCTIIISGGDPQKHGLAESIVYNN-------------KLLESG 142 ++ + + H M K A +V ++L Sbjct: 56 KVMRSGGSHYKVAGHFMRREHRSLNS---KKVRAYEVVKEAFKIIEKRTGKNPIQVLVWA 112 Query: 143 VERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNI 176 +E + +T S+ + I ++ ++ Sbjct: 113 IENAAPREDTTSVMFGGIRYHVAVDISPLRRLDV 146 >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Score = 24.4 bits (53), Expect = 8.6 Identities = 11/63 (17%), Positives = 32/63 (50%), Gaps = 7/63 (11%) Query: 118 ISGGDPQKHGLAESIVYNNKLLESGVERDDIKLETQSLDTFQNAQFSSSMIKNMQGKNII 177 +SGG Q+ +A +++ ++ +L D+ T +LDT +++ + + + + Sbjct: 153 LSGGQRQRIAIARALLRDSPILIL----DEA---TSALDTESERAIQAALDELQKNRTSL 205 Query: 178 LVS 180 +++ Sbjct: 206 VIA 208 >d1ieja_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 329 Score = 24.2 bits (52), Expect = 9.1 Identities = 13/61 (21%), Positives = 21/61 (34%), Gaps = 12/61 (19%) Query: 156 DTFQNAQFSSSMIKNMQGKNIILVSSAYHLKR---SQLYFQHFGINTKASCSDYLNAYYS 212 F F K+ K+++ SA LKR + G +Y +A S Sbjct: 277 SDFHL--FGPPGKKDPVLKDLLFKDSAIMLKRVPSLMDSQLYLG-------FEYYSAIQS 327 Query: 213 I 213 + Sbjct: 328 M 328 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.326 0.140 0.427 Gapped Lambda K H 0.267 0.0593 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 929,238 Number of extensions: 42052 Number of successful extensions: 123 Number of sequences better than 10.0: 1 Number of HSP's gapped: 122 Number of HSP's successfully gapped: 12 Length of query: 242 Length of database: 2,407,596 Length adjustment: 83 Effective length of query: 159 Effective length of database: 1,268,006 Effective search space: 201612954 Effective search space used: 201612954 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.1 bits)