RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|255764509|ref|YP_003065434.2| hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase [Candidatus Liberibacter asiaticus str. psy62] (351 letters) >gnl|CDD|153081 cd00643, HMG-CoA_reductase_classI, Class I hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR). Hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR), class I enzyme, homotetramer. Catalyzes the synthesis of coenzyme A and mevalonate in isoprenoid synthesis. In mammals this is the rate limiting committed step in cholesterol biosynthesis. Class I enzymes are found predominantly in eukaryotes and contain N-terminal membrane regions. With the exception of Archaeoglobus fulgidus, most archeae are assigned to class I, based on sequence similarity of the active site, even though they lack membrane regions. Yeast and human HMGR are divergent in their N-terminal regions, but are conserved in their active site. In contrast, human and bacterial HMGR differ in their active site architecture. Length = 403 Score = 320 bits (823), Expect = 3e-88 Identities = 142/332 (42%), Positives = 188/332 (56%), Gaps = 5/332 (1%) Query: 16 IGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTRSIFFE 75 GP+ I G + VP+AT E L S RG L G ++ + MTR+ F Sbjct: 75 AGPLLINGEYAGGEFYVPMATTEGALVASTNRGCKAINLS-GGATTRVLGDGMTRAPVFR 133 Query: 76 TENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRLEFATGDASGH 135 +A A I I V E TS+ R + IAG ++LR E+ TGDA G Sbjct: 134 FPSAREAAEFKAWIEENFEAIKEVAESTSRHARLQSIKPYIAGRSVYLRFEYTTGDAMGM 193 Query: 136 NMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVAEITINRAIC 195 NMVTKA +A DWI + + S+SGN C+DKK +AIN I GRGK+ VAE TI R + Sbjct: 194 NMVTKATEAACDWIEENFPDMEVISLSGNFCTDKKPSAINWIEGRGKSVVAEATIPREVV 253 Query: 196 QKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDAANIVEGSQG 255 ++ L+T+PE ++ +N KNLIG+ +A G NAH AN++ A ++ATGQDAA +VE S Sbjct: 254 KEVLKTTPEALVEVNIAKNLIGSAMA-GSGGFNAHAANIVAAIFIATGQDAAQVVESSNC 312 Query: 256 LTYAKLH-DDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT-GDNARRLAA 313 +T +L D LY S T+P+L +G VG G +P + L LGC G NAR+LA Sbjct: 313 ITTMELTADGDLYISVTMPSLEVGTVGGGTGLPTQRECLELLGCYGAGDEPGANARKLAE 372 Query: 314 ICAATVLCGELSLLAAQTNPGELMEAHLRLER 345 I AATVL GELSLLAA G L+ +H +L R Sbjct: 373 IVAATVLAGELSLLAALAA-GHLVRSHEKLGR 403 >gnl|CDD|144090 pfam00368, HMG-CoA_red, Hydroxymethylglutaryl-coenzyme A reductase. The HMG-CoA reductases catalyse the conversion of HMG-CoA to mevalonate, which is the rate-limiting step in the synthesis of isoprenoids like cholesterol. Probably because of the critical role of this enzyme in cholesterol homeostasis, mammalian HMG-CoA reductase is heavily regulated at the transcriptional, translational, and post-translational levels. Length = 370 Score = 294 bits (756), Expect = 2e-80 Identities = 135/341 (39%), Positives = 191/341 (56%), Gaps = 12/341 (3%) Query: 6 VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65 + + +P+ GP+ I G + VP+AT E L S RGA G+ ++ Sbjct: 41 IGYVQVPLGVAGPLLING----KEYYVPMATTEGALVASANRGAKAIRAS-GGVTTRVLG 95 Query: 66 ERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAGNLLFLRL 125 + MTR+ F + A I EI E TS+ + IAG +++LR Sbjct: 96 DGMTRAPVFRFPSVRDAAEFKAWIEENFEEIKEAAESTSRHGGLQDIEPYIAGRMVYLRF 155 Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185 + TGDA G NMVTKA +A ++I ++ + ++SGN+C+DKK +AIN I GRGK+ V Sbjct: 156 IYDTGDAMGMNMVTKATEAACEFIEEEFPGMELLALSGNLCTDKKPSAINWIEGRGKSVV 215 Query: 186 AEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQD 245 AE I + +K L+T+PE ++ +NT KNL G+ LAG I NAH AN + A ++ATGQD Sbjct: 216 AEAVIPAEVVEKVLKTTPEALVEINTAKNLAGSALAGAI-GFNAHAANGVAAVFIATGQD 274 Query: 246 AANIVEGSQGLTYAKLHDDS-LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT 304 A +VE S +T + D LY S T+P+L +G VG G +P + L LG K Sbjct: 275 PAQVVESSHAITTMEGTYDGDLYGSVTLPSLEVGTVGGGTGLPTQRACLELLGV----KG 330 Query: 305 GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345 G NA++LA I AA VL GELSLLAA G L++AH++L R Sbjct: 331 GGNAKKLAEIIAAVVLAGELSLLAALAA-GHLVKAHMKLGR 370 >gnl|CDD|37691 KOG2480, KOG2480, KOG2480, 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) reductase [Lipid transport and metabolism]. Length = 602 Score = 247 bits (631), Expect = 4e-66 Identities = 129/342 (37%), Positives = 187/342 (54%), Gaps = 11/342 (3%) Query: 9 ISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERM 68 + +P+ GP+ + G VP+AT E L S RG G + L + M Sbjct: 245 MPIPVGVAGPLLLDGTEYY----VPMATTEGALVASTNRGCKAINAG-GGATSVLEKDGM 299 Query: 69 TRSIFFETENAEMALTALQEITLKKAE--IARVIEQTSQFTRFLQLHSQIAGNLLFLRLE 126 TR +A A A + + + + + TS+F R +H+ IAG L++R Sbjct: 300 TRGPVVRFPSARRAAEAKIWLESPENQEVLKKAFNSTSRFARLQSIHTTIAGRNLYIRFC 359 Query: 127 FATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFVA 186 +TGDA G NM++K + + ++ ++ + S+SGN C+DKK AIN I GRGK+ VA Sbjct: 360 TSTGDAMGMNMISKGVENALRFLSEEFPDMQVISISGNYCTDKKPAAINWIEGRGKSVVA 419 Query: 187 EITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLATGQDA 246 E TI + +K L+T+ E ++ LN KNLIG+ +AG + NAH AN++ A +LATGQD Sbjct: 420 EATIPGEVVRKVLKTTVEALVELNILKNLIGSAMAGSVGGFNAHAANIVTAVFLATGQDP 479 Query: 247 ANIVEGSQGLTYAKLHDD-SLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKT- 304 A VE S +T + D LY S T+P++ +G VG G + L LG KT Sbjct: 480 AQNVESSNCITLMEASTDGDLYISVTMPSIEVGTVGGGTVLEPQGACLDLLGVRGAHKTS 539 Query: 305 -GDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345 GDNAR+LA I AA VL GELSL+AA G L+++H++L R Sbjct: 540 PGDNARQLARIVAAAVLAGELSLMAALAA-GHLVKSHMKLNR 580 >gnl|CDD|31449 COG1257, HMG1, Hydroxymethylglutaryl-CoA reductase [Lipid metabolism]. Length = 436 Score = 213 bits (543), Expect = 6e-56 Identities = 121/353 (34%), Positives = 171/353 (48%), Gaps = 20/353 (5%) Query: 6 VSSISMPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLID 65 + ++ +P+ GP+ I G +P+AT E L S RGA + G A + + Sbjct: 66 IGTVQLPLGIAGPLLINGKEYY----IPMATTEGALVASASRGAKLITAS-GGATARVTE 120 Query: 66 ERMTRSIFFETENAEMALTALQEITLKK--AEIARVIEQTSQFTRFLQLHSQIAGNLLFL 123 + MTR F + A + K+ T + + + + + GNLL+L Sbjct: 121 DGMTRQPVFRFVSLPEAAKFAIWVKKKEIIELAKEAAPSTGRGGKLIHIEPFVEGNLLYL 180 Query: 124 RLEFATGDASGHNMVTKAADAVMDWI-LSQWSYLHYGSVSGNICSDKKATAINGIMGRGK 182 R TGDA G NMV A +AV +I + ++S N+C+DKK AIN I GRGK Sbjct: 181 RFYVDTGDAMGMNMVNIATEAVAPFIEEETFGGAVLLAISSNLCTDKKPAAINSIEGRGK 240 Query: 183 NFVAEITINRAICQKYLRTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242 VAE TI + +K L+ +PE I+ +N K L G + GI NAH AN + A AT Sbjct: 241 TVVAEATIPEEVVKKILKATPEAIVDVNRAKTLNGGAMN-GIDGFNAHTANDVRAIEAAT 299 Query: 243 GQDAANIVEGSQGLTYAKLHDDS-LYFSCTIPNLILGCVGNGKNIPAIKNNLTALGC--- 298 GQDAA + E S +T+ + D LY S T+P+L++G G G +P + L LG Sbjct: 300 GQDAAQVGEYSPLITWMEDQRDGDLYGSVTLPSLVVGTGGGGTVLPTQREALKILGVAGA 359 Query: 299 ------IEERKTGDNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345 + NA LAA+ A +L GE+SLLAA G L AH L R Sbjct: 360 GELAGVLAAVGLAQNAAALAALVAEGILAGEMSLLAALAA-GHLGAAHDELGR 411 >gnl|CDD|153080 cd00365, HMG-CoA_reductase, Hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR). Hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR) is a tightly regulated enzyme, which catalyzes the synthesis of coenzyme A and mevalonate in isoprenoid synthesis. In mammals, this is the rate limiting committed step in cholesterol biosynthesis. Bacteria, such as Pseudomonas mevalonii, which rely solely on mevalonate for their carbon source, catalyze the reverse reaction, using an NAD-dependent HMGR to deacetylate mevalonate into 3-hydroxy-3-methylglutaryl-CoA. There are two classes of HMGR: class I enzymes which are found predominantly in eukaryotes and contain N-terminal membrane regions and class II enzymes which are found primarily in prokaryotes and are soluble as they lack the membrane region. With the exception of Archaeoglobus fulgidus, most archeae are assigned to class I, based on sequence similarity of the active site, even though they lack membrane regions. Yeast and human HMGR are divergent in their N-terminal regions, but are conserved in their active site. In contrast, human and bacterial HMGR differ in their active site architecture. While the prokaryotic enzyme is a homodimer, the eukaryotic enzyme is a homotetramer. Length = 376 Score = 86.6 bits (214), Expect = 8e-18 Identities = 63/353 (17%), Positives = 109/353 (30%), Gaps = 47/353 (13%) Query: 11 MPMRWIGPMKITGNVIQDKVKVPLATYEYPLWHSVKRGAHISMLCPDGIRATLIDERMTR 70 +P +I G + VPL T E + + A ++ ++ + Sbjct: 53 LPYAVASNFQIDGRDVL----VPLVTEEPSIVAAASYMAKLARAGGGFTTSSSAPLMHAQ 108 Query: 71 SIFFETENAEMALTALQEITLKKAEIARVIEQTSQFT-----RFLQLHSQIAGNLLFLRL 125 ++ A +L K EI + + Q + G +L L Sbjct: 109 VQIVLIQDPLNAKLSLL--RSGKDEIIELANRKDQLLNSLGGGCRDIEVHTFGPMLVAHL 166 Query: 126 EFATGDASGHNMVTKAADAVMDWILSQWSYLHYGSVSGNICSDKKATAINGIMGRGKNFV 185 GDA G NM+ A+AV + + + S + + G G+ Sbjct: 167 IVDVGDAMGANMINTMAEAVAPLMEAYTGGMQVRLRSLSNLT-----------GDGRLAR 215 Query: 186 AEITINRAICQKYL---RTSPEKIILLNTQKNLIGTFLAGGIRSANAHFANMLLAYYLAT 242 A+ I + E I+ K + ++ A N N + +A Sbjct: 216 AQARITPQQLETAEFSGEAVIEGILDAYAFKAAVDSYRAAT---HNKGIMNGVDPLIVAC 272 Query: 243 GQDAANIVEGSQGL---------TYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNL 293 GQD + G+ T+ K ++ L + + + +G VG Sbjct: 273 GQDWRAVEVGAHAYACRHYGSLTTWEKDNNGHLVITLEMS-MPVGLVGGA-------TKT 324 Query: 294 TALGCIEERKTG-DNARRLAAICAATVLCGELSLLAAQTNPGELMEAHLRLER 345 L R G A+ LA I A L L + A G + H+ L Sbjct: 325 HPLAQASLRILGVKTAQALARIAVAVGLAQNLGAMRALATEG-IQRGHMALHA 376 >gnl|CDD|146977 pfam04596, Pox_F15, Poxvirus protein F15. Length = 137 Score = 30.4 bits (69), Expect = 0.78 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 5/52 (9%) Query: 256 LTYAKLHDDSLYFSCTIPNLILGCVGNGKNIPAIKNNLTALGCIEERKTGDN 307 L Y+ H + +P+ +L C+ A KNN T CI + + D+ Sbjct: 57 LLYSPFHFQQPQYQYLLPSFVLKCIDE-----ANKNNKTCKYCITNKGSDDD 103 >gnl|CDD|153082 cd00644, HMG-CoA_reductase_classII, Class II hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR). Hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR), class II, prokaryotic enzyme is a homodimer. Class II enzymes are found primarily in prokaryotes and Archaeoglobus fulgidus and are soluble as they lack the membrane region. Enzymes catalyze the synthesis of coenzyme A and mevalonate in isoprenoid synthesis. Bacteria, such as Pseudomonas mevalonii, which rely solely on mevalonate for their carbon source, catalyze the reverse reaction, using an NAD-dependent HMGR to deacetylate mevalonate into 3-hydroxy-3-methylglutaryl-CoA. Human and bacterial HMGR differ in their active site architecture. Length = 417 Score = 29.8 bits (68), Expect = 1.3 Identities = 27/91 (29%), Positives = 37/91 (40%), Gaps = 23/91 (25%) Query: 240 LATGQD-----------AANIVEGS-QGLTYAKLHDDSLYFSCTIPNLILGCVGNGKNI- 286 LATG D AA G + L+ ++ D L +P L +G VG + Sbjct: 270 LATGNDWRAVEAGAHAYAAR--SGQYRSLSTWEIDDGKLVGELELP-LAVGTVGGSTKVH 326 Query: 287 PAIKNNLTALGCIEERKTGDNARRLAAICAA 317 P K L LG + +A+ LA I AA Sbjct: 327 PLAKLALKILG-VP------SAKELAEIIAA 350 >gnl|CDD|185732 cd08991, GH43_bXyl_2, Glycosyl hydrolase family 43. This glycosyl hydrolase family 43 (GH43) includes enzymes that have been characterized with xylan-digesting beta-xylosidase (EC 3.2.1.37) and xylanase (endo-alpha-L-arabinanase) activities. These are all inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller. Length = 294 Score = 28.5 bits (64), Expect = 3.1 Identities = 7/17 (41%), Positives = 10/17 (58%) Query: 133 SGHNMVTKAADAVMDWI 149 +GHN V K+ D +I Sbjct: 244 TGHNSVVKSPDGGELYI 260 >gnl|CDD|38856 KOG3651, KOG3651, KOG3651, Protein kinase C, alpha binding protein [Signal transduction mechanisms]. Length = 429 Score = 28.1 bits (62), Expect = 3.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Query: 199 LRTSPEKIILLNTQKNLIGTFLAGG 223 +R E + L +KNLIG + GG Sbjct: 1 MRIQSETVELTKDEKNLIGISIGGG 25 >gnl|CDD|32461 COG2307, COG2307, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 313 Score = 28.0 bits (62), Expect = 4.2 Identities = 13/56 (23%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 63 LIDERMTRSIFFETENAEMALTALQEITLKKAEIARVIEQTSQFTRFLQLHSQIAG 118 L+DE RS+ ++ E E L+ L + R+ + L+L + A Sbjct: 224 LLDELNPRSLLYQLEELEANLSELPGSFGSRHGAHRMAGRLR---ASLRLELEAAI 276 >gnl|CDD|32270 COG2087, CobU, Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase [Coenzyme metabolism]. Length = 175 Score = 26.7 bits (59), Expect = 9.6 Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 6/33 (18%) Query: 218 TFLAGGIRSANAHFANMLLA------YYLATGQ 244 + GG RS + FA L Y+ATG+ Sbjct: 3 ILVTGGARSGKSSFAEALAGESGGQVLYVATGR 35 >gnl|CDD|133096 cd06238, Peptidase_M14-like_1_1, Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The A forms have slightly different specificities, with Carboxypeptidase A1 (CPA1) preferring aliphatic and small aromatic residues, and CPA2 preferring the bulky aromatic side chains. Enzymes belonging to the N/E subfamily enzymes are not produced as inactive precursors and instead rely on their substrate specificity and subcellular compartmentalization to prevent inappropriate cleavage. They contain an extra C-terminal transthyretin-like domain, thought to be involved in folding or formation of oligomers. MCPs can also be classified based on their involvement in specific physiological processes; the pancreatic MCPs participate only in alimentary digestion and include carboxypeptidase A and B (A/B subfamily), while others, namely regulatory MCPs or the N/E subfamily, are involved in more selective reactions, mainly in non-digestive tissues and fluids, acting on blood coagulation/fibrinolysis, inflammation and local anaphylaxis, pro-hormone and neuropeptide processing, cellular response and others. Another MCP subfamily, is that of succinylglutamate desuccinylase /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate (NAA), and deficiency in which is the established cause of Canavan disease. Another subfamily (referred to as subfamily C) includes an exceptional type of activity in the MCP family, that of dipeptidyl-peptidase activity of gamma-glutamyl-(L)-meso-diaminopimelate peptidase I which is involved in bacterial cell wall metabolism. Length = 271 Score = 26.8 bits (60), Expect = 9.6 Identities = 7/16 (43%), Positives = 9/16 (56%) Query: 232 ANMLLAYYLATGQDAA 247 A +L AY+LA Q Sbjct: 67 AALLTAYHLAAAQGDE 82 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.134 0.395 Gapped Lambda K H 0.267 0.0722 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,013,608 Number of extensions: 202396 Number of successful extensions: 437 Number of sequences better than 10.0: 1 Number of HSP's gapped: 418 Number of HSP's successfully gapped: 15 Length of query: 351 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 256 Effective length of database: 4,210,882 Effective search space: 1077985792 Effective search space used: 1077985792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.1 bits)