BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|255764510|ref|YP_003065448.2| uroporphyrinogen-III synthase [Candidatus Liberibacter asiaticus str. psy62] (232 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|255764510|ref|YP_003065448.2| uroporphyrinogen-III synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 232 Score = 477 bits (1227), Expect = e-137, Method: Compositional matrix adjust. Identities = 232/232 (100%), Positives = 232/232 (100%) Query: 1 MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESL 60 MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESL Sbjct: 1 MYIVITRPIKKALRTQEKIQKMGYIPVMMPLSYFIHDRESVFLAMQQSYGAIAITSSESL 60 Query: 61 STLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLI 120 STLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLI Sbjct: 61 STLPANFCRHTPIFAIGEASACLARQKGFTQIFHGKDNSINLAKIIVEQKVLFTPQKPLI 120 Query: 121 YLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLY 180 YLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLY Sbjct: 121 YLGGKPRNFHFEDYLIEHKIPLRVIDCYYSQDIAYPETTMKNLLQNADAILFYARSSVLY 180 Query: 181 FFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPLRR 232 FFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPLRR Sbjct: 181 FFSLPLPAKISAAFLCLSNNIASAIPASYKNVVTVACFPKETSLLKLLPLRR 232 >gi|254780743|ref|YP_003065156.1| putative uracil-DNA glycosylase [Candidatus Liberibacter asiaticus str. psy62] Length = 261 Score = 24.6 bits (52), Expect = 1.5, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query: 105 IIVEQKVLFTPQKPLIYLGGKPRNFHFED 133 II+ Q L +P K L+++G K +NF F + Sbjct: 177 IIMRQIELISP-KILLFIGNKTKNFFFNN 204 >gi|254781003|ref|YP_003065416.1| hypothetical protein CLIBASIA_04520 [Candidatus Liberibacter asiaticus str. psy62] Length = 304 Score = 24.6 bits (52), Expect = 1.6, Method: Compositional matrix adjust. Identities = 10/45 (22%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Query: 29 MPLSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPI 73 +P+ YF+ D+ + +Q+S+ I + + + + + H PI Sbjct: 255 IPIDYFVMDQNAYKFLIQESFSEI-LYNEDDIKSRGKRLSDHCPI 298 >gi|254780995|ref|YP_003065408.1| Endonuclease/exonuclease/phosphatase [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 23.9 bits (50), Expect = 2.6, Method: Compositional matrix adjust. Identities = 11/43 (25%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Query: 31 LSYFIHDRESVFLAMQQSYGAIAITSSESLSTLPANFCRHTPI 73 L YF+ DR++ + S+ ++ S+ L T + H P+ Sbjct: 73 LDYFVIDRDNKNFLIDNSFSIVSYDQSD-LDTRRSKLSTHCPL 114 >gi|254780939|ref|YP_003065352.1| type I signal peptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 248 Score = 22.3 bits (46), Expect = 8.4, Method: Compositional matrix adjust. Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 96 KDNSINLAK-IIVEQKVLFTPQKPLIYLGGKPRNFHFEDYLIEH 138 KD SI+ K +I + +K +IY+ G P H E Y H Sbjct: 97 KDPSIDYVKRVIGLPGDRISLEKGIIYINGAPVVRHMEGYFSYH 140 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.138 0.405 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 142,641 Number of Sequences: 1233 Number of extensions: 5476 Number of successful extensions: 26 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 20 Number of HSP's gapped (non-prelim): 7 length of query: 232 length of database: 328,796 effective HSP length: 71 effective length of query: 161 effective length of database: 241,253 effective search space: 38841733 effective search space used: 38841733 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 37 (18.9 bits)